BP921850
Clone id YMU001_000154_H06
Library
Length 527
Definition Adiantum capillus-veneris mRNA. clone: YMU001_000154_H06.
Accession
Tissue type prothallium
Developmental stage -
Contig ID
Sequence
TTTGAGACTAAAAAATCATGAATAATTGCGGAGGTTTTAAATGTCACATGCAAGGAGCGG
AGATTTCTCCACACTTGCTCCATTCTAAAGGACCTTGCCTTCCAGACACTCTGCTGCCAC
CTCCTGCTCTTCAGCTAGTGACAATTGGGAGTCCTCCCCATTTTGCTTTAAAATGCAAAA
GTCCATTCGAATCAGCCCTCTCTTCATTTTCTGTGTTGCTAATCGCACTCTGCAACCCCC
TAGGGCTAGCAGGTGTTTCATCAACTGGTGCATCCACTGCCCCAGAATGTGAGCAAAAAC
CATTCTCAACAATTTGCGATACTCGCTCCTCGACATTCAGATTTTCACCTGAAAGTTCCT
CCAAAGCCCCATTTTGCGTCCCGCATTCAAAAATAACAGAAGCCACTCCAGTTTCCGCTG
CTTGCTCTTCAATGTGTACATCTTCATTGCTGTGTAAGTGGGCCTCTGAAAATTCAAAAG
TCTCTAAGTGTGCTTTGTCATCTAGCTGGGAATCGTCTTTATTATCG
■■Homology search results ■■ -
sp_hit_id Q58556
Definition sp|Q58556|Y1156_METJA Cell division cycle protein 48 homolog MJ1156 OS=Methanocaldococcus jannaschii
Align length 116
Score (bit) 32.7
E-value 1.1
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP921850|Adiantum capillus-veneris mRNA, clone:
YMU001_000154_H06.
(527 letters)

Database: uniprot_sprot.fasta
412,525 sequences; 148,809,765 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

sp|Q58556|Y1156_METJA Cell division cycle protein 48 homolog MJ1... 33 1.1
sp|Q94F57|AGP26_ARATH Classical arabinogalactan protein 26 OS=Ar... 32 1.4
sp|P44715|PTFAH_HAEIN Multiphosphoryl transfer protein OS=Haemop... 32 2.4
sp|P70040|FEN1A_XENLA Flap endonuclease 1-A OS=Xenopus laevis GN... 32 2.4
sp|Q6PIJ6|FBX38_HUMAN F-box only protein 38 OS=Homo sapiens GN=F... 31 3.2
sp|Q4W5Z4|DNM3A_CHICK DNA (cytosine-5)-methyltransferase 3A OS=G... 31 3.2
sp|B1Y1G9|SYA_LEPCP Alanyl-tRNA synthetase OS=Leptothrix cholodn... 31 4.1
sp|Q3ZJ90|RPOC2_PSEAK DNA-directed RNA polymerase subunit beta''... 31 4.1
sp|Q5DTT1|K2022_MOUSE Uncharacterized protein KIAA2022 OS=Mus mu... 31 4.1
sp|A1CUF9|ATG2_ASPCL Autophagy-related protein 2 OS=Aspergillus ... 31 4.1
sp|Q7Z5H3|RHG22_HUMAN Rho GTPase-activating protein 22 OS=Homo s... 30 5.4
sp|Q9BE45|IKBZ_BOVIN NF-kappa-B inhibitor zeta OS=Bos taurus GN=... 30 5.4
sp|A0JPH4|SCAP_XENLA Sterol regulatory element-binding protein c... 30 7.1
sp|Q5SS00|ZDBF2_MOUSE DBF4-type zinc finger-containing protein 2... 30 9.2
sp|Q5VWQ0|RSBN1_HUMAN Round spermatid basic protein 1 OS=Homo sa... 30 9.2
sp|P51533|PDR10_YEAST ATP-dependent permease PDR10 OS=Saccharomy... 30 9.2
sp|O74208|PDH1_CANGA ATP-binding cassette transporter CGR1 OS=Ca... 30 9.2
sp|Q0CQH1|NOP58_ASPTN Nucleolar protein nop58 OS=Aspergillus ter... 30 9.2
sp|P92567|M1410_ARATH Uncharacterized mitochondrial protein AtMg... 30 9.2
sp|P41911|GPD2_YEAST Glycerol-3-phosphate dehydrogenase [NAD+] 2... 30 9.2

>sp|Q58556|Y1156_METJA Cell division cycle protein 48 homolog MJ1156
OS=Methanocaldococcus jannaschii GN=MJ1156 PE=3 SV=1
Length = 903

Score = 32.7 bits (73), Expect = 1.1
Identities = 31/116 (26%), Positives = 52/116 (44%), Gaps = 4/116 (3%)
Frame = -2

Query: 502 DDKAHLETFEFSEAHLHSNEDVHIEEQAAET-GVASVIFECGTQNGAL---EELSGENLN 335
D+KA L+ F+ ++ EDV++EE A +T G E + A+ E G+ +
Sbjct: 622 DEKARLDIFKIHTRSMNLAEDVNLEELAKKTEGYTGADIEALCREAAMLAVRESIGKPWD 681

Query: 334 VEERVSQIVENGFCSHSGAVDAPVDETPASPRGLQSAISNTENEERADSNGLLHFK 167
+E ++ +++ N S SG A E L S I T+ E A++ K
Sbjct: 682 IEVKLRELI-NYLQSISGTFRAAAVE-------LNSVIKATKERESAEAGEFSELK 729


>sp|Q94F57|AGP26_ARATH Classical arabinogalactan protein 26
OS=Arabidopsis thaliana GN=AGP26 PE=2 SV=2
Length = 136

Score = 32.3 bits (72), Expect = 1.4
Identities = 21/63 (33%), Positives = 31/63 (49%), Gaps = 3/63 (4%)
Frame = +3

Query: 57 AEISPHLLHSKGPCLPDTLLPPPALQLVTIGSP-PHFALKC--KSPFESALSSFSVLLIA 227
+ I P + S P PD + P P L++ +GSP P + C S S L +LL+A
Sbjct: 72 SSIMPTIPSSLSPPNPDAVTPDPLLEVSPVGSPLPASSSVCLVSSQLSSLLLVLLMLLLA 131

Query: 228 LCN 236
C+
Sbjct: 132 FCS 134


>sp|P44715|PTFAH_HAEIN Multiphosphoryl transfer protein
OS=Haemophilus influenzae GN=fruB PE=3 SV=1
Length = 499

Score = 31.6 bits (70), Expect = 2.4
Identities = 18/68 (26%), Positives = 34/68 (50%)
Frame = -2

Query: 475 EFSEAHLHSNEDVHIEEQAAETGVASVIFECGTQNGALEELSGENLNVEERVSQIVENGF 296
E SE+++H N + ++QA E V++++ +NG L+ + L + S + NG
Sbjct: 3 ELSESNIHLNANAIDKQQAIEMAVSALVQAGNVENGYLQGMLAREL----QTSTFLGNGI 58

Query: 295 CSHSGAVD 272
G +D
Sbjct: 59 AIPHGTLD 66


>sp|P70040|FEN1A_XENLA Flap endonuclease 1-A OS=Xenopus laevis
GN=fen1-A PE=1 SV=1
Length = 382

Score = 31.6 bits (70), Expect = 2.4
Identities = 27/127 (21%), Positives = 57/127 (44%), Gaps = 1/127 (0%)
Frame = -2

Query: 523 NKDDSQLDDKAHLETFEFSEAHLHSN-EDVHIEEQAAETGVASVIFECGTQNGALEELSG 347
+K ++ D L+ + E LH + + +E + +T + + + + G + + G
Sbjct: 253 HKTIDEIIDNIDLKKYPVPENWLHKEAKHLFLEPEVVDTDITELKWIEPDEEGLVAFMCG 312

Query: 346 ENLNVEERVSQIVENGFCSHSGAVDAPVDETPASPRGLQSAISNTENEERADSNGLLHFK 167
E E+R+ + + G+ +D+ + ++S+T+ +E A+S G K
Sbjct: 313 EKQFSEDRIRNGAKKLAKNRQGSTQGRLDDFFK----VTGSVSSTKRKE-AESKGSAKKK 367

Query: 166 AKWGGLP 146
AK GG P
Sbjct: 368 AKTGGTP 374


>sp|Q6PIJ6|FBX38_HUMAN F-box only protein 38 OS=Homo sapiens
GN=FBXO38 PE=1 SV=3
Length = 1188

Score = 31.2 bits (69), Expect = 3.2
Identities = 29/111 (26%), Positives = 46/111 (41%), Gaps = 7/111 (6%)
Frame = -2

Query: 469 SEAHLHSNEDVHIEEQAAETGVASVIFECGTQNGALEELSGENLNVEERVSQIVENG--F 296
+ A++H N H ++ E + + G Q A + L+ V+E + E+G
Sbjct: 504 NNANIHDNNHHHPDDSDEENDFRQDL-QPGEQQFAADALNEMEDIVQEDGEVVAESGNNT 562

Query: 295 CSHSGAV-DAPVDETPASPRGLQSAISNT----ENEERADSNGLLHFKAKW 158
+HS A+ VDE A P GLQ + T + E D L + W
Sbjct: 563 PAHSQAIIPVDVDEEQAGPSGLQRVVKPTSITVHDSESDDEEDSLELQEVW 613


>sp|Q4W5Z4|DNM3A_CHICK DNA (cytosine-5)-methyltransferase 3A
OS=Gallus gallus GN=DNMT3A PE=2 SV=1
Length = 877

Score = 31.2 bits (69), Expect = 3.2
Identities = 22/72 (30%), Positives = 35/72 (48%), Gaps = 8/72 (11%)
Frame = -2

Query: 376 QNGALEELSGENLNVEERVSQIVENGFCSHSGAVDAPVDE------TPASPRGLQSAISN 215
++G EE E+L + + +ENG C+ +DAP DE P RG + +
Sbjct: 53 KSGRPEEDETESL-ADGETGRALENGRCTPKEGLDAPADEGELAPSDPQKKRGRRKLLEA 111

Query: 214 TE--NEERADSN 185
TE EE+ ++N
Sbjct: 112 TEKSKEEKEENN 123


>sp|B1Y1G9|SYA_LEPCP Alanyl-tRNA synthetase OS=Leptothrix cholodnii
(strain ATCC 51168 / LMG 8142 / SP-6) GN=alaS PE=3 SV=1
Length = 875

Score = 30.8 bits (68), Expect = 4.1
Identities = 24/86 (27%), Positives = 40/86 (46%)
Frame = -2

Query: 460 HLHSNEDVHIEEQAAETGVASVIFECGTQNGALEELSGENLNVEERVSQIVENGFCSHSG 281
H+ + D+ + + AE+GVA+ I +E ++G+N + + NG S
Sbjct: 670 HVKATGDIGLFKVVAESGVAAGIRR-------IEAITGDNALAYLQSLESTVNGVAS--- 719

Query: 280 AVDAPVDETPASPRGLQSAISNTENE 203
A+ + V E PA GLQ + E E
Sbjct: 720 ALKSAVPEVPARISGLQDQVRALEKE 745


>sp|Q3ZJ90|RPOC2_PSEAK DNA-directed RNA polymerase subunit beta''
OS=Pseudendoclonium akinetum GN=rpoC2 PE=3 SV=1
Length = 3462

Score = 30.8 bits (68), Expect = 4.1
Identities = 19/46 (41%), Positives = 22/46 (47%)
Frame = +2

Query: 68 STLAPF*RTLPSRHSAATSCSSASDNWESSPFCFKMQKSIRISPLF 205
ST APF R+ +R SA S A W F QKSIR +F
Sbjct: 2672 STFAPFARSSKARGSAKAIFSQAQRLWGEESFINDKQKSIRNQIIF 2717


>sp|Q5DTT1|K2022_MOUSE Uncharacterized protein KIAA2022 OS=Mus
musculus GN=Kiaa2022 PE=2 SV=2
Length = 1515

Score = 30.8 bits (68), Expect = 4.1
Identities = 27/78 (34%), Positives = 42/78 (53%)
Frame = +3

Query: 75 LLHSKGPCLPDTLLPPPALQLVTIGSPPHFALKCKSPFESALSSFSVLLIALCNPLGLAG 254
++ + P P LLPPP+ + + SPP ++P SA +S SV I+L + G+A
Sbjct: 52 VIQKESPMFPRGLLPPPS-KKPCMQSPPSPLALIEAPDHSA-NSASVNAISLTS--GVAK 107

Query: 255 VSSTGASTAPECEQKPFS 308
+T S ECE+ PF+
Sbjct: 108 GLNTW-SLPNECEKAPFA 124


>sp|A1CUF9|ATG2_ASPCL Autophagy-related protein 2 OS=Aspergillus
clavatus GN=atg2 PE=3 SV=1
Length = 2131

Score = 30.8 bits (68), Expect = 4.1
Identities = 18/49 (36%), Positives = 26/49 (53%), Gaps = 3/49 (6%)
Frame = +3

Query: 150 SPPHFALKCKS---PFESALSSFSVLLIALCNPLGLAGVSSTGASTAPE 287
+PP A+K ++ P E L+SFS + +P AGVS S AP+
Sbjct: 1455 TPPSVAVKYRTEVLPLEDMLASFSGDAFTMDSPHDQAGVSEVSVSAAPD 1503


tr_hit_id A2FQ26
Definition tr|A2FQ26|A2FQ26_TRIVA Putative uncharacterized protein OS=Trichomonas vaginalis G3
Align length 75
Score (bit) 36.2
E-value 1.0
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP921850|Adiantum capillus-veneris mRNA, clone:
YMU001_000154_H06.
(527 letters)

Database: uniprot_trembl.fasta
7,341,751 sequences; 2,391,615,440 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

tr|A2FQ26|A2FQ26_TRIVA Putative uncharacterized protein OS=Trich... 36 1.0
tr|Q297Q9|Q297Q9_DROPS GA12942 OS=Drosophila pseudoobscura pseud... 35 1.8
tr|B6GZ90|B6GZ90_PENCH Pc12g09300 protein OS=Penicillium chrysog... 34 4.0
tr|B7C155|B7C155_9FIRM Putative uncharacterized protein OS=Roseb... 34 5.2
tr|B1LVA3|B1LVA3_METRJ Methyl-accepting chemotaxis sensory trans... 33 6.7
tr|Q2QP54|Q2QP54_ORYSJ Elongation factor Ts OS=Oryza sativa subs... 33 6.7
tr|A2ZLC1|A2ZLC1_ORYSI Elongation factor Ts OS=Oryza sativa subs... 33 6.7
tr|Q86S97|Q86S97_BABRO Putative uncharacterized protein Br-6 (Fr... 33 6.7
tr|Q86S96|Q86S96_BABRO Putative uncharacterized protein Br-7 OS=... 33 6.7
tr|Q4UCR7|Q4UCR7_THEAN Putative uncharacterized protein OS=Theil... 33 6.7
tr|A6RSJ6|A6RSJ6_BOTFB Putative uncharacterized protein OS=Botry... 33 6.7
tr|A6RH37|A6RH37_AJECN Predicted protein OS=Ajellomyces capsulat... 33 6.7
tr|B4FJE9|B4FJE9_MAIZE Putative uncharacterized protein OS=Zea m... 33 8.8
tr|Q1EC76|Q1EC76_DROME IP15543p OS=Drosophila melanogaster GN=Dg... 33 8.8

>tr|A2FQ26|A2FQ26_TRIVA Putative uncharacterized protein
OS=Trichomonas vaginalis G3 GN=TVAG_261690 PE=4 SV=1
Length = 952

Score = 36.2 bits (82), Expect = 1.0
Identities = 24/75 (32%), Positives = 39/75 (52%), Gaps = 4/75 (5%)
Frame = -2

Query: 514 DSQLDDKAHLETFEFSEAHL--HSNEDVHIEEQAAETGVASVIFECGTQNGALEELSGEN 341
+ + +++ HLE E E HL NE++H+EE+ E + E + ++E EN
Sbjct: 417 EEEENEEIHLEEEENEEIHLEEEENEEIHLEEEENEENNEEKVQE---KENIIDENKEEN 473

Query: 340 L--NVEERVSQIVEN 302
+ NVEE +I EN
Sbjct: 474 IEQNVEEEEEKIEEN 488


>tr|Q297Q9|Q297Q9_DROPS GA12942 OS=Drosophila pseudoobscura
pseudoobscura GN=GA12942 PE=4 SV=2
Length = 822

Score = 35.4 bits (80), Expect = 1.8
Identities = 30/113 (26%), Positives = 47/113 (41%)
Frame = -2

Query: 526 DNKDDSQLDDKAHLETFEFSEAHLHSNEDVHIEEQAAETGVASVIFECGTQNGALEELSG 347
DN+ D+ D E SE + EDV IEE E + E +Q GA E++
Sbjct: 229 DNRGDNDEDGDYEEEDDSESENDNENEEDVEIEENGGEE-ATDITGE--SQEGANEDVKD 285

Query: 346 ENLNVEERVSQIVENGFCSHSGAVDAPVDETPASPRGLQSAISNTENEERADS 188
E+ E++ V++G H D + A G + +N+ + DS
Sbjct: 286 ESREDEKQEDNKVQSG---HGDQFDRSTEGPKADESGNEDPPANSTESQSTDS 335


>tr|B6GZ90|B6GZ90_PENCH Pc12g09300 protein OS=Penicillium
chrysogenum Wisconsin 54-1255 GN=Pc12g09300 PE=4 SV=1
Length = 619

Score = 34.3 bits (77), Expect = 4.0
Identities = 32/115 (27%), Positives = 51/115 (44%), Gaps = 1/115 (0%)
Frame = -2

Query: 526 DNKDDSQLDDKAHLETFEFSEAHLHSNEDVHIEEQAAETGVASVIFECG-TQNGALEELS 350
+ ++ +++ + E E E N +V IEE A E V E G TQ G EE
Sbjct: 489 EQNEEVDIEEPGNEEESEEVENEEAENGEVEIEEPANEVENEEVEIEQGQTQEGQSEE-- 546

Query: 349 GENLNVEERVSQIVENGFCSHSGAVDAPVDETPASPRGLQSAISNTENEERADSN 185
EN +VE+ E G +G+ + P D + + N+E+ E +DS+
Sbjct: 547 -ENEDVEDDDVDS-EEGQNEAAGSQEGPADAQTEERQDKDDSEDNSEDTEGSDSD 599


>tr|B7C155|B7C155_9FIRM Putative uncharacterized protein
OS=Roseburia intestinalis L1-82 GN=ROSINTL182_02748 PE=4
SV=1
Length = 372

Score = 33.9 bits (76), Expect = 5.2
Identities = 32/126 (25%), Positives = 55/126 (43%), Gaps = 18/126 (14%)
Frame = -2

Query: 526 DNKDDSQLDDKAHL--ETFEFSEAHLHSNEDVHIEEQAAETGVASVIFECGTQNGALE-- 359
D + S+ D A L T+E S H +S+E+V A+T I +C
Sbjct: 217 DATEQSEPDYPAPLTKNTYEKSIRHQNSDENVVCHGFVADTSAQRDITDCFKHGWTASKK 276

Query: 358 ------ELSGENLNVEER--------VSQIVENGFCSHSGAVDAPVDETPASPRGLQSAI 221
++ G N++V+ R V++I+ +G H+ +DA DET L + +
Sbjct: 277 GDSITLDVEGCNISVQYRKSVKLPAPVAEIIVDGDAEHAVRLDANFDETWGDKLELDTIL 336

Query: 220 SNTENE 203
+ EN+
Sbjct: 337 EHGENK 342


>tr|B1LVA3|B1LVA3_METRJ Methyl-accepting chemotaxis sensory
transducer with Pas/Pac sensor OS=Methylobacterium
radiotolerans (strain ATCC 27329 / DSM 1819 / JCM 2831)
GN=Mrad2831_0537 PE=4 SV=1
Length = 486

Score = 33.5 bits (75), Expect = 6.7
Identities = 26/96 (27%), Positives = 44/96 (45%)
Frame = -2

Query: 451 SNEDVHIEEQAAETGVASVIFECGTQNGALEELSGENLNVEERVSQIVENGFCSHSGAVD 272
S E + ++A +SV NGA++E+SG+ V ER QI + +G D
Sbjct: 268 SAEGLMQSAESARHKASSVASSSEQMNGAIQEISGQVGRVSERAQQI-----AAQAGTTD 322

Query: 271 APVDETPASPRGLQSAISNTENEERADSNGLLHFKA 164
A + + + R + + +S ++ AD LL A
Sbjct: 323 ATMRQLAENARKVDAVVSMIKS--IADQTNLLALNA 356


>tr|Q2QP54|Q2QP54_ORYSJ Elongation factor Ts OS=Oryza sativa subsp.
japonica GN=Os12g0541500 PE=3 SV=1
Length = 1123

Score = 33.5 bits (75), Expect = 6.7
Identities = 25/111 (22%), Positives = 44/111 (39%)
Frame = -2

Query: 523 NKDDSQLDDKAHLETFEFSEAHLHSNEDVHIEEQAAETGVASVIFECGTQNGALEELSGE 344
++DDS +DDK T S S ED A+ V +V+ E + E+
Sbjct: 519 SEDDSTVDDKLVEPTASVSATEAESKEDSSEGSVASTESVTAVVEESAPVSSVAIEVPAP 578

Query: 343 NLNVEERVSQIVENGFCSHSGAVDAPVDETPASPRGLQSAISNTENEERAD 191
+ E +I+E+ A D V+ P G++ + + + A+
Sbjct: 579 EAS-EASAQEIIEDSTTVEGAADDQTVESDSPPPEGVELSSNGAPDSSIAE 628


>tr|A2ZLC1|A2ZLC1_ORYSI Elongation factor Ts OS=Oryza sativa subsp.
indica GN=OsI_38621 PE=3 SV=1
Length = 1123

Score = 33.5 bits (75), Expect = 6.7
Identities = 25/111 (22%), Positives = 44/111 (39%)
Frame = -2

Query: 523 NKDDSQLDDKAHLETFEFSEAHLHSNEDVHIEEQAAETGVASVIFECGTQNGALEELSGE 344
++DDS +DDK T S S ED A+ V +V+ E + E+
Sbjct: 519 SEDDSTVDDKLVEPTASVSATEAESKEDSSEGSVASTESVTAVVEESAPVSSVAIEVPAP 578

Query: 343 NLNVEERVSQIVENGFCSHSGAVDAPVDETPASPRGLQSAISNTENEERAD 191
+ E +I+E+ A D V+ P G++ + + + A+
Sbjct: 579 EAS-EASAQEIIEDSTTVEGAADDQTVESDSPPPEGVELSSNGAPDSSIAE 628


>tr|Q86S97|Q86S97_BABRO Putative uncharacterized protein Br-6
(Fragment) OS=Babesia rodhaini GN=Br-6 PE=2 SV=1
Length = 347

Score = 33.5 bits (75), Expect = 6.7
Identities = 27/113 (23%), Positives = 49/113 (43%), Gaps = 3/113 (2%)
Frame = -2

Query: 526 DNKDDSQLDDKAHLETFEFSEAHLHSNEDVHIEEQAAETGVASVIFECGTQNGALEEL-- 353
D++ D++ ++ + E + +E++ EE T V +V Q G EEL
Sbjct: 54 DDEGDTEGEEISDSEDYVTDNDENSEHENIESEEV---TSVETVPVSADEQEGEQEELTI 110

Query: 352 -SGENLNVEERVSQIVENGFCSHSGAVDAPVDETPASPRGLQSAISNTENEER 197
S E + E ++ E+ H ++A DE+ + QSA + EE+
Sbjct: 111 QSQEAKEIREHNPEVTEDRLDGHESGMEATTDESKSDDTLDQSADGEIKGEEQ 163


>tr|Q86S96|Q86S96_BABRO Putative uncharacterized protein Br-7
OS=Babesia rodhaini GN=Br-7 PE=2 SV=1
Length = 744

Score = 33.5 bits (75), Expect = 6.7
Identities = 27/113 (23%), Positives = 49/113 (43%), Gaps = 3/113 (2%)
Frame = -2

Query: 526 DNKDDSQLDDKAHLETFEFSEAHLHSNEDVHIEEQAAETGVASVIFECGTQNGALEEL-- 353
D++ D++ ++ + E + +E++ EE T V +V Q G EEL
Sbjct: 451 DDEGDTEGEEISDSEDYVTDNDENSEHENIESEEV---TSVETVPVSADEQEGEQEELTI 507

Query: 352 -SGENLNVEERVSQIVENGFCSHSGAVDAPVDETPASPRGLQSAISNTENEER 197
S E + E ++ E+ H ++A DE+ + QSA + EE+
Sbjct: 508 QSQEAKEIREHNPEVTEDRLDGHESGMEATTDESKSDDTLDQSADGEIKGEEQ 560


>tr|Q4UCR7|Q4UCR7_THEAN Putative uncharacterized protein
OS=Theileria annulata GN=TA05435 PE=4 SV=1
Length = 439

Score = 33.5 bits (75), Expect = 6.7
Identities = 26/92 (28%), Positives = 40/92 (43%), Gaps = 7/92 (7%)
Frame = -2

Query: 526 DNKDDSQLD--DKAHLETFEFSEAHLHSNED--VHIEEQAAETGVASVIFECGTQNGALE 359
D +DD +LD +ET +F E SN D ++ + + ++ + N L
Sbjct: 132 DLRDDCKLDKISNCSIETPDFIETDNESNYDDNLNYNNHSTDNQSSNYFSDLNFDNSCLN 191

Query: 358 ELSGENLNVEERVSQIVENGF---CSHSGAVD 272
E NLN EE + + +GF CS VD
Sbjct: 192 EDHENNLNPEETENSTLSSGFDDSCSIDDCVD 223