DK943726
Clone id YMU02A01NGRL0003_M01
Library
Length 744
Definition Adiantum capillus-veneris mRNA. clone: YMU02A01NGRL0003_M01. 5' end sequence.
Accession
Tissue type young leaves
Developmental stage sporophyte
Contig ID -
Sequence
GAGGGAACTCCATAAAAAATGCATTTAGGTGGATGAGGCAGCAGCAGCTTTGGAGGCAAC
TAATAACACAGCTCTGGAGAACAATGGCCAGTTGTTAAGAGTAGCATTTGCAAAGAGCGG
TGGGCCTGGTTCAACGTTCCATGCCAGCAGTATTGCTGCTGCTGCGATTGAAGCAGCCAC
TTTCGCCCAGCAGGTATTGAGCTGAGGTGGTGCCACAGGGGTGCACTATTCTGGGCATTT
GTTGAGCCGCTTCTGATTACCGTCACCATGCAGTATGATTCTGCAGGTCGGACTCACAAG
GATAGTACTGGTACTGAAAGAGCTAAAGAAGCACCTCAATCAGGCTATGTGTGGGATGAA
GCCTCAGGCTATTACTATGATGCTGCCTCTGGGTTTTATTACGACCCTCATAGATGTCTC
TTCTATGATGGCAACCATGGTCTTTGGTACTCCTATGATGATAAATCGCAGCAGTATGTG
CCCTATGTTGAACCCAACACAGGAGTGGTGCCTGATTCAACAAACAAAACAGAGGCTGAA
AAGGGTGGCCTCACAGACGTGGCAACTGAAAAGAAAAACGAAACTGCAACTGTGGGAGGA
AGGTGAGGTTGACCCCAATGCATCTNAATGAGGATGAGAAAGAAGCTTTCTTTTAGCAGA
GGGTGGTACAGGGCTGCTGGCCCCTTGCTGCCCAAGGGTGGCTGGCGAAAAAAAAAAAAA
AAAAAAAAAAAAAAAAAAAAAAAA
■■Homology search results ■■ -
sp_hit_id Q8N302
Definition sp|Q8N302|AGGF1_HUMAN Angiogenic factor with G patch and FHA domains 1 OS=Homo sapiens
Align length 100
Score (bit) 54.7
E-value 5.0e-07
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= DK943726|Adiantum capillus-veneris mRNA, clone:
YMU02A01NGRL0003_M01, 5'
(707 letters)

Database: uniprot_sprot.fasta
412,525 sequences; 148,809,765 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

sp|Q8N302|AGGF1_HUMAN Angiogenic factor with G patch and FHA dom... 55 5e-07
sp|P52756|RBM5_HUMAN RNA-binding protein 5 OS=Homo sapiens GN=RB... 54 1e-06
sp|Q91YE7|RBM5_MOUSE RNA-binding protein 5 OS=Mus musculus GN=Rb... 52 2e-06
sp|Q1RMU5|RBM5_BOVIN RNA-binding protein 5 OS=Bos taurus GN=RBM5... 52 3e-06
sp|Q7TN31|AGGF1_MOUSE Angiogenic factor with G patch and FHA dom... 52 3e-06
sp|P98175|RBM10_HUMAN RNA-binding protein 10 OS=Homo sapiens GN=... 51 5e-06
sp|P70501|RBM10_RAT RNA-binding protein 10 OS=Rattus norvegicus ... 50 1e-05
sp|Q99KG3|RBM10_MOUSE RNA-binding protein 10 OS=Mus musculus GN=... 50 1e-05
sp|P78332|RBM6_HUMAN RNA-binding protein 6 OS=Homo sapiens GN=RB... 41 0.007
sp|P23792|DISC_DROME Protein disconnected OS=Drosophila melanoga... 36 0.23
sp|Q96MR6|WDR65_HUMAN WD repeat-containing protein 65 OS=Homo sa... 35 0.52
sp|O15230|LAMA5_HUMAN Laminin subunit alpha-5 OS=Homo sapiens GN... 33 1.5
sp|P49174|INVA_MAIZE Beta-fructofuranosidase, cell wall isozyme ... 33 2.0
sp|Q26366|VG_DROME Protein vestigial OS=Drosophila melanogaster ... 32 2.6
sp|Q07833|WAPA_BACSU Wall-associated protein OS=Bacillus subtili... 32 4.4
sp|Q6P0Q8|MAST2_HUMAN Microtubule-associated serine/threonine-pr... 32 4.4
sp|O13557|YL463_YEAST Putative uncharacterized protein YLR463C O... 31 5.7
sp|P89888|YE075_YEAST Putative uncharacterized protein YEL075W-A... 31 5.7
sp|Q97WG9|MRE11_SULSO DNA double-strand break repair protein mre... 31 5.7
sp|Q50365|HMW1_MYCPN Cytadherence high molecular weight protein ... 31 5.7
sp|P26792|INV1_DAUCA Beta-fructofuranosidase, insoluble isoenzym... 31 7.5
sp|P93761|INV1_CAPAN Acid beta-fructofuranosidase AIV-18 OS=Caps... 31 7.5
sp|A6URW2|SYM_METVS Methionyl-tRNA synthetase OS=Methanococcus v... 30 9.8

>sp|Q8N302|AGGF1_HUMAN Angiogenic factor with G patch and FHA
domains 1 OS=Homo sapiens GN=AGGF1 PE=1 SV=2
Length = 714

Score = 54.7 bits (130), Expect = 5e-07
Identities = 29/100 (29%), Positives = 48/100 (48%)
Frame = +1

Query: 244 EPLLITVTMQYDSAGRTHKDSTGTERAKEAPQSGYVWDEASGYYYDAASGFYYDPHRCLF 423
EP T G + +S Q+G+ +DE +G Y+D ++GFYYD L+
Sbjct: 173 EPASALATEDTSLEGSSLAESLRAAAEAAVSQTGFSYDENTGLYFDHSTGFYYDSENQLY 232

Query: 424 YDGNHGLWYSYDDKSQQYVPYVEPNTGVVPDSTNKTEAEK 543
YD + G++Y D +S +Y + + P S+ K +K
Sbjct: 233 YDPSTGIYYYCDVESGRYQFHSRVDLQPYPTSSTKQSKDK 272


>sp|P52756|RBM5_HUMAN RNA-binding protein 5 OS=Homo sapiens GN=RBM5
PE=1 SV=2
Length = 815

Score = 53.5 bits (127), Expect = 1e-06
Identities = 26/72 (36%), Positives = 40/72 (55%), Gaps = 4/72 (5%)
Frame = +1

Query: 340 SGYVWDEASGYYYDAASGFYYDPHRCLFYDGNHGLWYSYDDKSQQYVPYVEPN----TGV 507
S Y +DE+SGYYYD +G YYDP+ +Y+ + +D + + YVP E + +G+
Sbjct: 460 STYQYDESSGYYYDPTTGLYYDPNSQYYYNSLTQQYLYWDGEKETYVPAAESSSHQQSGL 519

Query: 508 VPDSTNKTEAEK 543
P K + EK
Sbjct: 520 PPAKEGKEKKEK 531


>sp|Q91YE7|RBM5_MOUSE RNA-binding protein 5 OS=Mus musculus GN=Rbm5
PE=1 SV=1
Length = 815

Score = 52.4 bits (124), Expect = 2e-06
Identities = 26/72 (36%), Positives = 39/72 (54%), Gaps = 4/72 (5%)
Frame = +1

Query: 340 SGYVWDEASGYYYDAASGFYYDPHRCLFYDGNHGLWYSYDDKSQQYVPYVEPN----TGV 507
S Y +DE+SGYYYD +G YYDP+ +Y+ + +D + + YVP E + TG+
Sbjct: 460 STYQYDESSGYYYDPTTGLYYDPNSQYYYNSLTQQYLYWDGEKETYVPAAEASSNQQTGL 519

Query: 508 VPDSTNKTEAEK 543
K + EK
Sbjct: 520 PSTKEGKEKKEK 531


>sp|Q1RMU5|RBM5_BOVIN RNA-binding protein 5 OS=Bos taurus GN=RBM5
PE=2 SV=1
Length = 815

Score = 52.0 bits (123), Expect = 3e-06
Identities = 26/72 (36%), Positives = 39/72 (54%), Gaps = 4/72 (5%)
Frame = +1

Query: 340 SGYVWDEASGYYYDAASGFYYDPHRCLFYDGNHGLWYSYDDKSQQYVPYVEPN----TGV 507
S Y +DE+SGYYYD +G YYDP+ +Y+ + +D + + Y+ E N TG+
Sbjct: 460 STYQYDESSGYYYDPTTGLYYDPNSQYYYNSLTQQYLYWDGEKETYMLAAESNSHQQTGL 519

Query: 508 VPDSTNKTEAEK 543
P K + EK
Sbjct: 520 PPAKEGKEKKEK 531


>sp|Q7TN31|AGGF1_MOUSE Angiogenic factor with G patch and FHA
domains 1 OS=Mus musculus GN=Aggf1 PE=2 SV=1
Length = 711

Score = 52.0 bits (123), Expect = 3e-06
Identities = 20/47 (42%), Positives = 34/47 (72%)
Frame = +1

Query: 337 QSGYVWDEASGYYYDAASGFYYDPHRCLFYDGNHGLWYSYDDKSQQY 477
Q+G+ +DE++G Y+D ++GFYYD L+YD + G++Y D +S +Y
Sbjct: 204 QTGFTYDESTGLYFDHSTGFYYDSENQLYYDPSTGIYYYCDVESGRY 250


>sp|P98175|RBM10_HUMAN RNA-binding protein 10 OS=Homo sapiens
GN=RBM10 PE=1 SV=3
Length = 930

Score = 51.2 bits (121), Expect = 5e-06
Identities = 27/74 (36%), Positives = 39/74 (52%), Gaps = 6/74 (8%)
Frame = +1

Query: 340 SGYVWDEASGYYYDAASGFYYDPHRCLFYDGNHGLWYSYDDKSQQYVPYVEPN------T 501
S Y +DE SGYYYD +G YYDP+ +Y+ + +D + + YVP +E + T
Sbjct: 570 STYQYDETSGYYYDPQTGLYYDPNSQYYYNAQSQQYLYWDGERRTYVPALEQSADGHKET 629

Query: 502 GVVPDSTNKTEAEK 543
G P K + EK
Sbjct: 630 G-APSKEGKEKKEK 642



Score = 48.1 bits (113), Expect = 5e-05
Identities = 34/105 (32%), Positives = 45/105 (42%), Gaps = 5/105 (4%)
Frame = +1

Query: 292 THKDST---GTERAKEAPQSGYVWDEASGYYYDAASGFYYDPHRCLFYDGNHGLWYSYDD 462
TH S T + S Y + S Y YD SG+YYDP L+YD N Y Y+
Sbjct: 543 THPSSALPPATSPTAQESYSQYPVPDVSTYQYDETSGYYYDPQTGLYYDPNS--QYYYNA 600

Query: 463 KSQQYVPYVEPNTGVVPDSTNKTEAEK--GGLTDVATEKKNETAT 591
+SQQY+ + VP + K G + EKK + T
Sbjct: 601 QSQQYLYWDGERRTYVPALEQSADGHKETGAPSKEGKEKKEKHKT 645


>sp|P70501|RBM10_RAT RNA-binding protein 10 OS=Rattus norvegicus
GN=Rbm10 PE=2 SV=1
Length = 852

Score = 50.1 bits (118), Expect = 1e-05
Identities = 20/51 (39%), Positives = 31/51 (60%)
Frame = +1

Query: 340 SGYVWDEASGYYYDAASGFYYDPHRCLFYDGNHGLWYSYDDKSQQYVPYVE 492
S Y +DE SGYYYD +G YYDP+ +Y+ + +D + + Y+P +E
Sbjct: 492 STYQYDETSGYYYDPQTGLYYDPNSQYYYNAQSQQYLYWDGERRTYIPALE 542



Score = 47.0 bits (110), Expect = 1e-04
Identities = 29/86 (33%), Positives = 40/86 (46%), Gaps = 2/86 (2%)
Frame = +1

Query: 340 SGYVWDEASGYYYDAASGFYYDPHRCLFYDGNHGLWYSYDDKSQQYVPYVEPNTGVVPDS 519
S Y + S Y YD SG+YYDP L+YD N Y Y+ +SQQY+ + +P
Sbjct: 484 SQYPVPDVSTYQYDETSGYYYDPQTGLYYDPNS--QYYYNAQSQQYLYWDGERRTYIPAL 541

Query: 520 TNKTEAEK--GGLTDVATEKKNETAT 591
+ K G + EKK + T
Sbjct: 542 EQSADGHKDTGASSKEGKEKKEKHKT 567


>sp|Q99KG3|RBM10_MOUSE RNA-binding protein 10 OS=Mus musculus
GN=Rbm10 PE=1 SV=1
Length = 930

Score = 50.1 bits (118), Expect = 1e-05
Identities = 20/51 (39%), Positives = 31/51 (60%)
Frame = +1

Query: 340 SGYVWDEASGYYYDAASGFYYDPHRCLFYDGNHGLWYSYDDKSQQYVPYVE 492
S Y +DE SGYYYD +G YYDP+ +Y+ + +D + + Y+P +E
Sbjct: 570 STYQYDETSGYYYDPQTGLYYDPNSQYYYNAQSQQYLYWDGERRTYIPALE 620



Score = 48.9 bits (115), Expect = 3e-05
Identities = 32/122 (26%), Positives = 50/122 (40%), Gaps = 2/122 (1%)
Frame = +1

Query: 232 WAFVEPLLITVTMQYDSAGRTHKDSTGTERAKEAPQSGYVWDEASGYYYDAASGFYYDPH 411
+ + P ++ +Q + + T S Y + S Y YD SG+YYDP
Sbjct: 526 YTIISPAVLKAELQSPTQPSSSAFPPATSPTAPEAYSQYPVPDVSTYQYDETSGYYYDPQ 585

Query: 412 RCLFYDGNHGLWYSYDDKSQQYVPYVEPNTGVVPDSTNKTEAEK--GGLTDVATEKKNET 585
L+YD N Y Y+ +SQQY+ + +P + K G + EKK +
Sbjct: 586 TGLYYDPNS--QYYYNAQSQQYLYWDGERRTYIPALEQSADGHKDTGASSKEGKEKKEKH 643

Query: 586 AT 591
T
Sbjct: 644 KT 645


>sp|P78332|RBM6_HUMAN RNA-binding protein 6 OS=Homo sapiens GN=RBM6
PE=1 SV=5
Length = 1123

Score = 40.8 bits (94), Expect = 0.007
Identities = 19/43 (44%), Positives = 26/43 (60%), Gaps = 1/43 (2%)
Frame = +1

Query: 286 GRTHKDSTGTERAKEAPQSG-YVWDEASGYYYDAASGFYYDPH 411
GR S+ T R + S Y++D A+GYYYD +G YYDP+
Sbjct: 769 GRNSDWSSDTNRQGQQSSSDCYIYDSATGYYYDPLAGTYYDPN 811



Score = 33.1 bits (74), Expect = 1.5
Identities = 26/83 (31%), Positives = 37/83 (44%), Gaps = 9/83 (10%)
Frame = +1

Query: 370 YYYDAASGFYYDPHRCLFYDGNHGLWYSYDDKSQQYVPYVEPNTGV---------VPDST 522
Y YD+A+G+YYDP +YD N +QQ V YV + G+ P S
Sbjct: 790 YIYDSATGYYYDPLAGTYYDPN----------TQQEV-YVPQDPGLPEEEEIKEKKPTSQ 838

Query: 523 NKTEAEKGGLTDVATEKKNETAT 591
K+ ++K EKK+ T
Sbjct: 839 GKSSSKKEMSKRDGKEKKDRGVT 861


>sp|P23792|DISC_DROME Protein disconnected OS=Drosophila
melanogaster GN=disco PE=1 SV=2
Length = 568

Score = 35.8 bits (81), Expect = 0.23
Identities = 21/51 (41%), Positives = 28/51 (54%)
Frame = -1

Query: 236 AQNSAPLWHHLSSIPAGRKWLLQSQQQQYCWHGTLNQAHRSLQMLLLTTGH 84
A++S P+W LS + R LL++Q QQY H L Q H+ Q LT H
Sbjct: 477 AKDSPPMWSLLSEMY--RSMLLKTQHQQYNHHHQLQQQHQQEQHHHLTLSH 525


tr_hit_id Q8VYR8
Definition tr|Q8VYR8|Q8VYR8_ARATH Putative uncharacterized protein At3g54230 OS=Arabidopsis thaliana
Align length 117
Score (bit) 102.0
E-value 3.0e-20
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= DK943726|Adiantum capillus-veneris mRNA, clone:
YMU02A01NGRL0003_M01, 5'
(707 letters)

Database: uniprot_trembl.fasta
7,341,751 sequences; 2,391,615,440 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

tr|Q8VYR8|Q8VYR8_ARATH Putative uncharacterized protein At3g5423... 102 3e-20
tr|A9RWI0|A9RWI0_PHYPA Predicted protein OS=Physcomitrella paten... 100 9e-20
tr|Q6H4V9|Q6H4V9_ORYSJ Putative RNA-binding protein 10 OS=Oryza ... 100 1e-19
tr|Q6H4V8|Q6H4V8_ORYSJ Os02g0167500 protein OS=Oryza sativa subs... 100 1e-19
tr|B8AIH3|B8AIH3_ORYSI Putative uncharacterized protein OS=Oryza... 100 1e-19
tr|A3A3I6|A3A3I6_ORYSJ Putative uncharacterized protein OS=Oryza... 100 1e-19
tr|A7PCC5|A7PCC5_VITVI Chromosome chr2 scaffold_11, whole genome... 98 5e-19
tr|A5BEC7|A5BEC7_VITVI Putative uncharacterized protein OS=Vitis... 98 5e-19
tr|A9S0V2|A9S0V2_PHYPA Predicted protein OS=Physcomitrella paten... 96 2e-18
tr|A7RSJ8|A7RSJ8_NEMVE Predicted protein (Fragment) OS=Nematoste... 64 1e-08
tr|Q9M383|Q9M383_ARATH Putative uncharacterized protein F24B22.1... 63 2e-08
tr|B6THT8|B6THT8_MAIZE Putative uncharacterized protein OS=Zea m... 62 4e-08
tr|B4FTF4|B4FTF4_MAIZE Putative uncharacterized protein OS=Zea m... 62 4e-08
tr|Q08CK9|Q08CK9_DANRE Zgc:152959 OS=Danio rerio GN=aggf1 PE=2 SV=1 60 2e-07
tr|Q8L4S3|Q8L4S3_ARATH Putative uncharacterized protein (At5g093... 58 5e-07
tr|A7Q6G5|A7Q6G5_VITVI Chromosome chr11 scaffold_56, whole genom... 58 5e-07
tr|A7RK53|A7RK53_NEMVE Predicted protein OS=Nematostella vectens... 58 5e-07
tr|Q7K0W0|Q7K0W0_DROME CG8079, isoform A OS=Drosophila melanogas... 57 2e-06
tr|B4HS16|B4HS16_DROSE GM21598 OS=Drosophila sechellia GN=GM2159... 57 2e-06
tr|Q8IPW6|Q8IPW6_DROME CG4896, isoform C OS=Drosophila melanogas... 56 2e-06
tr|Q8IPW5|Q8IPW5_DROME CG4896, isoform D OS=Drosophila melanogas... 56 2e-06
tr|Q8IHG7|Q8IHG7_DROME AT02677p (Fragment) OS=Drosophila melanog... 56 2e-06
tr|Q7Q5P7|Q7Q5P7_ANOGA AGAP006281-PA OS=Anopheles gambiae GN=AGA... 56 2e-06
tr|Q6NQZ3|Q6NQZ3_DROME CG4896, isoform E OS=Drosophila melanogas... 56 2e-06
tr|B4QGE8|B4QGE8_DROSI Hex-C OS=Drosophila simulans GN=Dsim\Hex-... 56 2e-06
tr|Q5VQM8|Q5VQM8_ORYSJ Putative uncharacterized protein P0583G08... 56 3e-06
tr|Q0JQC6|Q0JQC6_ORYSJ Os01g0170100 protein OS=Oryza sativa subs... 56 3e-06
tr|B8ADG7|B8ADG7_ORYSI Putative uncharacterized protein OS=Oryza... 56 3e-06
tr|A2ZPQ8|A2ZPQ8_ORYSJ Putative uncharacterized protein OS=Oryza... 56 3e-06
tr|A1Z9Z1|A1Z9Z1_DROME CG8079, isoform B OS=Drosophila melanogas... 56 3e-06

>tr|Q8VYR8|Q8VYR8_ARATH Putative uncharacterized protein At3g54230
OS=Arabidopsis thaliana GN=At3g54230 PE=2 SV=1
Length = 1007

Score = 102 bits (253), Expect = 3e-20
Identities = 54/117 (46%), Positives = 69/117 (58%), Gaps = 22/117 (18%)
Frame = +1

Query: 259 TVTMQYDSAGRTHKD-------STG----------TERAKEAPQSGYVWDEASGYYYDAA 387
T + QYD G K+ +TG +++ APQSGYVWDEASGYYYDAA
Sbjct: 538 TFSQQYDGVGWAPKEYNTGEKQNTGGQAQGVGEIESQKGTSAPQSGYVWDEASGYYYDAA 597

Query: 388 SGFYYDPHRCLFYDGNHGLWYSYDDKSQQYVPYVEPN-----TGVVPDSTNKTEAEK 543
SG+YYD + L+YD N GLWYSYD ++QQYVP + N T PDS K ++ +
Sbjct: 598 SGYYYDGNSGLYYDSNSGLWYSYDQQTQQYVPCPDQNNESKVTENQPDSAKKEKSSQ 654


>tr|A9RWI0|A9RWI0_PHYPA Predicted protein OS=Physcomitrella patens
subsp. patens GN=PHYPADRAFT_161416 PE=4 SV=1
Length = 1153

Score = 100 bits (249), Expect = 9e-20
Identities = 51/107 (47%), Positives = 64/107 (59%), Gaps = 20/107 (18%)
Frame = +1

Query: 259 TVTMQYDSAGRTHKD-------STGTERAKE------------APQSGYVWDEASGYYYD 381
T QYD G K+ TG ++ E APQSG+VWDEASGYYYD
Sbjct: 619 TFAQQYDMIGWAPKEYNPGENAETGLQKIAETDAGSSGEGDGGAPQSGFVWDEASGYYYD 678

Query: 382 AASGFYYDPHRCLFYDGNHGLWYSYDDKSQQYVPYVEP-NTGVVPDS 519
++SGFYYD ++ L+YDGN G+WY+YD +QQY PYV P NT +S
Sbjct: 679 SSSGFYYDGNQGLYYDGNSGVWYTYDQDTQQYTPYVPPENTATAGES 725


>tr|Q6H4V9|Q6H4V9_ORYSJ Putative RNA-binding protein 10 OS=Oryza
sativa subsp. japonica GN=OSJNBa0085K21.34-2 PE=4 SV=1
Length = 928

Score = 100 bits (248), Expect = 1e-19
Identities = 49/107 (45%), Positives = 68/107 (63%), Gaps = 13/107 (12%)
Frame = +1

Query: 265 TMQYDSAGRTHKD---------STGTERAKEAPQSGYVWDEASGYYYDAASGFYYDPHRC 417
+ QYD+ G K+ ++ + + APQSG+VWDE SGYYYD+ASGFYYD +
Sbjct: 434 SQQYDAIGWAPKEYNPDDKLNSNSEPQSSGSAPQSGFVWDEKSGYYYDSASGFYYDGNTG 493

Query: 418 LFYDGNHGLWYSYDDKSQQYVPYVEPNT----GVVPDSTNKTEAEKG 546
L+YDGN G+WYSYD ++QQYVP E N+ G + +++ KT G
Sbjct: 494 LYYDGNAGVWYSYDQQTQQYVPCSEQNSSKAAGDMANTSTKTSESSG 540


>tr|Q6H4V8|Q6H4V8_ORYSJ Os02g0167500 protein OS=Oryza sativa subsp.
japonica GN=OSJNBa0085K21.34-1 PE=4 SV=1
Length = 889

Score = 100 bits (248), Expect = 1e-19
Identities = 49/107 (45%), Positives = 68/107 (63%), Gaps = 13/107 (12%)
Frame = +1

Query: 265 TMQYDSAGRTHKD---------STGTERAKEAPQSGYVWDEASGYYYDAASGFYYDPHRC 417
+ QYD+ G K+ ++ + + APQSG+VWDE SGYYYD+ASGFYYD +
Sbjct: 434 SQQYDAIGWAPKEYNPDDKLNSNSEPQSSGSAPQSGFVWDEKSGYYYDSASGFYYDGNTG 493

Query: 418 LFYDGNHGLWYSYDDKSQQYVPYVEPNT----GVVPDSTNKTEAEKG 546
L+YDGN G+WYSYD ++QQYVP E N+ G + +++ KT G
Sbjct: 494 LYYDGNAGVWYSYDQQTQQYVPCSEQNSSKAAGDMANTSTKTSESSG 540


>tr|B8AIH3|B8AIH3_ORYSI Putative uncharacterized protein OS=Oryza
sativa subsp. indica GN=OsI_05999 PE=4 SV=1
Length = 1061

Score = 100 bits (248), Expect = 1e-19
Identities = 49/107 (45%), Positives = 68/107 (63%), Gaps = 13/107 (12%)
Frame = +1

Query: 265 TMQYDSAGRTHKD---------STGTERAKEAPQSGYVWDEASGYYYDAASGFYYDPHRC 417
+ QYD+ G K+ ++ + + APQSG+VWDE SGYYYD+ASGFYYD +
Sbjct: 567 SQQYDAIGWAPKEYNPDDKLNSNSEPQSSGSAPQSGFVWDEKSGYYYDSASGFYYDGNTG 626

Query: 418 LFYDGNHGLWYSYDDKSQQYVPYVEPNT----GVVPDSTNKTEAEKG 546
L+YDGN G+WYSYD ++QQYVP E N+ G + +++ KT G
Sbjct: 627 LYYDGNAGVWYSYDQQTQQYVPCSEQNSSKAAGDMANTSTKTSESSG 673


>tr|A3A3I6|A3A3I6_ORYSJ Putative uncharacterized protein OS=Oryza
sativa subsp. japonica GN=OsJ_005358 PE=4 SV=1
Length = 1038

Score = 100 bits (248), Expect = 1e-19
Identities = 49/107 (45%), Positives = 68/107 (63%), Gaps = 13/107 (12%)
Frame = +1

Query: 265 TMQYDSAGRTHKD---------STGTERAKEAPQSGYVWDEASGYYYDAASGFYYDPHRC 417
+ QYD+ G K+ ++ + + APQSG+VWDE SGYYYD+ASGFYYD +
Sbjct: 544 SQQYDAIGWAPKEYNPDDKLNSNSEPQSSGSAPQSGFVWDEKSGYYYDSASGFYYDGNTG 603

Query: 418 LFYDGNHGLWYSYDDKSQQYVPYVEPNT----GVVPDSTNKTEAEKG 546
L+YDGN G+WYSYD ++QQYVP E N+ G + +++ KT G
Sbjct: 604 LYYDGNAGVWYSYDQQTQQYVPCSEQNSSKAAGDMANTSTKTSESSG 650


>tr|A7PCC5|A7PCC5_VITVI Chromosome chr2 scaffold_11, whole genome
shotgun sequence OS=Vitis vinifera GN=GSVIVT00015806001
PE=4 SV=1
Length = 989

Score = 98.2 bits (243), Expect = 5e-19
Identities = 53/123 (43%), Positives = 68/123 (55%), Gaps = 17/123 (13%)
Frame = +1

Query: 259 TVTMQYDSAGRTHKD-------STGTE----------RAKEAPQSGYVWDEASGYYYDAA 387
T QYD+ G K+ STG + + APQSG+VWDE SGYYYDAA
Sbjct: 531 TFAQQYDAVGWAPKEYNPDDKQSTGGQDRGNGDPAGQKDGSAPQSGFVWDETSGYYYDAA 590

Query: 388 SGFYYDPHRCLFYDGNHGLWYSYDDKSQQYVPYVEPNTGVVPDSTNKTEAEKGGLTDVAT 567
SGFYYD + L+YDGN G WYSYD +QQYVP + N T+ ++E +D +
Sbjct: 591 SGFYYDGNTGLYYDGNGGTWYSYDHSTQQYVPCTDQN----DTKTSGKQSESSKASDSSN 646

Query: 568 EKK 576
+K
Sbjct: 647 SRK 649


>tr|A5BEC7|A5BEC7_VITVI Putative uncharacterized protein OS=Vitis
vinifera GN=VITISV_013474 PE=4 SV=1
Length = 1070

Score = 98.2 bits (243), Expect = 5e-19
Identities = 53/123 (43%), Positives = 68/123 (55%), Gaps = 17/123 (13%)
Frame = +1

Query: 259 TVTMQYDSAGRTHKD-------STGTE----------RAKEAPQSGYVWDEASGYYYDAA 387
T QYD+ G K+ STG + + APQSG+VWDE SGYYYDAA
Sbjct: 558 TFAQQYDAVGWAPKEYNPDDKQSTGGQDRGNGDPAGQKDGSAPQSGFVWDETSGYYYDAA 617

Query: 388 SGFYYDPHRCLFYDGNHGLWYSYDDKSQQYVPYVEPNTGVVPDSTNKTEAEKGGLTDVAT 567
SGFYYD + L+YDGN G WYSYD +QQYVP + N T+ ++E +D +
Sbjct: 618 SGFYYDGNTGLYYDGNGGTWYSYDHSTQQYVPCTDQN----DTKTSGKQSESSKASDSSN 673

Query: 568 EKK 576
+K
Sbjct: 674 SRK 676


>tr|A9S0V2|A9S0V2_PHYPA Predicted protein OS=Physcomitrella patens
subsp. patens GN=PHYPADRAFT_56617 PE=4 SV=1
Length = 888

Score = 96.3 bits (238), Expect = 2e-18
Identities = 42/67 (62%), Positives = 50/67 (74%)
Frame = +1

Query: 331 APQSGYVWDEASGYYYDAASGFYYDPHRCLFYDGNHGLWYSYDDKSQQYVPYVEPNTGVV 510
APQS +VWDEASGYYYDA+SGFYYD +R L+Y+GN G+WY+YD KSQQY YV P
Sbjct: 418 APQSSFVWDEASGYYYDASSGFYYDGNRGLYYNGNSGVWYTYDKKSQQYNTYVSPEITTT 477

Query: 511 PDSTNKT 531
T +T
Sbjct: 478 AVETMET 484


>tr|A7RSJ8|A7RSJ8_NEMVE Predicted protein (Fragment) OS=Nematostella
vectensis GN=v1g240403 PE=4 SV=1
Length = 192

Score = 63.5 bits (153), Expect = 1e-08
Identities = 28/80 (35%), Positives = 47/80 (58%)
Frame = +1

Query: 238 FVEPLLITVTMQYDSAGRTHKDSTGTERAKEAPQSGYVWDEASGYYYDAASGFYYDPHRC 417
F EP I+ + ++ + K + + +SG+V+DE +G YYD SG YY+P C
Sbjct: 95 FFEPTQISTS--HEQGNQDLKSALAEAASAAMTKSGFVFDERTGLYYDWNSGLYYNPRTC 152

Query: 418 LFYDGNHGLWYSYDDKSQQY 477
L+Y+ N G +Y+Y++ S+ Y
Sbjct: 153 LYYNNNTGTYYTYNESSRSY 172