DK944126
Clone id YMU02A01NGRL0005_A22
Library
Length 134
Definition Adiantum capillus-veneris mRNA. clone: YMU02A01NGRL0005_A22. 5' end sequence.
Accession
Tissue type young leaves
Developmental stage sporophyte
Contig ID -
Sequence
TCTCACATGGGGTCATTCGAATTTCTTTGTTTGAGATCAATGTCTTGGATTTTTGGAGGA
CAAAGTGATGTTAACGCCTTTGCATCGGGTGTTTTCTTATATTTACGAGTGTGGGCTTGA
ATTTTAATTGTCAT
■■Homology search results ■■ -
sp_hit_id Q5SRE5
Definition sp|Q5SRE5|NU188_HUMAN Nucleoporin NUP188 homolog OS=Homo sapiens
Align length 31
Score (bit) 28.9
E-value 8.3
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= DK944126|Adiantum capillus-veneris mRNA, clone:
YMU02A01NGRL0005_A22, 5'
(134 letters)

Database: uniprot_sprot.fasta
412,525 sequences; 148,809,765 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

sp|Q5SRE5|NU188_HUMAN Nucleoporin NUP188 homolog OS=Homo sapiens... 29 8.3

>sp|Q5SRE5|NU188_HUMAN Nucleoporin NUP188 homolog OS=Homo sapiens
GN=NUP188 PE=1 SV=1
Length = 1749

Score = 28.9 bits (63), Expect = 8.3
Identities = 12/31 (38%), Positives = 19/31 (61%)
Frame = +1

Query: 1 SHMGSFEFLCLRSMSWIFGGQSDVNAFASGV 93
SH S +FLC+ S+++ GQ+ +N GV
Sbjct: 755 SHTPSLQFLCICSLAYTEAGQTVINIMGIGV 785


tr_hit_id B3SDD1
Definition tr|B3SDD1|B3SDD1_TRIAD Predicted protein OS=Trichoplax adhaerens
Align length 33
Score (bit) 33.9
E-value 4.1
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= DK944126|Adiantum capillus-veneris mRNA, clone:
YMU02A01NGRL0005_A22, 5'
(134 letters)

Database: uniprot_trembl.fasta
7,341,751 sequences; 2,391,615,440 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

tr|B3SDD1|B3SDD1_TRIAD Predicted protein OS=Trichoplax adhaerens... 34 4.1

>tr|B3SDD1|B3SDD1_TRIAD Predicted protein OS=Trichoplax adhaerens
GN=TRIADDRAFT_62289 PE=4 SV=1
Length = 183

Score = 33.9 bits (76), Expect = 4.1
Identities = 15/33 (45%), Positives = 22/33 (66%)
Frame = +2

Query: 5 TWGHSNFFV*DQCLGFLEDKVMLTPLHRVFSYI 103
+WGHS F V + LGF++D+ + L R+FS I
Sbjct: 81 SWGHSYFIVRGEILGFMKDEQLRKHLPRMFSLI 113