DK943658
Clone id YMU02A01NGRL0003_I14
Library
Length 185
Definition Adiantum capillus-veneris mRNA. clone: YMU02A01NGRL0003_I14. 5' end sequence.
Accession
Tissue type young leaves
Developmental stage sporophyte
Contig ID -
Sequence
ATACTCGTCATTTCTTATACTTCCCTACCCCCTTCACAACCAAAAAGTTTTGAAGGAAAA
CCTGACCTCCAGCCTCCACCCCCAAGAACCTTTCAAGACAACTTCTTTGATCTCGCGAAC
CATATAGACAAGAAATTATGCATTAAGTTGATTGCAAATAGAGCGGGTGCTGGAACATTG
CTTGG
■■Homology search results ■■ -
sp_hit_id O43365
Definition sp|O43365|HXA3_HUMAN Homeobox protein Hox-A3 OS=Homo sapiens
Align length 22
Score (bit) 31.6
E-value 1.3
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= DK943658|Adiantum capillus-veneris mRNA, clone:
YMU02A01NGRL0003_I14, 5'
(185 letters)

Database: uniprot_sprot.fasta
412,525 sequences; 148,809,765 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

sp|O43365|HXA3_HUMAN Homeobox protein Hox-A3 OS=Homo sapiens GN=... 32 1.3
sp|Q6DCV1|AB1IP_XENLA Amyloid beta A4 precursor protein-binding ... 31 1.7
sp|O82221|RUXG_ARATH Probable small nuclear ribonucleoprotein G ... 30 4.8
sp|Q9HC56|PCDH9_HUMAN Protocadherin-9 OS=Homo sapiens GN=PCDH9 P... 30 4.8
sp|Q9C0D6|FHDC1_HUMAN FH2 domain-containing protein 1 OS=Homo sa... 30 4.8
sp|P83404|DEFI_PHLDU Defensin OS=Phlebotomus duboscqi PE=1 SV=2 29 6.3
sp|P25604|STP22_YEAST Suppressor protein STP22 of temperature-se... 29 8.2
sp|Q7Z5R6|AB1IP_HUMAN Amyloid beta A4 precursor protein-binding ... 29 8.2

>sp|O43365|HXA3_HUMAN Homeobox protein Hox-A3 OS=Homo sapiens
GN=HOXA3 PE=2 SV=1
Length = 443

Score = 31.6 bits (70), Expect = 1.3
Identities = 14/22 (63%), Positives = 16/22 (72%)
Frame = +1

Query: 22 SLPPSQPKSFEGKPDLQPPPPR 87
S PPSQP S G+P L PPPP+
Sbjct: 76 SAPPSQPPSL-GEPPLHPPPPQ 96


>sp|Q6DCV1|AB1IP_XENLA Amyloid beta A4 precursor protein-binding
family B member 1-interacting protein OS=Xenopus laevis
GN=apbb1ip PE=2 SV=2
Length = 653

Score = 31.2 bits (69), Expect = 1.7
Identities = 12/26 (46%), Positives = 14/26 (53%)
Frame = +1

Query: 25 LPPSQPKSFEGKPDLQPPPPRTFQDN 102
LPP P F+ PD PP P +F N
Sbjct: 542 LPPPPPDFFDAPPDFLPPSPPSFMSN 567


>sp|O82221|RUXG_ARATH Probable small nuclear ribonucleoprotein G
OS=Arabidopsis thaliana GN=At2g23930 PE=2 SV=1
Length = 80

Score = 29.6 bits (65), Expect = 4.8
Identities = 15/24 (62%), Positives = 17/24 (70%)
Frame = +1

Query: 109 DLANHIDKKLCIKLIANRAGAGTL 180
DL ++DKKL IKL ANR GTL
Sbjct: 9 DLKKYMDKKLQIKLNANRMVTGTL 32


>sp|Q9HC56|PCDH9_HUMAN Protocadherin-9 OS=Homo sapiens GN=PCDH9 PE=1
SV=2
Length = 1237

Score = 29.6 bits (65), Expect = 4.8
Identities = 15/34 (44%), Positives = 18/34 (52%)
Frame = +1

Query: 22 SLPPSQPKSFEGKPDLQPPPPRTFQDNFFDLANH 123
SLP + G+ D P PP TF+ N DLA H
Sbjct: 905 SLPAELEEQSIGRFDWGPAPPTTFKPNSPDLAKH 938


>sp|Q9C0D6|FHDC1_HUMAN FH2 domain-containing protein 1 OS=Homo
sapiens GN=FHDC1 PE=2 SV=2
Length = 1143

Score = 29.6 bits (65), Expect = 4.8
Identities = 13/39 (33%), Positives = 19/39 (48%)
Frame = +1

Query: 19 TSLPPSQPKSFEGKPDLQPPPPRTFQDNFFDLANHIDKK 135
+S PP P G+P + PPPP + +H+ KK
Sbjct: 56 SSPPPPPPPPLPGEPPIPPPPPGLPPTTHMNGYSHLGKK 94


>sp|P83404|DEFI_PHLDU Defensin OS=Phlebotomus duboscqi PE=1 SV=2
Length = 98

Score = 29.3 bits (64), Expect = 6.3
Identities = 14/39 (35%), Positives = 22/39 (56%), Gaps = 1/39 (2%)
Frame = +1

Query: 1 ILVISYTSLPPSQPKSFEGKP-DLQPPPPRTFQDNFFDL 114
++V+ S PS P E + D Q P +TFQD F+++
Sbjct: 11 VVVVGVISAYPSNPVEVEAEDFDAQDPDLQTFQDTFYEV 49


>sp|P25604|STP22_YEAST Suppressor protein STP22 of
temperature-sensitive alpha-factor receptor and arginine
permease OS=Saccharomyces cerevisiae GN=STP22 PE=1 SV=3
Length = 385

Score = 28.9 bits (63), Expect = 8.2
Identities = 14/28 (50%), Positives = 15/28 (53%)
Frame = +1

Query: 31 PSQPKSFEGKPDLQPPPPRTFQDNFFDL 114
P +PKS KP L PPPP N DL
Sbjct: 181 PPKPKSPHLKPPLPPPPPPQPASNALDL 208


>sp|Q7Z5R6|AB1IP_HUMAN Amyloid beta A4 precursor protein-binding
family B member 1-interacting protein OS=Homo sapiens
GN=APBB1IP PE=1 SV=1
Length = 666

Score = 28.9 bits (63), Expect = 8.2
Identities = 11/23 (47%), Positives = 13/23 (56%)
Frame = +1

Query: 25 LPPSQPKSFEGKPDLQPPPPRTF 93
LPP P E PD PPPP ++
Sbjct: 568 LPPPPPDFMEPPPDFVPPPPPSY 590


tr_hit_id -
Definition No hits.
Align length -
Score (bit) -
E-value -
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= DK943658|Adiantum capillus-veneris mRNA, clone:
YMU02A01NGRL0003_I14, 5'
(185 letters)

Database: uniprot_trembl.fasta
7,341,751 sequences; 2,391,615,440 total letters

Searching..................................................done

***** No hits found ******