DK944049
Clone id YMU02A01NGRL0004_N03
Library
Length 369
Definition Adiantum capillus-veneris mRNA. clone: YMU02A01NGRL0004_N03. 5' end sequence.
Accession
Tissue type young leaves
Developmental stage sporophyte
Contig ID -
Sequence
GAAGCAGTGGTATCAACGCAGAGTGGCCATTACGGCCGGGCAGAAAAATCAGTTCTGGAT
GCGCTTCAGAAAAGGGTGACATGCAGTCTCTTTCAAAGGGCAGAGCGCTCTTAGCTTTTG
CAAATGAGAGGAAGGGCTTTTGTGTGTACATAATGGATATAGGGGTGAGGCGGTCAGCTT
GGGACTCGTCAACTAGTGTTAGGGTAACTCCAGATGCGTGAATATATCCTGTAGACTAGG
GCGTTCTAACTTAATTGCTGTAGAGAGTACTGGAAATAGCTGTGTTTTGTCTGTCTTATT
TGGACATCCTTGTATCAAATCATTCGATGACATCGATGGTGGATTGAATTGATAACCCTA
ATCAAGATG
■■Homology search results ■■ -
sp_hit_id Q9Y2F5
Definition sp|Q9Y2F5|K0947_HUMAN Uncharacterized protein KIAA0947 OS=Homo sapiens
Align length 40
Score (bit) 30.4
E-value 2.9
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= DK944049|Adiantum capillus-veneris mRNA, clone:
YMU02A01NGRL0004_N03, 5'
(329 letters)

Database: uniprot_sprot.fasta
412,525 sequences; 148,809,765 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

sp|Q9Y2F5|K0947_HUMAN Uncharacterized protein KIAA0947 OS=Homo s... 30 2.9
sp|Q9NBW1|FRIZ4_DROME Frizzled-4 OS=Drosophila melanogaster GN=f... 30 2.9
sp|Q9BXS9|S26A6_HUMAN Solute carrier family 26 member 6 OS=Homo ... 30 3.8

>sp|Q9Y2F5|K0947_HUMAN Uncharacterized protein KIAA0947 OS=Homo
sapiens GN=KIAA0947 PE=1 SV=4
Length = 2266

Score = 30.4 bits (67), Expect = 2.9
Identities = 14/40 (35%), Positives = 21/40 (52%)
Frame = -1

Query: 152 LTSPKLTASPLYPLCTHKSPSSHLQKLRALCPLKETACHP 33
+ +P T+ PL PL + SPSS + + P +ET P
Sbjct: 1640 IATPPRTSQPLSPLISSSSPSSPASPVGQVSPFRETPVPP 1679


>sp|Q9NBW1|FRIZ4_DROME Frizzled-4 OS=Drosophila melanogaster GN=fz4
PE=2 SV=2
Length = 705

Score = 30.4 bits (67), Expect = 2.9
Identities = 12/31 (38%), Positives = 17/31 (54%)
Frame = -1

Query: 116 PLCTHKSPSSHLQKLRALCPLKETACHPFLK 24
P+CT K+P + R+LC CHP L+
Sbjct: 105 PMCTPKAPVHAIGPCRSLCESVRIRCHPVLQ 135


>sp|Q9BXS9|S26A6_HUMAN Solute carrier family 26 member 6 OS=Homo
sapiens GN=SLC26A6 PE=1 SV=1
Length = 759

Score = 30.0 bits (66), Expect = 3.8
Identities = 20/58 (34%), Positives = 30/58 (51%), Gaps = 4/58 (6%)
Frame = +1

Query: 97 LLCVHNGYR----GEAVSLGLVN*C*GNSRCVNISCRLGRSNLIAVESTGNSCVLSVL 258
+ + +GYR E V+LGL N G +C +SC + RS L+ + GNS V +
Sbjct: 365 IFALRHGYRVDSNQELVALGLSNLIGGIFQCFPVSCSMSRS-LVQESTGGNSQVAGAI 421


tr_hit_id A4IA29
Definition tr|A4IA29|A4IA29_LEIIN Putative uncharacterized protein (Fragment) OS=Leishmania infantum
Align length 90
Score (bit) 33.5
E-value 5.4
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= DK944049|Adiantum capillus-veneris mRNA, clone:
YMU02A01NGRL0004_N03, 5'
(329 letters)

Database: uniprot_trembl.fasta
7,341,751 sequences; 2,391,615,440 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

tr|A4IA29|A4IA29_LEIIN Putative uncharacterized protein (Fragmen... 33 5.4
tr|A7R365|A7R365_VITVI Chromosome undetermined scaffold_487, who... 33 9.1

>tr|A4IA29|A4IA29_LEIIN Putative uncharacterized protein (Fragment)
OS=Leishmania infantum GN=LinJ34.2140 PE=4 SV=1
Length = 1824

Score = 33.5 bits (75), Expect = 5.4
Identities = 24/90 (26%), Positives = 42/90 (46%)
Frame = -1

Query: 281 DLIQGCPNKTDKTQLFPVLSTAIKLERPSLQDIFTHLELP*H*LTSPKLTASPLYPLCTH 102
++I+G K Q F S++I + R S+ + +H+ P L+S ++ + TH
Sbjct: 121 EIIKGPSTVQVKCQQFTPASSSIAILRSSILRVISHVTTPSLVLSSEEVESIEKAVTHTH 180

Query: 101 KSPSSHLQKLRALCPLKETACHPFLKRIQN 12
+S L KLRA E + +I+N
Sbjct: 181 SQLNSELHKLRATVEATEIESNELRDQIRN 210


>tr|A7R365|A7R365_VITVI Chromosome undetermined scaffold_487, whole
genome shotgun sequence OS=Vitis vinifera
GN=GSVIVT00013480001 PE=3 SV=1
Length = 511

Score = 32.7 bits (73), Expect = 9.1
Identities = 12/29 (41%), Positives = 20/29 (68%)
Frame = -1

Query: 98 SPSSHLQKLRALCPLKETACHPFLKRIQN 12
SP+ HL+KL+ + P T+CH ++R +N
Sbjct: 157 SPAFHLEKLKGMMPAFSTSCHDLIERWKN 185