DK943829
Clone id YMU02A01NGRL0004_B14
Library
Length 330
Definition Adiantum capillus-veneris mRNA. clone: YMU02A01NGRL0004_B14. 5' end sequence.
Accession
Tissue type young leaves
Developmental stage sporophyte
Contig ID -
Sequence
GTACAAGGGCTTAATTTTATGGTCCTTCATTGTTGGGGATACAAGATACGCACAGTTGCT
GGCAGGATTTCTTTCAATTTTTTAGAATACTTCTGTAAGATTGATCTGATCAGGGAAGAA
ATGCATCACGACACATTCTTTGATGCTTGTGGTAATCATTCGCATTTTTGGAGTGATCTG
TGCCATGAACTCAGTAGGAGTATCCTAGGAGCTCAACTGGTGTTTTAGATTCGTGAGATT
GCGATGTATTCTTGTTATTTGCTCCTGTAAAATGTCTCAATGCAAGATATGGTTTGTTTC
TTAAAAAAAAAAAAAAAAAAAAAAAAAAAA
■■Homology search results ■■ -
sp_hit_id Q4R8R3
Definition sp|Q4R8R3|CC112_MACFA Coiled-coil domain-containing protein 112 OS=Macaca fascicularis
Align length 43
Score (bit) 31.2
E-value 1.7
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= DK943829|Adiantum capillus-veneris mRNA, clone:
YMU02A01NGRL0004_B14, 5'
(302 letters)

Database: uniprot_sprot.fasta
412,525 sequences; 148,809,765 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

sp|Q4R8R3|CC112_MACFA Coiled-coil domain-containing protein 112 ... 31 1.7
sp|Q8NEF3|CC112_HUMAN Coiled-coil domain-containing protein 112 ... 31 1.7

>sp|Q4R8R3|CC112_MACFA Coiled-coil domain-containing protein 112
OS=Macaca fascicularis GN=CCDC112 PE=2 SV=1
Length = 446

Score = 31.2 bits (69), Expect = 1.7
Identities = 13/43 (30%), Positives = 24/43 (55%)
Frame = -3

Query: 270 LQEQITRIHRNLTNLKHQLSS*DTPTEFMAQITPKMRMITTSI 142
+Q+Q+ +IH N+ L+HQL +F+ ++ M I +I
Sbjct: 41 IQQQLAKIHNNVKKLQHQLKDVKPTPDFVEKLREMMEEIENAI 83


>sp|Q8NEF3|CC112_HUMAN Coiled-coil domain-containing protein 112
OS=Homo sapiens GN=CCDC112 PE=2 SV=2
Length = 446

Score = 31.2 bits (69), Expect = 1.7
Identities = 13/43 (30%), Positives = 24/43 (55%)
Frame = -3

Query: 270 LQEQITRIHRNLTNLKHQLSS*DTPTEFMAQITPKMRMITTSI 142
+Q+Q+ +IH N+ L+HQL +F+ ++ M I +I
Sbjct: 41 IQQQLAKIHNNVKKLQHQLKDVKPTPDFVEKLREMMEEIENAI 83


tr_hit_id B1ILE9
Definition tr|B1ILE9|B1ILE9_CLOBK Xanthine dehydrogenase family protein, molybdopterin-binding subunit OS=Clostridium botulinum (strain Okra / Type B1)
Align length 47
Score (bit) 34.3
E-value 3.1
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= DK943829|Adiantum capillus-veneris mRNA, clone:
YMU02A01NGRL0004_B14, 5'
(302 letters)

Database: uniprot_trembl.fasta
7,341,751 sequences; 2,391,615,440 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

tr|B1ILE9|B1ILE9_CLOBK Xanthine dehydrogenase family protein, mo... 34 3.1
tr|A7GHA2|A7GHA2_CLOBL Xanthine dehydrogenase family protein, mo... 34 3.1
tr|A7FXE0|A7FXE0_CLOB1 Xanthine dehydrogenase family protein, mo... 34 3.1
tr|A5I5W5|A5I5W5_CLOBH Xanthine dehydrogenase, molybdenum bindin... 34 3.1
tr|B1QB59|B1QB59_CLOBO Xanthine dehydrogenase family protein, mo... 34 3.1
tr|A7G748|A7G748_CLOBH Xanthine dehydrogenase family protein, mo... 34 3.1
tr|B6FKZ9|B6FKZ9_9CLOT Putative uncharacterized protein OS=Clost... 33 5.4

>tr|B1ILE9|B1ILE9_CLOBK Xanthine dehydrogenase family protein,
molybdopterin-binding subunit OS=Clostridium botulinum
(strain Okra / Type B1) GN=CLD_1661 PE=4 SV=1
Length = 851

Score = 34.3 bits (77), Expect = 3.1
Identities = 15/47 (31%), Positives = 29/47 (61%)
Frame = -3

Query: 186 MAQITPKMRMITTSIKECVVMHFFPDQINLTEVF*KIERNPASNCAY 46
MA + K +++TTS++EC F+ + ++T+ ++NP S+ AY
Sbjct: 670 MASLKLKEKLLTTSLEECEGEEFYGEYQSITDPINSDKKNPVSHVAY 716


>tr|A7GHA2|A7GHA2_CLOBL Xanthine dehydrogenase family protein,
molybdopterin-binding subunit OS=Clostridium botulinum
(strain Langeland / NCTC 10281 / Type F) GN=CLI_2937
PE=4 SV=1
Length = 851

Score = 34.3 bits (77), Expect = 3.1
Identities = 15/47 (31%), Positives = 29/47 (61%)
Frame = -3

Query: 186 MAQITPKMRMITTSIKECVVMHFFPDQINLTEVF*KIERNPASNCAY 46
MA + K +++TTS++EC F+ + ++T+ ++NP S+ AY
Sbjct: 670 MASLKLKEKLLTTSLEECEGEEFYGEYQSITDPINSDKKNPVSHVAY 716


>tr|A7FXE0|A7FXE0_CLOB1 Xanthine dehydrogenase family protein,
molybdopterin-binding subunit OS=Clostridium botulinum
(strain ATCC 19397 / Type A) GN=CLB_2845 PE=4 SV=1
Length = 851

Score = 34.3 bits (77), Expect = 3.1
Identities = 15/47 (31%), Positives = 29/47 (61%)
Frame = -3

Query: 186 MAQITPKMRMITTSIKECVVMHFFPDQINLTEVF*KIERNPASNCAY 46
MA + K +++TTS++EC F+ + ++T+ ++NP S+ AY
Sbjct: 670 MASLKLKEKLLTTSLEECEGEEFYGEYQSITDPINSDKKNPVSHVAY 716


>tr|A5I5W5|A5I5W5_CLOBH Xanthine dehydrogenase, molybdenum binding
and iron-sulfur binding subunits OS=Clostridium
botulinum (strain Hall / ATCC 3502 / NCTC 13319 / Type
A) GN=xdhAC PE=4 SV=1
Length = 856

Score = 34.3 bits (77), Expect = 3.1
Identities = 15/47 (31%), Positives = 29/47 (61%)
Frame = -3

Query: 186 MAQITPKMRMITTSIKECVVMHFFPDQINLTEVF*KIERNPASNCAY 46
MA + K +++TTS++EC F+ + ++T+ ++NP S+ AY
Sbjct: 675 MASLKLKEKLLTTSLEECEGEEFYGEYQSITDPINSDKKNPVSHVAY 721


>tr|B1QB59|B1QB59_CLOBO Xanthine dehydrogenase family protein,
molybdopterin-binding subunit OS=Clostridium botulinum
NCTC 2916 GN=CBN_2870 PE=4 SV=1
Length = 851

Score = 34.3 bits (77), Expect = 3.1
Identities = 15/47 (31%), Positives = 29/47 (61%)
Frame = -3

Query: 186 MAQITPKMRMITTSIKECVVMHFFPDQINLTEVF*KIERNPASNCAY 46
MA + K +++TTS++EC F+ + ++T+ ++NP S+ AY
Sbjct: 670 MASLKLKEKLLTTSLEECEGEEFYGEYQSITDPINSDKKNPVSHVAY 716


>tr|A7G748|A7G748_CLOBH Xanthine dehydrogenase family protein,
molybdopterin-binding subunit OS=Clostridium botulinum
(strain Hall / ATCC 3502 / NCTC 13319 / Type A)
GN=CLC_2778 PE=4 SV=1
Length = 851

Score = 34.3 bits (77), Expect = 3.1
Identities = 15/47 (31%), Positives = 29/47 (61%)
Frame = -3

Query: 186 MAQITPKMRMITTSIKECVVMHFFPDQINLTEVF*KIERNPASNCAY 46
MA + K +++TTS++EC F+ + ++T+ ++NP S+ AY
Sbjct: 670 MASLKLKEKLLTTSLEECEGEEFYGEYQSITDPINSDKKNPVSHVAY 716


>tr|B6FKZ9|B6FKZ9_9CLOT Putative uncharacterized protein
OS=Clostridium nexile DSM 1787 GN=CLONEX_00795 PE=4 SV=1
Length = 468

Score = 33.5 bits (75), Expect = 5.4
Identities = 24/77 (31%), Positives = 38/77 (49%), Gaps = 7/77 (9%)
Frame = -3

Query: 276 DILQEQITRIHRNLTNLKHQLSS*DTP-------TEFMAQITPKMRMITTSIKECVVMHF 118
DI + QITRIH L +LK +S+ E M + + M+T+ I+E + +
Sbjct: 90 DINRNQITRIHNTLESLKQNISTLQARIQSSVDYEENMVYLDENIYMLTSVIQEGIQEYI 149

Query: 117 FPDQINLTEVF*KIERN 67
+ NL EV + ER+
Sbjct: 150 HVETTNLQEVRIEQERH 166