DK943666
Clone id YMU02A01NGRL0003_I24
Library
Length 387
Definition Adiantum capillus-veneris mRNA. clone: YMU02A01NGRL0003_I24. 5' end sequence.
Accession
Tissue type young leaves
Developmental stage sporophyte
Contig ID -
Sequence
GAGAAATTGCATGAGAAGAAGGAGGAGGCTGAAAAAGCCGCTGAGAAAAATCTGTTTGTC
AAAGTACTGGATATGGTTTTCAAGACCTTGTACCACATTGCGGAGCTGCCTATTTTGGCG
TCGCATAAGGACAAGCTTGTGAAATTTATTGATAGAGGATAGGAGAATCCAGTGGCTGTG
CTGCCCATCTTTGGAGGTGTCGTGCCTTTTGGTCTAGTTCTCATTTTCTGGTTCCTTTTC
TTGAGATTCAGTTTCATGATATCGAAGAAGGCATCATTGGCGAAGGCGACGATGGATGAT
ATCACTCCTGATGATGACATTCCAGGCTCTGAGATGTCTAGGGACAAAAAATCAGGGAAC
GAGAAGGTGACTGAGGAGAATGCGATG
■■Homology search results ■■ -
sp_hit_id Q39994
Definition sp|Q39994|CALX_HELTU Calnexin homolog OS=Helianthus tuberosus
Align length 54
Score (bit) 34.7
E-value 0.15
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= DK943666|Adiantum capillus-veneris mRNA, clone:
YMU02A01NGRL0003_I24, 5'
(387 letters)

Database: uniprot_sprot.fasta
412,525 sequences; 148,809,765 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

sp|Q39994|CALX_HELTU Calnexin homolog OS=Helianthus tuberosus PE... 35 0.15
sp|Q5T1S8|CA130_HUMAN Uncharacterized protein C1orf130 OS=Homo s... 34 0.20
sp|P00550|PTM3C_ECOLI PTS system mannitol-specific EIICBA compon... 32 1.3
sp|Q9XBM7|PTM3C_KLEPN PTS system mannitol-specific EIICBA compon... 30 4.9
sp|P00332|ADH_SCHPO Alcohol dehydrogenase OS=Schizosaccharomyces... 30 4.9
sp|Q75EY8|CFT1_ASHGO Protein CFT1 OS=Ashbya gossypii GN=CFT1 PE=... 29 8.4

>sp|Q39994|CALX_HELTU Calnexin homolog OS=Helianthus tuberosus PE=2
SV=1
Length = 540

Score = 34.7 bits (78), Expect = 0.15
Identities = 20/54 (37%), Positives = 30/54 (55%)
Frame = +1

Query: 76 VFKTLYHIAELPILASHKDKLVKFIDRG*ENPVAVLPIFGGVVPFGLVLIFWFL 237
VF LY IA+LP L HK K+++ I++ P + GV+ +V+IF L
Sbjct: 435 VFDVLYKIADLPFLGDHKVKVLELIEKAETQPNITI----GVIVSIIVVIFSIL 484


>sp|Q5T1S8|CA130_HUMAN Uncharacterized protein C1orf130 OS=Homo
sapiens GN=C1orf130 PE=2 SV=1
Length = 102

Score = 34.3 bits (77), Expect = 0.20
Identities = 17/54 (31%), Positives = 29/54 (53%), Gaps = 7/54 (12%)
Frame = -2

Query: 266 FDIMKLNLKKRNQKMRTR-------PKGTTPPKMGSTATGFSYPLSINFTSLSL 126
F ++ + LK N+KMRTR PK T P +G + G +P ++ F+ + +
Sbjct: 44 FTVVLILLKMYNRKMRTRRELEPKGPKPTAPSAVGPNSNGSQHPATVTFSPVDV 97


>sp|P00550|PTM3C_ECOLI PTS system mannitol-specific EIICBA component
OS=Escherichia coli (strain K12) GN=mtlA PE=1 SV=1
Length = 637

Score = 31.6 bits (70), Expect = 1.3
Identities = 19/54 (35%), Positives = 26/54 (48%)
Frame = -2

Query: 239 KRNQKMRTRPKGTTPPKMGSTATGFSYPLSINFTSLSLCDAKIGSSAMWYKVLK 78
+R Q M+ KG +P G S+ I + CDA +GSSAM VL+
Sbjct: 350 RRMQDMKAESKGASPLSAGDVTNDLSHVRKI----IVACDAGMGSSAMGAGVLR 399


>sp|Q9XBM7|PTM3C_KLEPN PTS system mannitol-specific EIICBA component
OS=Klebsiella pneumoniae GN=mtlA PE=3 SV=1
Length = 635

Score = 29.6 bits (65), Expect = 4.9
Identities = 18/54 (33%), Positives = 26/54 (48%)
Frame = -2

Query: 239 KRNQKMRTRPKGTTPPKMGSTATGFSYPLSINFTSLSLCDAKIGSSAMWYKVLK 78
+R M+ KG +P G+ S+ I + CDA +GSSAM VL+
Sbjct: 350 RRMHDMKAESKGASPLAAGNVTNDLSHVRKI----IVACDAGMGSSAMGAGVLR 399


>sp|P00332|ADH_SCHPO Alcohol dehydrogenase OS=Schizosaccharomyces
pombe GN=adh1 PE=1 SV=2
Length = 350

Score = 29.6 bits (65), Expect = 4.9
Identities = 19/53 (35%), Positives = 25/53 (47%), Gaps = 2/53 (3%)
Frame = -2

Query: 203 TTPPKMGSTATGFSYPLSINFTSLSLCDAKIGSSAMW--YKVLKTISSTLTNR 51
+T PK A GF+ P S T AK+G+ W K+LK S + NR
Sbjct: 249 STSPKSYEQAAGFARPGSTMVTVSMPAGAKLGADIFWLTVKMLKICGSHVGNR 301


>sp|Q75EY8|CFT1_ASHGO Protein CFT1 OS=Ashbya gossypii GN=CFT1 PE=3
SV=1
Length = 1305

Score = 28.9 bits (63), Expect = 8.4
Identities = 14/29 (48%), Positives = 17/29 (58%)
Frame = -1

Query: 267 LRYHETESQEKEPENEN*TKRHDTSKDGQ 181
LR HE E +E E E E+ KR T DG+
Sbjct: 144 LRGHEEEGEEAEEEEEHPAKRARTDADGR 172


tr_hit_id A9PFQ9
Definition tr|A9PFQ9|A9PFQ9_POPTR Putative uncharacterized protein OS=Populus trichocarpa
Align length 70
Score (bit) 43.1
E-value 0.007
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= DK943666|Adiantum capillus-veneris mRNA, clone:
YMU02A01NGRL0003_I24, 5'
(387 letters)

Database: uniprot_trembl.fasta
7,341,751 sequences; 2,391,615,440 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

tr|A9PFQ9|A9PFQ9_POPTR Putative uncharacterized protein OS=Popul... 43 0.007
tr|A9PHA6|A9PHA6_POPTR Putative uncharacterized protein OS=Popul... 42 0.020
tr|A9T350|A9T350_PHYPA Predicted protein OS=Physcomitrella paten... 38 0.29
tr|A9T349|A9T349_PHYPA Predicted protein OS=Physcomitrella paten... 37 0.49
tr|Q83PQ1|Q83PQ1_SHIFL PTS system, mannitol-specific enzyme IIAB... 33 5.5
tr|Q3YVW1|Q3YVW1_SHISS PTS system, mannitol-specific enzyme IIAB... 33 5.5
tr|Q31V30|Q31V30_SHIBS PTS system mannitol-specific enzyme IIABC... 33 5.5
tr|Q0SYB9|Q0SYB9_SHIF8 PTS system, mannitol-specific enzyme IIAB... 33 5.5
tr|B2U5B0|B2U5B0_SHIB3 PTS system, mannitol-specific IIABC compo... 33 5.5
tr|B1IZJ3|B1IZJ3_ECOLC PTS system, mannitol-specific IIC subunit... 33 5.5
tr|A7ZTE8|A7ZTE8_ECO24 PTS system, mannitol-specific IIABC compo... 33 5.5
tr|B3WKY1|B3WKY1_ECOLX PTS system, mannitol-specific IIABC compo... 33 5.5
tr|B3IBY8|B3IBY8_ECOLX PTS system, mannitol-specific IIABC compo... 33 5.5
tr|B3HGK3|B3HGK3_ECOLX PTS system, mannitol-specific IIABC compo... 33 5.5
tr|Q17PI6|Q17PI6_AEDAE Putative uncharacterized protein OS=Aedes... 33 7.1
tr|A3GFQ1|A3GFQ1_PICST Amino acid permease (Fragment) OS=Pichia ... 33 7.1

>tr|A9PFQ9|A9PFQ9_POPTR Putative uncharacterized protein OS=Populus
trichocarpa PE=2 SV=1
Length = 157

Score = 43.1 bits (100), Expect = 0.007
Identities = 23/70 (32%), Positives = 42/70 (60%)
Frame = +1

Query: 76 VFKTLYHIAELPILASHKDKLVKFIDRG*ENPVAVLPIFGGVVPFGLVLIFWFLFLRFSF 255
VF+ LY +AE+ L+ HKDK+++ I++ + P+ + + +V +V++ FL L F
Sbjct: 57 VFEILYQVAEISFLSEHKDKIIELIEKAEKQPIITIGVLVSIV---VVILTVFLKLIFG- 112

Query: 256 MISKKASLAK 285
KKA++ K
Sbjct: 113 --GKKAAVEK 120


>tr|A9PHA6|A9PHA6_POPTR Putative uncharacterized protein OS=Populus
trichocarpa PE=2 SV=1
Length = 538

Score = 41.6 bits (96), Expect = 0.020
Identities = 22/65 (33%), Positives = 34/65 (52%)
Frame = +1

Query: 76 VFKTLYHIAELPILASHKDKLVKFIDRG*ENPVAVLPIFGGVVPFGLVLIFWFLFLRFSF 255
VF+ LY AEL L+ HKDK+++ I++ + P + + VV L L F +F
Sbjct: 432 VFELLYQAAELSFLSKHKDKIIELIEKAEKQPNITIGVLVSVVVVILTLFFRIIFGGKKA 491

Query: 256 MISKK 270
+ KK
Sbjct: 492 KVEKK 496


>tr|A9T350|A9T350_PHYPA Predicted protein OS=Physcomitrella patens
subsp. patens GN=PHYPADRAFT_191189 PE=4 SV=1
Length = 522

Score = 37.7 bits (86), Expect = 0.29
Identities = 26/72 (36%), Positives = 38/72 (52%)
Frame = +1

Query: 61 KVLDMVFKTLYHIAELPILASHKDKLVKFIDRG*ENPVAVLPIFGGVVPFGLVLIFWFLF 240
K + VF+ L IAE+P LA +K+++ +D+ NP L GV+ VL+F L
Sbjct: 404 KTSEKVFEALNKIAEVPFLAKYKEQIDAVLDKAESNPNVTL----GVLATIPVLLFTML- 458

Query: 241 LRFSFMISKKAS 276
FS + KK S
Sbjct: 459 --FSLCLGKKKS 468


>tr|A9T349|A9T349_PHYPA Predicted protein OS=Physcomitrella patens
subsp. patens GN=PHYPADRAFT_59289 PE=4 SV=1
Length = 545

Score = 37.0 bits (84), Expect = 0.49
Identities = 25/71 (35%), Positives = 38/71 (53%)
Frame = +1

Query: 64 VLDMVFKTLYHIAELPILASHKDKLVKFIDRG*ENPVAVLPIFGGVVPFGLVLIFWFLFL 243
+ + VF+ L IAE+P LA +K+++ +D+ NP L GV+ VL+F L
Sbjct: 428 IKEKVFEALNKIAEVPFLAKYKEQIDAVLDKAESNPNVTL----GVLATIPVLLFTML-- 481

Query: 244 RFSFMISKKAS 276
FS + KK S
Sbjct: 482 -FSLCLGKKKS 491


>tr|Q83PQ1|Q83PQ1_SHIFL PTS system, mannitol-specific enzyme IIABC
components OS=Shigella flexneri GN=mtlA PE=4 SV=1
Length = 637

Score = 33.5 bits (75), Expect = 5.5
Identities = 20/54 (37%), Positives = 27/54 (50%)
Frame = -2

Query: 239 KRNQKMRTRPKGTTPPKMGSTATGFSYPLSINFTSLSLCDAKIGSSAMWYKVLK 78
+R Q M+ KGT+P G S+ I + CDA +GSSAM VL+
Sbjct: 350 RRMQDMKAESKGTSPLSAGDVTNDLSHVRKI----IVACDAGMGSSAMGAGVLR 399


>tr|Q3YVW1|Q3YVW1_SHISS PTS system, mannitol-specific enzyme IIABC
components OS=Shigella sonnei (strain Ss046) GN=mtlA
PE=4 SV=1
Length = 637

Score = 33.5 bits (75), Expect = 5.5
Identities = 20/54 (37%), Positives = 27/54 (50%)
Frame = -2

Query: 239 KRNQKMRTRPKGTTPPKMGSTATGFSYPLSINFTSLSLCDAKIGSSAMWYKVLK 78
+R Q M+ KGT+P G S+ I + CDA +GSSAM VL+
Sbjct: 350 RRMQDMKAESKGTSPLSAGDVTNDLSHVRKI----IVACDAGMGSSAMGAGVLR 399


>tr|Q31V30|Q31V30_SHIBS PTS system mannitol-specific enzyme IIABC
components OS=Shigella boydii serotype 4 (strain Sb227)
GN=mtlA PE=4 SV=1
Length = 637

Score = 33.5 bits (75), Expect = 5.5
Identities = 20/54 (37%), Positives = 27/54 (50%)
Frame = -2

Query: 239 KRNQKMRTRPKGTTPPKMGSTATGFSYPLSINFTSLSLCDAKIGSSAMWYKVLK 78
+R Q M+ KGT+P G S+ I + CDA +GSSAM VL+
Sbjct: 350 RRMQDMKAESKGTSPLSAGDVTNDLSHVRKI----IVACDAGMGSSAMGAGVLR 399


>tr|Q0SYB9|Q0SYB9_SHIF8 PTS system, mannitol-specific enzyme IIABC
components OS=Shigella flexneri serotype 5b (strain
8401) GN=mtlA PE=4 SV=1
Length = 637

Score = 33.5 bits (75), Expect = 5.5
Identities = 20/54 (37%), Positives = 27/54 (50%)
Frame = -2

Query: 239 KRNQKMRTRPKGTTPPKMGSTATGFSYPLSINFTSLSLCDAKIGSSAMWYKVLK 78
+R Q M+ KGT+P G S+ I + CDA +GSSAM VL+
Sbjct: 350 RRMQDMKAESKGTSPLSAGDVTNDLSHVRKI----IVACDAGMGSSAMGAGVLR 399


>tr|B2U5B0|B2U5B0_SHIB3 PTS system, mannitol-specific IIABC
component OS=Shigella boydii serotype 18 (strain CDC
3083-94 / BS512) GN=mtlA PE=4 SV=1
Length = 637

Score = 33.5 bits (75), Expect = 5.5
Identities = 20/54 (37%), Positives = 27/54 (50%)
Frame = -2

Query: 239 KRNQKMRTRPKGTTPPKMGSTATGFSYPLSINFTSLSLCDAKIGSSAMWYKVLK 78
+R Q M+ KGT+P G S+ I + CDA +GSSAM VL+
Sbjct: 350 RRMQDMKAESKGTSPLSAGDVTNDLSHVRKI----IVACDAGMGSSAMGAGVLR 399


>tr|B1IZJ3|B1IZJ3_ECOLC PTS system, mannitol-specific IIC subunit
OS=Escherichia coli (strain ATCC 8739 / DSM 1576 /
Crooks) GN=EcolC_0113 PE=4 SV=1
Length = 637

Score = 33.5 bits (75), Expect = 5.5
Identities = 20/54 (37%), Positives = 27/54 (50%)
Frame = -2

Query: 239 KRNQKMRTRPKGTTPPKMGSTATGFSYPLSINFTSLSLCDAKIGSSAMWYKVLK 78
+R Q M+ KGT+P G S+ I + CDA +GSSAM VL+
Sbjct: 350 RRMQDMKAESKGTSPLSAGDVTNDLSHVRKI----IVACDAGMGSSAMGAGVLR 399