DK943810
Clone id YMU02A01NGRL0004_A11
Library
Length 534
Definition Adiantum capillus-veneris mRNA. clone: YMU02A01NGRL0004_A11. 5' end sequence.
Accession
Tissue type young leaves
Developmental stage sporophyte
Contig ID -
Sequence
GTACGGGGCTGTAGCAATGGCTCATAGCCCAAAGTCTGAGGATTTTTCGGCACCTTCCCA
GTTTTTCTTTTACTTGTACGATCGGCGCAGTGCAGGATTAGGGGGTCTCTCATTTGATGA
AGGCCAGTTCTCTGTTATTGGGTATGTTACCAATGGGAAGGAGTTGCTTTCTCAACTGAG
GACGGGGGATATTATAGAATCAGCAAAGCTAGTCTCTGGTGCTGATCGGCTTGTCTTTCA
ACCTGTCGATAGTACAAGTTGAGGGTCAAGTCACTTTTTTCTCTCTGCCTGCCATGGCAG
TGAGTTACTCTTTTCTGCTCTTTACCTGCCCTTTTTATGGTGATTTAAGAGCTGATGTTC
CCTGATTGGGATCAAGAAGAGGTCATAGAAGGCAACAATTTTTCTTCAAGCTATTCAACT
TGTCCATATCCCCAAGAGTGCCTCAAGCTCAAATACTGTTGTTGATCTGGTAGTTCCCAA
TGCTGATGAGTATCGCTGTGCTATATGAACAACTGTTTCCACAAAAAAAAAAAA
■■Homology search results ■■ -
sp_hit_id P82869
Definition sp|P82869|CYP37_ARATH Peptidyl-prolyl cis-trans isomerase CYP37, chloroplastic OS=Arabidopsis thaliana
Align length 77
Score (bit) 120.0
E-value 4.0e-27
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= DK943810|Adiantum capillus-veneris mRNA, clone:
YMU02A01NGRL0004_A11, 5'
(522 letters)

Database: uniprot_sprot.fasta
412,525 sequences; 148,809,765 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

sp|P82869|CYP37_ARATH Peptidyl-prolyl cis-trans isomerase CYP37,... 120 4e-27
sp|Q55118|PPI3_SYNY3 Putative thylakoid lumen peptidyl-prolyl ci... 70 8e-12
sp|P72704|PPI1_SYNY3 Probable peptidyl-prolyl cis-trans isomeras... 54 3e-07
sp|O49939|TLP40_SPIOL Peptidyl-prolyl cis-trans isomerase, chlor... 52 1e-06
sp|Q9SSA5|CYP38_ARATH Peptidyl-prolyl cis-trans isomerase CYP38,... 49 1e-05
sp|P16748|UL68_HCMVA Uncharacterized protein UL68 OS=Human cytom... 33 1.1
sp|O25982|PPIA_HELPY Peptidyl-prolyl cis-trans isomerase OS=Heli... 33 1.1
sp|Q8G0J9|PPI1_BRUSU Probable peptidyl-prolyl cis-trans isomeras... 32 1.8
sp|Q8YHB5|PPI1_BRUME Probable peptidyl-prolyl cis-trans isomeras... 32 1.8
sp|Q57D43|PPI1_BRUAB Probable peptidyl-prolyl cis-trans isomeras... 32 1.8
sp|Q2YPY5|PPI1_BRUA2 Probable peptidyl-prolyl cis-trans isomeras... 32 1.8

>sp|P82869|CYP37_ARATH Peptidyl-prolyl cis-trans isomerase CYP37,
chloroplastic OS=Arabidopsis thaliana GN=CYP37 PE=1 SV=3
Length = 466

Score = 120 bits (301), Expect = 4e-27
Identities = 55/77 (71%), Positives = 67/77 (87%)
Frame = +2

Query: 2 YGAVAMAHSPKSEDFSAPSQFFFYLYDRRSAGLGGLSFDEGQFSVIGYVTNGKELLSQLR 181
YGAVAMAHS SE++S+P QFFFYLYD+R++GLGGLSFDEGQFSV GY GK++L Q++
Sbjct: 377 YGAVAMAHSENSEEYSSPYQFFFYLYDKRNSGLGGLSFDEGQFSVFGYTIAGKDILGQIK 436

Query: 182 TGDIIESAKLVSGADRL 232
TGDII+SAKL+ G DRL
Sbjct: 437 TGDIIKSAKLIEGQDRL 453


>sp|Q55118|PPI3_SYNY3 Putative thylakoid lumen peptidyl-prolyl
cis-trans isomerase sll0408 OS=Synechocystis sp. (strain
PCC 6803) GN=sll0408 PE=3 SV=2
Length = 379

Score = 69.7 bits (169), Expect = 8e-12
Identities = 38/78 (48%), Positives = 51/78 (65%)
Frame = +2

Query: 2 YGAVAMAHSPKSEDFSAPSQFFFYLYDRRSAGLGGLSFDEGQFSVIGYVTNGKELLSQLR 181
YGA+A+A P++E SQFFF+ +D G + +G++SV GYV +GKE L QL
Sbjct: 300 YGAIALAR-PETEPNGGSSQFFFFKFDTELTP-PGFNLMDGRYSVFGYVVDGKETLEQLS 357

Query: 182 TGDIIESAKLVSGADRLV 235
GD I SAK++SGAD LV
Sbjct: 358 EGDKIVSAKVISGADNLV 375


>sp|P72704|PPI1_SYNY3 Probable peptidyl-prolyl cis-trans isomerase
sll0227 OS=Synechocystis sp. (strain PCC 6803)
GN=sll0227 PE=3 SV=1
Length = 246

Score = 54.3 bits (129), Expect = 3e-07
Identities = 31/76 (40%), Positives = 47/76 (61%)
Frame = +2

Query: 5 GAVAMAHSPKSEDFSAPSQFFFYLYDRRSAGLGGLSFDEGQFSVIGYVTNGKELLSQLRT 184
GAVAMA S + SA SQF+F L D F +G ++V GYVT G +++ +++
Sbjct: 178 GAVAMARSQMPD--SASSQFYFTLSDETG-------FLDGDYAVFGYVTQGMDVVLKIKQ 228

Query: 185 GDIIESAKLVSGADRL 232
GD I+SAK+++G + L
Sbjct: 229 GDKIQSAKVITGQNNL 244


>sp|O49939|TLP40_SPIOL Peptidyl-prolyl cis-trans isomerase,
chloroplastic OS=Spinacia oleracea GN=TLP40 PE=1 SV=1
Length = 449

Score = 52.4 bits (124), Expect = 1e-06
Identities = 30/78 (38%), Positives = 46/78 (58%)
Frame = +2

Query: 2 YGAVAMAHSPKSEDFSAPSQFFFYLYDRRSAGLGGLSFDEGQFSVIGYVTNGKELLSQLR 181
+G +AMA + E+ S SQ F+ L + D G+++V GYVT+ ++ L+ L+
Sbjct: 366 FGTMAMARE-EFENNSGSSQIFWLLKESELTPSNANILD-GRYAVFGYVTDNQDYLADLK 423

Query: 182 TGDIIESAKLVSGADRLV 235
GD+IES + VSG D LV
Sbjct: 424 VGDVIESVQAVSGVDNLV 441


>sp|Q9SSA5|CYP38_ARATH Peptidyl-prolyl cis-trans isomerase CYP38,
chloroplastic OS=Arabidopsis thaliana GN=CYP38 PE=1 SV=1
Length = 437

Score = 49.3 bits (116), Expect = 1e-05
Identities = 28/77 (36%), Positives = 44/77 (57%)
Frame = +2

Query: 2 YGAVAMAHSPKSEDFSAPSQFFFYLYDRRSAGLGGLSFDEGQFSVIGYVTNGKELLSQLR 181
+G +AMA D S SQ F+ L + D G+++V GYVT+ ++ L+ L+
Sbjct: 354 FGTMAMAREEFEND-SGSSQVFWLLKESELTPSNSNILD-GRYAVFGYVTDNEDFLADLK 411

Query: 182 TGDIIESAKLVSGADRL 232
GD+IES ++VSG + L
Sbjct: 412 VGDVIESIQVVSGLENL 428


>sp|P16748|UL68_HCMVA Uncharacterized protein UL68 OS=Human
cytomegalovirus (strain AD169) GN=UL68 PE=4 SV=1
Length = 110

Score = 32.7 bits (73), Expect = 1.1
Identities = 14/31 (45%), Positives = 21/31 (67%)
Frame = +3

Query: 249 IVQVEGQVTFFSLPAMAVSYSFLLFTCPFYG 341
+V++E V FFS P + S+SF ++TCP G
Sbjct: 60 LVRIELGVYFFSSPTSSPSHSFYIYTCPRLG 90


>sp|O25982|PPIA_HELPY Peptidyl-prolyl cis-trans isomerase
OS=Helicobacter pylori GN=ppiA PE=3 SV=1
Length = 163

Score = 32.7 bits (73), Expect = 1.1
Identities = 22/68 (32%), Positives = 37/68 (54%), Gaps = 2/68 (2%)
Frame = +2

Query: 5 GAVAMAHSPKSEDFSAPSQFFFYLYDRRSAGLGGLSFDEGQFSVIGYVTN--GKELLSQL 178
G+++MAH+ + + SQFF D L +G+ +V G +T+ G +L ++
Sbjct: 100 GSISMAHAGRD---TGGSQFFLCFVD--------LPHLDGEHTVFGKITSAEGLSVLDKI 148

Query: 179 RTGDIIES 202
+ GDIIES
Sbjct: 149 KQGDIIES 156


>sp|Q8G0J9|PPI1_BRUSU Probable peptidyl-prolyl cis-trans isomerase
OS=Brucella suis GN=ppi PE=3 SV=1
Length = 196

Score = 32.0 bits (71), Expect = 1.8
Identities = 23/83 (27%), Positives = 39/83 (46%)
Frame = +2

Query: 5 GAVAMAHSPKSEDFSAPSQFFFYLYDRRSAGLGGLSFDEGQFSVIGYVTNGKELLSQLRT 184
G V MA S SA SQFF D F GQ++V+G V +G + + +++
Sbjct: 122 GTVGMARSQNPN--SANSQFFIMFDDG--------PFLNGQYTVVGKVVSGMDAVDKIKK 171

Query: 185 GDIIESAKLVSGADRLVFQPVDS 253
G E+ V D+++ +++
Sbjct: 172 GSEAENG-AVKNPDKIIKATIEA 193


>sp|Q8YHB5|PPI1_BRUME Probable peptidyl-prolyl cis-trans isomerase
OS=Brucella melitensis GN=ppi PE=3 SV=2
Length = 196

Score = 32.0 bits (71), Expect = 1.8
Identities = 23/83 (27%), Positives = 39/83 (46%)
Frame = +2

Query: 5 GAVAMAHSPKSEDFSAPSQFFFYLYDRRSAGLGGLSFDEGQFSVIGYVTNGKELLSQLRT 184
G V MA S SA SQFF D F GQ++V+G V +G + + +++
Sbjct: 122 GTVGMARSQNPN--SANSQFFIMFDDG--------PFLNGQYTVVGKVVSGMDAVDKIKK 171

Query: 185 GDIIESAKLVSGADRLVFQPVDS 253
G E+ V D+++ +++
Sbjct: 172 GSEAENG-AVKNPDKIIKATIEA 193


>sp|Q57D43|PPI1_BRUAB Probable peptidyl-prolyl cis-trans isomerase
OS=Brucella abortus GN=ppi PE=3 SV=1
Length = 196

Score = 32.0 bits (71), Expect = 1.8
Identities = 23/83 (27%), Positives = 39/83 (46%)
Frame = +2

Query: 5 GAVAMAHSPKSEDFSAPSQFFFYLYDRRSAGLGGLSFDEGQFSVIGYVTNGKELLSQLRT 184
G V MA S SA SQFF D F GQ++V+G V +G + + +++
Sbjct: 122 GTVGMARSQNPN--SANSQFFIMFDDG--------PFLNGQYTVVGKVVSGMDAVDKIKK 171

Query: 185 GDIIESAKLVSGADRLVFQPVDS 253
G E+ V D+++ +++
Sbjct: 172 GSEAENG-AVKNPDKIIKATIEA 193


tr_hit_id A9RZ62
Definition tr|A9RZ62|A9RZ62_PHYPA Predicted protein (Fragment) OS=Physcomitrella patens subsp. patens
Align length 78
Score (bit) 133.0
E-value 5.0e-30
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= DK943810|Adiantum capillus-veneris mRNA, clone:
YMU02A01NGRL0004_A11, 5'
(522 letters)

Database: uniprot_trembl.fasta
7,341,751 sequences; 2,391,615,440 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

tr|A9RZ62|A9RZ62_PHYPA Predicted protein (Fragment) OS=Physcomit... 133 5e-30
tr|A9TCN6|A9TCN6_PHYPA Predicted protein (Fragment) OS=Physcomit... 133 6e-30
tr|B8LRT4|B8LRT4_PICSI Putative uncharacterized protein OS=Picea... 128 2e-28
tr|Q7XIK0|Q7XIK0_ORYSJ Putative peptidyl-prolycis-trans isomeras... 127 4e-28
tr|Q7XIJ9|Q7XIJ9_ORYSJ Os07g0565600 protein OS=Oryza sativa subs... 127 4e-28
tr|B8B7H0|B8B7H0_ORYSI Putative uncharacterized protein OS=Oryza... 127 4e-28
tr|A3BL85|A3BL85_ORYSJ Putative uncharacterized protein OS=Oryza... 127 4e-28
tr|A7P1H5|A7P1H5_VITVI Chromosome chr19 scaffold_4, whole genome... 123 6e-27
tr|Q00TA5|Q00TA5_OSTTA Peptidyl-prolyl cis-trans isomerase TLP38... 87 5e-16
tr|A8INE5|A8INE5_CHLRE Peptidyl-prolyl cis-trans isomerase, cycl... 82 1e-14
tr|B5W488|B5W488_SPIMA Peptidyl-prolyl cis-trans isomerase cyclo... 69 2e-10
tr|B2J712|B2J712_NOSP7 Peptidyl-prolyl cis-trans isomerase, cycl... 67 5e-10
tr|B4VZ26|B4VZ26_9CYAN Peptidyl-prolyl cis-trans isomerase, cycl... 67 5e-10
tr|Q116D7|Q116D7_TRIEI Peptidyl-prolyl cis-trans isomerase OS=Tr... 64 3e-09
tr|A0ZHD7|A0ZHD7_NODSP Peptidyl-prolyl cis-trans isomerase OS=No... 64 4e-09
tr|A0YPV7|A0YPV7_9CYAN Peptidyl-prolyl cis-trans isomerase OS=Ly... 62 1e-08
tr|Q8DKN8|Q8DKN8_THEEB Peptidyl-prolyl cis-trans isomerase OS=Th... 61 3e-08
tr|Q3MAQ2|Q3MAQ2_ANAVT Peptidyl-prolyl cis-trans isomerase OS=An... 61 4e-08
tr|B0CD62|B0CD62_ACAM1 Peptidyl-prolyl cis-trans isomerase, cycl... 61 4e-08
tr|Q8YM80|Q8YM80_ANASP Peptidyl-prolyl cis-trans isomerase OS=An... 60 5e-08
tr|B0JTK1|B0JTK1_MICAN Peptidyl-prolyl cis-trans isomerase OS=Mi... 60 6e-08
tr|A8ZQK9|A8ZQK9_ACAM1 Peptidyl-prolyl cis-trans isomerase OS=Ac... 60 6e-08
tr|A8YFA2|A8YFA2_MICAE Peptidyl-prolyl cis-trans isomerase OS=Mi... 60 6e-08
tr|A0YN21|A0YN21_9CYAN Peptidyl-prolyl cis-trans isomerase OS=Ly... 60 6e-08
tr|B4BX39|B4BX39_9CHRO Putative uncharacterized protein OS=Cyano... 60 8e-08
tr|B7JUG9|B7JUG9_SYNP8 Peptidyl-prolyl cis-trans isomerase OS=Sy... 59 1e-07
tr|B4B800|B4B800_9CHRO Peptidyl-prolyl cis-trans isomerase cyclo... 59 1e-07
tr|B0C601|B0C601_ACAM1 Peptidyl-prolyl cis-trans isomerase, cycl... 59 2e-07
tr|Q7V9C0|Q7V9C0_PROMM Peptidyl-prolyl cis-trans isomerase OS=Pr... 58 2e-07
tr|Q2JIV4|Q2JIV4_SYNJB Peptidyl-prolyl cis-trans isomerase OS=Sy... 58 2e-07

>tr|A9RZ62|A9RZ62_PHYPA Predicted protein (Fragment)
OS=Physcomitrella patens subsp. patens
GN=PHYPADRAFT_121649 PE=4 SV=1
Length = 346

Score = 133 bits (335), Expect = 5e-30
Identities = 63/78 (80%), Positives = 73/78 (93%)
Frame = +2

Query: 2 YGAVAMAHSPKSEDFSAPSQFFFYLYDRRSAGLGGLSFDEGQFSVIGYVTNGKELLSQLR 181
YGAVAMAH+ SEDFS+PSQFFFYLYDRR++GLGGLSF+EGQFSV GYVT G+ELLSQL+
Sbjct: 268 YGAVAMAHNKTSEDFSSPSQFFFYLYDRRNSGLGGLSFEEGQFSVFGYVTKGRELLSQLK 327

Query: 182 TGDIIESAKLVSGADRLV 235
TGD+I+ AKLVSGADR+V
Sbjct: 328 TGDVIKEAKLVSGADRVV 345


>tr|A9TCN6|A9TCN6_PHYPA Predicted protein (Fragment)
OS=Physcomitrella patens subsp. patens
GN=PHYPADRAFT_143508 PE=4 SV=1
Length = 346

Score = 133 bits (334), Expect = 6e-30
Identities = 63/78 (80%), Positives = 72/78 (92%)
Frame = +2

Query: 2 YGAVAMAHSPKSEDFSAPSQFFFYLYDRRSAGLGGLSFDEGQFSVIGYVTNGKELLSQLR 181
YGAVAMAH+ SEDFS+PSQFFFYLYDRR++GLGGLSF+EGQFSV GYVT G+ELLSQL+
Sbjct: 268 YGAVAMAHNKTSEDFSSPSQFFFYLYDRRNSGLGGLSFEEGQFSVFGYVTKGRELLSQLK 327

Query: 182 TGDIIESAKLVSGADRLV 235
TGD+I+ AKLVSG DRLV
Sbjct: 328 TGDVIKEAKLVSGTDRLV 345


>tr|B8LRT4|B8LRT4_PICSI Putative uncharacterized protein OS=Picea
sitchensis PE=2 SV=1
Length = 484

Score = 128 bits (321), Expect = 2e-28
Identities = 62/85 (72%), Positives = 73/85 (85%)
Frame = +2

Query: 2 YGAVAMAHSPKSEDFSAPSQFFFYLYDRRSAGLGGLSFDEGQFSVIGYVTNGKELLSQLR 181
YG++AMAH+P SED+S+PSQFFFYLYD+R+AGLGGLSFDEGQFSV GY T GKE+L QL+
Sbjct: 401 YGSIAMAHNPISEDYSSPSQFFFYLYDKRNAGLGGLSFDEGQFSVFGYTTGGKEILPQLK 460

Query: 182 TGDIIESAKLVSGADRLVFQPVDST 256
TGDII+SAKLV G + LV P ST
Sbjct: 461 TGDIIKSAKLVDGFEHLVL-PSSST 484


>tr|Q7XIK0|Q7XIK0_ORYSJ Putative peptidyl-prolycis-trans isomerase
protein OS=Oryza sativa subsp. japonica
GN=OJ1773_H01.112-1 PE=4 SV=1
Length = 465

Score = 127 bits (318), Expect = 4e-28
Identities = 58/81 (71%), Positives = 72/81 (88%)
Frame = +2

Query: 2 YGAVAMAHSPKSEDFSAPSQFFFYLYDRRSAGLGGLSFDEGQFSVIGYVTNGKELLSQLR 181
YGAVAMAHS S+++S+PSQFFFYLYD+R++GLGG+SFDEGQFSV GY T+G+E+LSQ++
Sbjct: 379 YGAVAMAHSVDSDEYSSPSQFFFYLYDKRNSGLGGISFDEGQFSVFGYTTDGREVLSQIK 438

Query: 182 TGDIIESAKLVSGADRLVFQP 244
TGDII SAKLV G +RLV P
Sbjct: 439 TGDIIRSAKLVQGRERLVLPP 459


>tr|Q7XIJ9|Q7XIJ9_ORYSJ Os07g0565600 protein OS=Oryza sativa subsp.
japonica GN=OJ1773_H01.112-2 PE=4 SV=1
Length = 432

Score = 127 bits (318), Expect = 4e-28
Identities = 58/81 (71%), Positives = 72/81 (88%)
Frame = +2

Query: 2 YGAVAMAHSPKSEDFSAPSQFFFYLYDRRSAGLGGLSFDEGQFSVIGYVTNGKELLSQLR 181
YGAVAMAHS S+++S+PSQFFFYLYD+R++GLGG+SFDEGQFSV GY T+G+E+LSQ++
Sbjct: 346 YGAVAMAHSVDSDEYSSPSQFFFYLYDKRNSGLGGISFDEGQFSVFGYTTDGREVLSQIK 405

Query: 182 TGDIIESAKLVSGADRLVFQP 244
TGDII SAKLV G +RLV P
Sbjct: 406 TGDIIRSAKLVQGRERLVLPP 426


>tr|B8B7H0|B8B7H0_ORYSI Putative uncharacterized protein OS=Oryza
sativa subsp. indica GN=OsI_26503 PE=4 SV=1
Length = 432

Score = 127 bits (318), Expect = 4e-28
Identities = 58/81 (71%), Positives = 72/81 (88%)
Frame = +2

Query: 2 YGAVAMAHSPKSEDFSAPSQFFFYLYDRRSAGLGGLSFDEGQFSVIGYVTNGKELLSQLR 181
YGAVAMAHS S+++S+PSQFFFYLYD+R++GLGG+SFDEGQFSV GY T+G+E+LSQ++
Sbjct: 346 YGAVAMAHSVDSDEYSSPSQFFFYLYDKRNSGLGGISFDEGQFSVFGYTTDGREVLSQIK 405

Query: 182 TGDIIESAKLVSGADRLVFQP 244
TGDII SAKLV G +RLV P
Sbjct: 406 TGDIIRSAKLVQGRERLVLPP 426


>tr|A3BL85|A3BL85_ORYSJ Putative uncharacterized protein OS=Oryza
sativa subsp. japonica GN=OsJ_023807 PE=4 SV=1
Length = 452

Score = 127 bits (318), Expect = 4e-28
Identities = 58/81 (71%), Positives = 72/81 (88%)
Frame = +2

Query: 2 YGAVAMAHSPKSEDFSAPSQFFFYLYDRRSAGLGGLSFDEGQFSVIGYVTNGKELLSQLR 181
YGAVAMAHS S+++S+PSQFFFYLYD+R++GLGG+SFDEGQFSV GY T+G+E+LSQ++
Sbjct: 366 YGAVAMAHSVDSDEYSSPSQFFFYLYDKRNSGLGGISFDEGQFSVFGYTTDGREVLSQIK 425

Query: 182 TGDIIESAKLVSGADRLVFQP 244
TGDII SAKLV G +RLV P
Sbjct: 426 TGDIIRSAKLVQGRERLVLPP 446


>tr|A7P1H5|A7P1H5_VITVI Chromosome chr19 scaffold_4, whole genome
shotgun sequence OS=Vitis vinifera GN=GSVIVT00027619001
PE=4 SV=1
Length = 207

Score = 123 bits (308), Expect = 6e-27
Identities = 58/78 (74%), Positives = 68/78 (87%)
Frame = +2

Query: 2 YGAVAMAHSPKSEDFSAPSQFFFYLYDRRSAGLGGLSFDEGQFSVIGYVTNGKELLSQLR 181
YGAVAMAHS S+++S+P QFFFYLYD+RSAGLGGLSFDEGQFSV GY T G+E+LSQ++
Sbjct: 125 YGAVAMAHSETSDEYSSPYQFFFYLYDKRSAGLGGLSFDEGQFSVFGYTTAGREILSQIK 184

Query: 182 TGDIIESAKLVSGADRLV 235
TGDII SAKLV G D L+
Sbjct: 185 TGDIIRSAKLVEGRDCLI 202


>tr|Q00TA5|Q00TA5_OSTTA Peptidyl-prolyl cis-trans isomerase TLP38,
chloroplast / thylakoid lumen PPIase of 38 kDa /
cyclophilin / rotamase (ISS) OS=Ostreococcus tauri
GN=Ot17g01840 PE=4 SV=1
Length = 429

Score = 87.0 bits (214), Expect = 5e-16
Identities = 44/76 (57%), Positives = 56/76 (73%)
Frame = +2

Query: 5 GAVAMAHSPKSEDFSAPSQFFFYLYDRRSAGLGGLSFDEGQFSVIGYVTNGKELLSQLRT 184
G+VAMA S S+ S QFF YL+D+RSAGLGGLSF+EG+FSV GYVT G+E L + T
Sbjct: 333 GSVAMARS--SDGQSDKDQFFVYLFDKRSAGLGGLSFEEGEFSVFGYVTKGEEYLGSIGT 390

Query: 185 GDIIESAKLVSGADRL 232
+I+ AK+ SG D+L
Sbjct: 391 NAVIDRAKITSGEDKL 406


>tr|A8INE5|A8INE5_CHLRE Peptidyl-prolyl cis-trans isomerase,
cyclophilin-type OS=Chlamydomonas reinhardtii GN=CYN37
PE=4 SV=1
Length = 398

Score = 82.4 bits (202), Expect = 1e-14
Identities = 41/78 (52%), Positives = 55/78 (70%), Gaps = 1/78 (1%)
Frame = +2

Query: 5 GAVAMAHSPKSEDFSAPSQFFFYLYDRRSAGLGGLSFDEGQFSVIGYVTNGKE-LLSQLR 181
GAV A P ++ + + + +F Y +D++ AGLGGL+FDEGQF V GYVT G E +L +L
Sbjct: 319 GAVTFARLPTTDSYLSGTDWFVYKFDKQQAGLGGLAFDEGQFGVFGYVTEGLEGVLPRLA 378

Query: 182 TGDIIESAKLVSGADRLV 235
GDII AK+VSG D+LV
Sbjct: 379 PGDIIVEAKVVSGGDKLV 396