DK943869
Clone id YMU02A01NGRL0004_D10
Library
Length 589
Definition Adiantum capillus-veneris mRNA. clone: YMU02A01NGRL0004_D10. 5' end sequence.
Accession
Tissue type young leaves
Developmental stage sporophyte
Contig ID -
Sequence
GGATAGTCCTGAGGGTGGTCACATTGTTCCAGCGCAGTACCTCGAACCATGCACATGACG
AGGCCGGCGTCAGTGAGGGCGTACGCGGAGGTGCTGAGACTTGTGCGTCGCCTACCTCCG
GAGGCGCGCTCTTACTACTCCCGCTTCGCGCGAGAGAACTTCGCCACTTACAACGACGAG
GTCGATCAGTCCACCATCTCTACTCTGCTTGCTCGAGCTTACAAACACTCTTGCTGGGTC
CTTTCCAAGTATGGAGTTGACAAAGCTGCAGCAGATAAATTGAAGCAGATCTGCAAGTAA
AACTGGATCTTGGAATCCTGGATATGAAGCTGGCTGTGAAGGTGCCATTATCGCTCATAA
AAAGGGGTGCTTTGAAATTGGTGGGAGGAGGTGGCACCTTTTTGAAGAACTAGAGTGTCC
GGCTGGTGGAAGTGTTGTGTCGTTTGCAAACAGTTGTTGAAATGATTGTACTTTGAAGTG
CTCAAATTTGTTGATGGGGTCTGTCTAGAAGGAATTGAGCTTAATTACTAATGGTGTGTT
CAACACTCGCAGAGGATCGGTCTCAATAGTAGTAAGAGCTCCCAAGCTC
■■Homology search results ■■ -
sp_hit_id Q1G3M2
Definition sp|Q1G3M2|U631_ARATH UPF0631 protein At3g19508 OS=Arabidopsis thaliana
Align length 76
Score (bit) 86.3
E-value 1.0e-16
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= DK943869|Adiantum capillus-veneris mRNA, clone:
YMU02A01NGRL0004_D10, 5'
(589 letters)

Database: uniprot_sprot.fasta
412,525 sequences; 148,809,765 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

sp|Q1G3M2|U631_ARATH UPF0631 protein At3g19508 OS=Arabidopsis th... 86 1e-16
sp|A9SNJ1|U631_PHYPA UPF0631 protein OS=Physcomitrella patens GN... 78 4e-14
sp|B4F6X2|U631_XENTR UPF0631 protein HSD24 homolog OS=Xenopus tr... 41 0.005
sp|B3DFV0|U631_DANRE UPF0631 protein HSD24 homolog OS=Danio reri... 40 0.007
sp|A5D7J1|U631_BOVIN UPF0631 protein HSD24 homolog OS=Bos taurus... 40 0.009
sp|Q3UN90|U631_MOUSE UPF0631 protein HSD24 homolog OS=Mus muscul... 40 0.011
sp|B2RZD7|U631_RAT UPF0631 protein HSD24 homolog OS=Rattus norve... 39 0.015
sp|A8MSI8|U631_HUMAN UPF0631 protein HSD24 OS=Homo sapiens GN=HS... 38 0.043
sp|Q8N9K5|ZN565_HUMAN Zinc finger protein 565 OS=Homo sapiens GN... 35 0.28
sp|Q8R033|LYRM2_MOUSE LYR motif-containing protein 2 OS=Mus musc... 32 3.1
sp|Q5HF43|ISDH_STAAC Iron-regulated surface determinant protein ... 31 5.2
sp|Q2FG07|ISDH_STAA3 Iron-regulated surface determinant protein ... 31 5.2
sp|P56125|HEM1_HELPY Glutamyl-tRNA reductase OS=Helicobacter pyl... 31 5.2
sp|Q9ZMJ5|HEM1_HELPJ Glutamyl-tRNA reductase OS=Helicobacter pyl... 31 5.2
sp|Q1CUR3|HEM1_HELPH Glutamyl-tRNA reductase OS=Helicobacter pyl... 31 5.2
sp|Q17W63|HEM1_HELAH Glutamyl-tRNA reductase OS=Helicobacter aci... 31 5.2
sp|B2GV91|LYRM2_RAT LYR motif-containing protein 2 OS=Rattus nor... 30 6.9

>sp|Q1G3M2|U631_ARATH UPF0631 protein At3g19508 OS=Arabidopsis
thaliana GN=At3g19508 PE=3 SV=1
Length = 81

Score = 86.3 bits (212), Expect = 1e-16
Identities = 42/76 (55%), Positives = 55/76 (72%), Gaps = 2/76 (2%)
Frame = +1

Query: 73 VRAYAEVLRLVRRLPPEARSYYSRFARENFATYNDEVDQS--TISTLLARAYKHSCWVLS 246
+R Y V+RLVR LP ++R YY+++ARENF Y EVDQS ++ L RAY HS WVL
Sbjct: 5 LRVYGGVMRLVRLLPADSRPYYAKYARENFVNYR-EVDQSETSLDELFQRAYNHSLWVLK 63

Query: 247 KYGVDKAAADKLKQIC 294
KY +D++AA KLK+IC
Sbjct: 64 KYSIDESAATKLKEIC 79


>sp|A9SNJ1|U631_PHYPA UPF0631 protein OS=Physcomitrella patens
GN=PHYPADRAFT_186863 PE=3 SV=1
Length = 66

Score = 77.8 bits (190), Expect = 4e-14
Identities = 33/58 (56%), Positives = 46/58 (79%)
Frame = +1

Query: 76 RAYAEVLRLVRRLPPEARSYYSRFARENFATYNDEVDQSTISTLLARAYKHSCWVLSK 249
+AY EVL+LV+RLPP +R YY+++ARENF TY++ D +I +LLAR + H+CWVL K
Sbjct: 7 QAYREVLKLVKRLPPPSRGYYAQYARENFVTYSEVEDPESIRSLLARVHHHTCWVLKK 64


>sp|B4F6X2|U631_XENTR UPF0631 protein HSD24 homolog OS=Xenopus
tropicalis PE=3 SV=1
Length = 78

Score = 40.8 bits (94), Expect = 0.005
Identities = 20/61 (32%), Positives = 35/61 (57%), Gaps = 1/61 (1%)
Frame = +1

Query: 73 VRAYAEVLRLVRRLPPEA-RSYYSRFARENFATYNDEVDQSTISTLLARAYKHSCWVLSK 249
++ Y +LR + LP E+ + YY +++F + DE D I ++ RA + + WVL+K
Sbjct: 14 LQLYRYLLRCCKLLPTESLQHYYRHSVKQSFRVHADEDDPERIQQIIKRAIEDADWVLNK 73

Query: 250 Y 252
Y
Sbjct: 74 Y 74


>sp|B3DFV0|U631_DANRE UPF0631 protein HSD24 homolog OS=Danio rerio
GN=zgc:193694 PE=3 SV=1
Length = 78

Score = 40.4 bits (93), Expect = 0.007
Identities = 20/61 (32%), Positives = 35/61 (57%), Gaps = 1/61 (1%)
Frame = +1

Query: 73 VRAYAEVLRLVRRLPPEA-RSYYSRFARENFATYNDEVDQSTISTLLARAYKHSCWVLSK 249
++ Y +LR R LP EA + +Y R+++ ++ DE D I ++ RA + W+L+K
Sbjct: 14 LQLYRYLLRCCRLLPSEAMQKHYQHAIRQSYNSHVDEDDPQRIQMIIQRAISDADWILNK 73

Query: 250 Y 252
Y
Sbjct: 74 Y 74


>sp|A5D7J1|U631_BOVIN UPF0631 protein HSD24 homolog OS=Bos taurus
PE=3 SV=1
Length = 78

Score = 40.0 bits (92), Expect = 0.009
Identities = 18/61 (29%), Positives = 36/61 (59%), Gaps = 1/61 (1%)
Frame = +1

Query: 73 VRAYAEVLRLVRRLPPEA-RSYYSRFARENFATYNDEVDQSTISTLLARAYKHSCWVLSK 249
++ Y +LR R+LP + + +Y R++F ++DE + I ++ RA + + W+L+K
Sbjct: 14 LQLYRYLLRCCRQLPTKGIQEHYKHAVRQSFRVHSDEDNPERIQQIIKRAIEDADWILNK 73

Query: 250 Y 252
Y
Sbjct: 74 Y 74


>sp|Q3UN90|U631_MOUSE UPF0631 protein HSD24 homolog OS=Mus musculus
PE=2 SV=1
Length = 78

Score = 39.7 bits (91), Expect = 0.011
Identities = 17/61 (27%), Positives = 36/61 (59%), Gaps = 1/61 (1%)
Frame = +1

Query: 73 VRAYAEVLRLVRRLPPEA-RSYYSRFARENFATYNDEVDQSTISTLLARAYKHSCWVLSK 249
++ Y +LR R+LP + + +Y R++F ++DE + I ++ RA + + W+++K
Sbjct: 14 LQLYRYLLRCCRQLPTKGIQEHYKHAVRQSFQVHSDEDNSERIQQIIKRAIEDADWIMNK 73

Query: 250 Y 252
Y
Sbjct: 74 Y 74


>sp|B2RZD7|U631_RAT UPF0631 protein HSD24 homolog OS=Rattus
norvegicus PE=3 SV=1
Length = 78

Score = 39.3 bits (90), Expect = 0.015
Identities = 17/61 (27%), Positives = 36/61 (59%), Gaps = 1/61 (1%)
Frame = +1

Query: 73 VRAYAEVLRLVRRLPPEA-RSYYSRFARENFATYNDEVDQSTISTLLARAYKHSCWVLSK 249
++ Y +LR R+LP + + +Y R++F ++DE + I ++ RA + + W+++K
Sbjct: 14 LQLYRYLLRCCRQLPTKGIQEHYKHAVRQSFQVHSDEDNPERIQQIIRRAIEDADWIMNK 73

Query: 250 Y 252
Y
Sbjct: 74 Y 74


>sp|A8MSI8|U631_HUMAN UPF0631 protein HSD24 OS=Homo sapiens GN=HSD24
PE=3 SV=2
Length = 78

Score = 37.7 bits (86), Expect = 0.043
Identities = 16/61 (26%), Positives = 36/61 (59%), Gaps = 1/61 (1%)
Frame = +1

Query: 73 VRAYAEVLRLVRRLPPEA-RSYYSRFARENFATYNDEVDQSTISTLLARAYKHSCWVLSK 249
++ Y +LR ++LP + + +Y R++F ++DE + I ++ RA + + W+++K
Sbjct: 14 LQLYRYLLRCCQQLPTKGIQQHYKHAVRQSFRVHSDEDNPERIQQIIKRAIEDADWIMNK 73

Query: 250 Y 252
Y
Sbjct: 74 Y 74


>sp|Q8N9K5|ZN565_HUMAN Zinc finger protein 565 OS=Homo sapiens
GN=ZNF565 PE=2 SV=1
Length = 499

Score = 35.0 bits (79), Expect = 0.28
Identities = 16/39 (41%), Positives = 21/39 (53%)
Frame = +2

Query: 302 TGSWNPGYEAGCEGAIIAHKKGCFEIGGRRWHLFEELEC 418
TG W P E+ CE + +K FEIG W + E L+C
Sbjct: 72 TGPWCPDLESRCEKFL---QKDIFEIGAFNWEIMESLKC 107


>sp|Q8R033|LYRM2_MOUSE LYR motif-containing protein 2 OS=Mus
musculus GN=Lyrm2 PE=2 SV=1
Length = 88

Score = 31.6 bits (70), Expect = 3.1
Identities = 16/63 (25%), Positives = 32/63 (50%), Gaps = 1/63 (1%)
Frame = +1

Query: 31 SAVPRTMHMTRPASVRAYAEVLRLVRRLPPEA-RSYYSRFARENFATYNDEVDQSTISTL 207
+A+ M R + Y ++LR +R++P ++ R Y +ARE F ++ TI +
Sbjct: 9 AALTLKQFMRRQQVLLLYRKILRAIRQVPSDSDRKYLQDWAREEFKRNKSATEEDTIRMM 68

Query: 208 LAR 216
+ +
Sbjct: 69 ITQ 71


tr_hit_id Q8LQX1
Definition tr|Q8LQX1|Q8LQX1_ORYSJ cDNA, clone: J065059I08, full insert sequence OS=Oryza sativa subsp. japonica
Align length 77
Score (bit) 93.2
E-value 1.0e-17
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= DK943869|Adiantum capillus-veneris mRNA, clone:
YMU02A01NGRL0004_D10, 5'
(589 letters)

Database: uniprot_trembl.fasta
7,341,751 sequences; 2,391,615,440 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

tr|Q8LQX1|Q8LQX1_ORYSJ cDNA, clone: J065059I08, full insert sequ... 93 1e-17
tr|A2WPK5|A2WPK5_ORYSI Putative uncharacterized protein OS=Oryza... 93 1e-17
tr|A7QW58|A7QW58_VITVI Chromosome chr3 scaffold_199, whole genom... 92 2e-17
tr|A9NK74|A9NK74_PICSI Putative uncharacterized protein OS=Picea... 91 5e-17
tr|B6TG05|B6TG05_MAIZE Putative uncharacterized protein OS=Zea m... 82 2e-14
tr|A9NJS7|A9NJS7_PICSI Putative uncharacterized protein OS=Picea... 71 4e-11
tr|A5BB37|A5BB37_VITVI Putative uncharacterized protein OS=Vitis... 67 6e-10
tr|Q86AY8|Q86AY8_DICDI Similar to Dictyostelium discoideum (Slim... 42 0.020
tr|A5AUG1|A5AUG1_VITVI Putative uncharacterized protein OS=Vitis... 41 0.044
tr|A5C0H3|A5C0H3_VITVI Putative uncharacterized protein OS=Vitis... 40 0.097
tr|A5AKV1|A5AKV1_VITVI Putative uncharacterized protein OS=Vitis... 40 0.097
tr|A5BZ09|A5BZ09_VITVI Putative uncharacterized protein OS=Vitis... 39 0.28
tr|A5AGM6|A5AGM6_VITVI Putative uncharacterized protein OS=Vitis... 37 0.82
tr|A5AEE4|A5AEE4_VITVI Putative uncharacterized protein OS=Vitis... 36 1.8
tr|A8N6N0|A8N6N0_COPC7 Putative uncharacterized protein OS=Copri... 35 2.4
tr|B3KQ35|B3KQ35_HUMAN cDNA FLJ32728 fis, clone TESTI2001049, hi... 35 3.2
tr|Q5A7N5|Q5A7N5_CANAL Putative uncharacterized protein OS=Candi... 34 7.1
tr|Q3KEP9|Q3KEP9_PSEPF Membrane protein involved in the export o... 33 9.1
tr|B6ABX8|B6ABX8_9CRYT Putative uncharacterized protein OS=Crypt... 33 9.1
tr|A5EAZ5|A5EAZ5_BRASB Putative Non-ribosomal peptide synthase O... 33 9.2

>tr|Q8LQX1|Q8LQX1_ORYSJ cDNA, clone: J065059I08, full insert
sequence OS=Oryza sativa subsp. japonica GN=B1045F02.18
PE=4 SV=1
Length = 86

Score = 93.2 bits (230), Expect = 1e-17
Identities = 45/77 (58%), Positives = 56/77 (72%), Gaps = 1/77 (1%)
Frame = +1

Query: 67 ASVRAYAEVLRLVRRLPPEARSYYSRFARENFATYNDEVDQSTISTLLARAYKHSCWVLS 246
A +RAY EVLRLVRRLP +AR YY+++ARENF Y D ++ LL RAY HS WVLS
Sbjct: 4 AGLRAYREVLRLVRRLPADARPYYAKYARENFVNYRDLSADDDLAALLRRAYAHSSWVLS 63

Query: 247 KYGVD-KAAADKLKQIC 294
KY +D AAA +LK++C
Sbjct: 64 KYSIDADAAAGRLKEVC 80


>tr|A2WPK5|A2WPK5_ORYSI Putative uncharacterized protein OS=Oryza
sativa subsp. indica GN=OsI_01786 PE=4 SV=1
Length = 86

Score = 93.2 bits (230), Expect = 1e-17
Identities = 45/77 (58%), Positives = 56/77 (72%), Gaps = 1/77 (1%)
Frame = +1

Query: 67 ASVRAYAEVLRLVRRLPPEARSYYSRFARENFATYNDEVDQSTISTLLARAYKHSCWVLS 246
A +RAY EVLRLVRRLP +AR YY+++ARENF Y D ++ LL RAY HS WVLS
Sbjct: 4 AGLRAYREVLRLVRRLPADARPYYAKYARENFVNYRDLSADDDLAALLRRAYAHSSWVLS 63

Query: 247 KYGVD-KAAADKLKQIC 294
KY +D AAA +LK++C
Sbjct: 64 KYSIDADAAAGRLKEVC 80


>tr|A7QW58|A7QW58_VITVI Chromosome chr3 scaffold_199, whole genome
shotgun sequence OS=Vitis vinifera GN=GSVIVT00007709001
PE=4 SV=1
Length = 82

Score = 92.4 bits (228), Expect = 2e-17
Identities = 43/77 (55%), Positives = 56/77 (72%), Gaps = 2/77 (2%)
Frame = +1

Query: 70 SVRAYAEVLRLVRRLPPEARSYYSRFARENFATYN--DEVDQSTISTLLARAYKHSCWVL 243
+++AY VLRLVRRLP + R YY+++ARENF Y D D + ++ L R Y HS WVL
Sbjct: 4 ALKAYGAVLRLVRRLPKDTRPYYAKYARENFVNYREVDAADPNALNDLFNRTYTHSLWVL 63

Query: 244 SKYGVDKAAADKLKQIC 294
+KY VD+AAADKLK+IC
Sbjct: 64 NKYSVDQAAADKLKEIC 80


>tr|A9NK74|A9NK74_PICSI Putative uncharacterized protein OS=Picea
sitchensis PE=4 SV=1
Length = 81

Score = 90.9 bits (224), Expect = 5e-17
Identities = 40/75 (53%), Positives = 52/75 (69%)
Frame = +1

Query: 70 SVRAYAEVLRLVRRLPPEARSYYSRFARENFATYNDEVDQSTISTLLARAYKHSCWVLSK 249
S+RAY +LRL+R LP + RSYY ++ARENF Y + ++ LL R Y H+CWVL K
Sbjct: 4 SLRAYGGILRLIRLLPKQTRSYYQKYARENFVNYREVSGSDSMEELLQRTYNHACWVLKK 63

Query: 250 YGVDKAAADKLKQIC 294
Y VD+AAA LK+IC
Sbjct: 64 YQVDEAAAKNLKEIC 78


>tr|B6TG05|B6TG05_MAIZE Putative uncharacterized protein OS=Zea mays
PE=4 SV=1
Length = 86

Score = 82.0 bits (201), Expect = 2e-14
Identities = 40/76 (52%), Positives = 50/76 (65%), Gaps = 1/76 (1%)
Frame = +1

Query: 67 ASVRAYAEVLRLVRRLPPEARSYYSRFARENFATYNDEVDQSTISTLLARAYKHSCWVLS 246
A +RAY EVLRLVRRLP E + YY+++AR+NF Y D + LL RAY HS WVLS
Sbjct: 4 AGLRAYREVLRLVRRLPAETQPYYAKYARQNFVNYRDLAADDDLGALLRRAYTHSTWVLS 63

Query: 247 KYGVDKA-AADKLKQI 291
KY +D A +LK +
Sbjct: 64 KYSIDAGKVAVRLKDL 79


>tr|A9NJS7|A9NJS7_PICSI Putative uncharacterized protein OS=Picea
sitchensis PE=4 SV=1
Length = 64

Score = 71.2 bits (173), Expect = 4e-11
Identities = 30/60 (50%), Positives = 40/60 (66%)
Frame = +1

Query: 70 SVRAYAEVLRLVRRLPPEARSYYSRFARENFATYNDEVDQSTISTLLARAYKHSCWVLSK 249
S+RAY +LRL+R LP + RSYY ++ARENF Y + ++ LL R Y H+CWVL K
Sbjct: 4 SLRAYGGILRLIRLLPKQTRSYYQKYARENFVNYREVSGSDSMEELLQRTYNHACWVLKK 63


>tr|A5BB37|A5BB37_VITVI Putative uncharacterized protein OS=Vitis
vinifera GN=VITISV_006021 PE=4 SV=1
Length = 400

Score = 67.4 bits (163), Expect = 6e-10
Identities = 31/62 (50%), Positives = 42/62 (67%), Gaps = 2/62 (3%)
Frame = +1

Query: 70 SVRAYAEVLRLVRRLPPEARSYYSRFARENFATYN--DEVDQSTISTLLARAYKHSCWVL 243
+++AY VLRLVRRLP + R YY+++ARENF Y D D + ++ L R Y HS WVL
Sbjct: 26 ALKAYGAVLRLVRRLPKDTRPYYAKYARENFVNYREVDAADPNALNDLFNRTYTHSLWVL 85

Query: 244 SK 249
+K
Sbjct: 86 NK 87


>tr|Q86AY8|Q86AY8_DICDI Similar to Dictyostelium discoideum (Slime
mold). R2005 protein (Putative uncharacterized protein)
OS=Dictyostelium discoideum GN=DDB_0216964 PE=4 SV=2
Length = 637

Score = 42.4 bits (98), Expect = 0.020
Identities = 21/63 (33%), Positives = 36/63 (57%), Gaps = 1/63 (1%)
Frame = +1

Query: 64 PASVRAYAEVLRLV-RRLPPEARSYYSRFARENFATYNDEVDQSTISTLLARAYKHSCWV 240
PAS+ Y ++R + ++LP A++YY F RE+F + E DQ I L+ + Y ++
Sbjct: 9 PASLALYRTIVRSINQKLPKPAQNYYWTFTREHFEGHKYETDQEHIKFLVKKGYTSLKYI 68

Query: 241 LSK 249
+ K
Sbjct: 69 IKK 71


>tr|A5AUG1|A5AUG1_VITVI Putative uncharacterized protein OS=Vitis
vinifera GN=VITISV_039492 PE=4 SV=1
Length = 653

Score = 41.2 bits (95), Expect = 0.044
Identities = 18/39 (46%), Positives = 23/39 (58%)
Frame = -3

Query: 347 WHLHSQLHIQDSKIQFYLQICFNLSAAALSTPYLERTQQ 231
WH+H QLHI + QF F +S A LSTP +E+ Q
Sbjct: 473 WHMHDQLHIAKKESQFIFVNPFTISRAGLSTPQIEKRAQ 511


>tr|A5C0H3|A5C0H3_VITVI Putative uncharacterized protein OS=Vitis
vinifera GN=VITISV_003280 PE=4 SV=1
Length = 582

Score = 40.0 bits (92), Expect = 0.097
Identities = 18/39 (46%), Positives = 22/39 (56%)
Frame = -3

Query: 347 WHLHSQLHIQDSKIQFYLQICFNLSAAALSTPYLERTQQ 231
WH+H QLHI + QF F +S A LSTP E+ Q
Sbjct: 413 WHMHDQLHIAKKESQFIFVNPFTISXAGLSTPXTEKRAQ 451