DK944141
Clone id YMU02A01NGRL0005_B16
Library
Length 412
Definition Adiantum capillus-veneris mRNA. clone: YMU02A01NGRL0005_B16. 5' end sequence.
Accession
Tissue type young leaves
Developmental stage sporophyte
Contig ID -
Sequence
TTTGGCAGCTGTGCTACAGGGAGGCAATGACGGTGCCTTAGACTCTTCAATCTTTAGGGA
AACAGTGTCTTTTTCTAGCTTGAGGGTTTCCCTGGGATCTGTATCAACATTCAGTGATGT
GTATAGGCTTGTGCAATTTCTGTGCCGATTCCGGGATGAAGATTACCTCTCTTTCGAGGC
ATTGGACTTCATAGAGGACCATTCACTCTGACTTGTCTCCTTACCTTAGATTAGATTAGG
AGGAGGACAGACATACCTGCTTGCAGTGATGCAGACATCCACGACATACAATTGTCTGTA
AAACAGAGTTTTGTAAAGGGCATATTCATATTGTAGTTTTGTACACTAATATGCATGGAA
AAACCCAACCCATAANANAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA
■■Homology search results ■■ -
sp_hit_id Q7T0Y4
Definition sp|Q7T0Y4|CB039_XENLA UPF0407 protein C2orf39 homolog OS=Xenopus laevis
Align length 35
Score (bit) 31.2
E-value 1.7
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= DK944141|Adiantum capillus-veneris mRNA, clone:
YMU02A01NGRL0005_B16, 5'
(378 letters)

Database: uniprot_sprot.fasta
412,525 sequences; 148,809,765 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

sp|Q7T0Y4|CB039_XENLA UPF0407 protein C2orf39 homolog OS=Xenopus... 31 1.7
sp|Q4ZTG0|DNAE2_PSEU2 Error-prone DNA polymerase OS=Pseudomonas ... 30 4.8
sp|Q9PSI9|MCL1A_DANRE Protein L-Myc-1a OS=Danio rerio GN=mycl1a ... 29 6.3
sp|Q63HK3|ZKSC2_HUMAN Zinc finger protein with KRAB and SCAN dom... 29 8.3
sp|Q9W754|SCNNB_RANCA Amiloride-sensitive sodium channel subunit... 29 8.3
sp|Q6NQJ7|FRS4_ARATH Protein FAR1-RELATED SEQUENCE 4 OS=Arabidop... 29 8.3

>sp|Q7T0Y4|CB039_XENLA UPF0407 protein C2orf39 homolog OS=Xenopus
laevis PE=2 SV=1
Length = 690

Score = 31.2 bits (69), Expect = 1.7
Identities = 15/35 (42%), Positives = 23/35 (65%)
Frame = +2

Query: 56 RETVSFSSLRVSLGSVSTFSDVYRLVQFLCRFRDE 160
R + S+ +LG V+ DVY+LV+FLCR++ E
Sbjct: 515 RSLIKLDSIFGALG-VTVEEDVYKLVEFLCRYKRE 548


>sp|Q4ZTG0|DNAE2_PSEU2 Error-prone DNA polymerase OS=Pseudomonas
syringae pv. syringae (strain B728a) GN=dnaE2 PE=3 SV=1
Length = 1031

Score = 29.6 bits (65), Expect = 4.8
Identities = 14/38 (36%), Positives = 21/38 (55%)
Frame = +1

Query: 169 LFRGIGLHRGPFTLTCLLTLD*IRRRTDIPACSDADIH 282
L+ G+GLHRGP L L + + +PA + D+H
Sbjct: 150 LWLGVGLHRGPDDEQRLADLLALAQSLGVPAVASGDVH 187


>sp|Q9PSI9|MCL1A_DANRE Protein L-Myc-1a OS=Danio rerio GN=mycl1a
PE=2 SV=2
Length = 372

Score = 29.3 bits (64), Expect = 6.3
Identities = 14/39 (35%), Positives = 22/39 (56%)
Frame = -1

Query: 123 YTSLNVDTDPRETLKLEKDTVSLKIEESKAPSLPPCSTA 7
Y + + DTDP + ++E + ++E S APS P S A
Sbjct: 244 YAAPSPDTDPEDDFEIEPVSKRPRLESSSAPSSPLSSPA 282


>sp|Q63HK3|ZKSC2_HUMAN Zinc finger protein with KRAB and SCAN domains
2 OS=Homo sapiens GN=ZKSCAN2 PE=1 SV=1
Length = 967

Score = 28.9 bits (63), Expect = 8.3
Identities = 21/86 (24%), Positives = 40/86 (46%), Gaps = 8/86 (9%)
Frame = +3

Query: 141 CADSGMKITSLSRHWTS*RTIHSDLSPYLRLD*EEDRHTCLQ*CRHPR-HT-------IV 296
C + G T+ S H+++ R +H+ +PY +D E+ + C + H R HT
Sbjct: 861 CGECGKSFTN-SSHFSAHRRVHTGENPYKCVDCEKSFNNCTRFREHRRIHTGEKPYGCAQ 919

Query: 297 CKTEFCKGHIHIVVLYTNMHGKTQPI 374
C F K ++ + +H + +P+
Sbjct: 920 CGKRFSKS--SVLTKHREVHVREKPL 943


>sp|Q9W754|SCNNB_RANCA Amiloride-sensitive sodium channel subunit
beta (Fragment) OS=Rana catesbeiana GN=SCNN1B PE=2 SV=1
Length = 273

Score = 28.9 bits (63), Expect = 8.3
Identities = 13/34 (38%), Positives = 15/34 (44%), Gaps = 1/34 (2%)
Frame = +3

Query: 93 WDLYQHSVMCIGLCNF-CADSGMKITSLSRHWTS 191
WD H CI +C C DS K+T W S
Sbjct: 162 WDTVSHREQCINMCQQPCNDSNYKMTISMADWPS 195


>sp|Q6NQJ7|FRS4_ARATH Protein FAR1-RELATED SEQUENCE 4 OS=Arabidopsis
thaliana GN=FRS4 PE=2 SV=1
Length = 732

Score = 28.9 bits (63), Expect = 8.3
Identities = 14/31 (45%), Positives = 20/31 (64%)
Frame = +2

Query: 116 DVYRLVQFLCRFRDEDYLSFEALDFIEDHSL 208
D L++FL R ++E+ F A+DF EDH L
Sbjct: 162 DAEILLEFLMRMQEENPKFFFAVDFSEDHLL 192


tr_hit_id A9S748
Definition tr|A9S748|A9S748_PHYPA Predicted protein OS=Physcomitrella patens subsp. patens
Align length 61
Score (bit) 67.8
E-value 3.0e-10
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= DK944141|Adiantum capillus-veneris mRNA, clone:
YMU02A01NGRL0005_B16, 5'
(378 letters)

Database: uniprot_trembl.fasta
7,341,751 sequences; 2,391,615,440 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

tr|A9S748|A9S748_PHYPA Predicted protein OS=Physcomitrella paten... 68 3e-10
tr|A9SCT3|A9SCT3_PHYPA Predicted protein OS=Physcomitrella paten... 66 1e-09
tr|A9REF1|A9REF1_PHYPA Predicted protein OS=Physcomitrella paten... 63 6e-09
tr|A9T5I1|A9T5I1_PHYPA Predicted protein OS=Physcomitrella paten... 56 1e-06
tr|A9SLL0|A9SLL0_PHYPA Predicted protein OS=Physcomitrella paten... 45 0.002
tr|A9TRK0|A9TRK0_PHYPA Predicted protein OS=Physcomitrella paten... 42 0.012
tr|Q2QMU3|Q2QMU3_ORYSJ Os12g0590900 protein OS=Oryza sativa subs... 38 0.28
tr|A9U2B6|A9U2B6_PHYPA Predicted protein OS=Physcomitrella paten... 38 0.28
tr|A3CJ02|A3CJ02_ORYSJ Putative uncharacterized protein OS=Oryza... 38 0.28
tr|A2ZM89|A2ZM89_ORYSI Putative uncharacterized protein OS=Oryza... 38 0.28
tr|Q4P9R4|Q4P9R4_USTMA Putative uncharacterized protein OS=Ustil... 37 0.49
tr|Q46D33|Q46D33_METBF Putative uncharacterized protein OS=Metha... 37 0.49
tr|Q7Y0C6|Q7Y0C6_ORYSJ Os03g0765800 protein OS=Oryza sativa subs... 36 1.1
tr|Q10EM3|Q10EM3_ORYSJ Expressed protein OS=Oryza sativa subsp. ... 36 1.1
tr|A3AN05|A3AN05_ORYSJ Putative uncharacterized protein OS=Oryza... 36 1.1
tr|A2XMB0|A2XMB0_ORYSI Putative uncharacterized protein OS=Oryza... 36 1.1
tr|A9RG94|A9RG94_PHYPA Predicted protein OS=Physcomitrella paten... 35 1.4
tr|B6KV85|B6KV85_TOXGO Molybdopterin cofactor sulfurase, putativ... 35 2.4
tr|A9REN7|A9REN7_PHYPA Predicted protein OS=Physcomitrella paten... 34 3.1
tr|A6RTA5|A6RTA5_BOTFB Putative uncharacterized protein OS=Botry... 34 4.1
tr|A6REX3|A6REX3_AJECN Putative uncharacterized protein OS=Ajell... 34 4.1
tr|Q8TPG3|Q8TPG3_METAC Putative uncharacterized protein OS=Metha... 33 5.4
tr|A9TR75|A9TR75_PHYPA Predicted protein OS=Physcomitrella paten... 33 7.0
tr|Q7SE17|Q7SE17_NEUCR Putative uncharacterized protein OS=Neuro... 33 7.0
tr|A7EZR6|A7EZR6_SCLS1 Putative uncharacterized protein OS=Scler... 33 9.2

>tr|A9S748|A9S748_PHYPA Predicted protein OS=Physcomitrella patens
subsp. patens GN=PHYPADRAFT_163205 PE=3 SV=1
Length = 748

Score = 67.8 bits (164), Expect = 3e-10
Identities = 33/61 (54%), Positives = 43/61 (70%)
Frame = +2

Query: 26 NDGALDSSIFRETVSFSSLRVSLGSVSTFSDVYRLVQFLCRFRDEDYLSFEALDFIEDHS 205
N+ D IF F ++R S G+VS FSDVYRL+QFL RFRDE+YL+ EA+ FIE+ +
Sbjct: 686 NERPKDVGIFEGNWGFMAVRASFGAVSNFSDVYRLLQFLSRFRDEEYLTTEAMGFIEESN 745

Query: 206 L 208
L
Sbjct: 746 L 746


>tr|A9SCT3|A9SCT3_PHYPA Predicted protein OS=Physcomitrella patens
subsp. patens GN=PHYPADRAFT_77631 PE=3 SV=1
Length = 695

Score = 65.9 bits (159), Expect = 1e-09
Identities = 31/55 (56%), Positives = 41/55 (74%)
Frame = +2

Query: 41 DSSIFRETVSFSSLRVSLGSVSTFSDVYRLVQFLCRFRDEDYLSFEALDFIEDHS 205
D I E F ++R SLG+VS F+DVYRLVQFL RFRDE+YL+ EA+ F+E+ +
Sbjct: 634 DIRIIDENWGFMAVRASLGAVSNFADVYRLVQFLSRFRDEEYLATEAMGFVEERN 688


>tr|A9REF1|A9REF1_PHYPA Predicted protein OS=Physcomitrella patens
subsp. patens GN=PHYPADRAFT_65039 PE=3 SV=1
Length = 940

Score = 63.2 bits (152), Expect = 6e-09
Identities = 31/69 (44%), Positives = 44/69 (63%)
Frame = +2

Query: 2 LAAVLQGGNDGALDSSIFRETVSFSSLRVSLGSVSTFSDVYRLVQFLCRFRDEDYLSFEA 181
+A +L D + S+F F ++VSLG +S F D YR+V FL RFR++DY+S EA
Sbjct: 692 VANLLGPAKDRVRNISVFERAPEFECVQVSLGPLSNFDDAYRVVYFLSRFRNQDYVSMEA 751

Query: 182 LDFIEDHSL 208
L F+E+ SL
Sbjct: 752 LGFMEESSL 760


>tr|A9T5I1|A9T5I1_PHYPA Predicted protein OS=Physcomitrella patens
subsp. patens GN=PHYPADRAFT_140541 PE=4 SV=1
Length = 382

Score = 55.8 bits (133), Expect = 1e-06
Identities = 25/51 (49%), Positives = 35/51 (68%)
Frame = +2

Query: 47 SIFRETVSFSSLRVSLGSVSTFSDVYRLVQFLCRFRDEDYLSFEALDFIED 199
S+F F ++VSLG +S F D YR+V FL FR++DY+S EAL F++D
Sbjct: 330 SVFERPPEFECVQVSLGPLSNFEDAYRVVHFLSLFRNQDYVSMEALGFMKD 380


>tr|A9SLL0|A9SLL0_PHYPA Predicted protein OS=Physcomitrella patens
subsp. patens GN=PHYPADRAFT_230060 PE=3 SV=1
Length = 753

Score = 45.1 bits (105), Expect = 0.002
Identities = 25/63 (39%), Positives = 37/63 (58%), Gaps = 2/63 (3%)
Frame = +2

Query: 2 LAAVLQGGNDGALDSSIFRETVS--FSSLRVSLGSVSTFSDVYRLVQFLCRFRDEDYLSF 175
+A +L D S+F E S F+ ++VSLG +S F D YR+V+FL RFRD +++
Sbjct: 573 VANLLGHPKDRKKSVSVFDERYSSGFTCVQVSLGPLSNFEDAYRIVEFLMRFRDPEFVPT 632

Query: 176 EAL 184
L
Sbjct: 633 HTL 635


>tr|A9TRK0|A9TRK0_PHYPA Predicted protein OS=Physcomitrella patens
subsp. patens GN=PHYPADRAFT_96215 PE=3 SV=1
Length = 808

Score = 42.4 bits (98), Expect = 0.012
Identities = 20/42 (47%), Positives = 30/42 (71%), Gaps = 2/42 (4%)
Frame = +2

Query: 50 IFRETVS--FSSLRVSLGSVSTFSDVYRLVQFLCRFRDEDYL 169
+F E S F+ ++VSLG +S F D YRLVQFL +FR+ +++
Sbjct: 623 VFSERYSSRFTCVQVSLGPISNFEDAYRLVQFLLQFRNPEFV 664


>tr|Q2QMU3|Q2QMU3_ORYSJ Os12g0590900 protein OS=Oryza sativa subsp.
japonica GN=Os12g0590900 PE=2 SV=1
Length = 908

Score = 37.7 bits (86), Expect = 0.28
Identities = 20/59 (33%), Positives = 30/59 (50%)
Frame = +2

Query: 29 DGALDSSIFRETVSFSSLRVSLGSVSTFSDVYRLVQFLCRFRDEDYLSFEALDFIEDHS 205
+G DS + T+ + SLG ++ F DVY + F+ +F D +L E L DHS
Sbjct: 848 NGRKDSK--KVTIRVEVVTASLGFLTNFEDVYNMWAFVAKFLDPSFLESERLTIAADHS 904


>tr|A9U2B6|A9U2B6_PHYPA Predicted protein OS=Physcomitrella patens
subsp. patens GN=PHYPADRAFT_154667 PE=4 SV=1
Length = 577

Score = 37.7 bits (86), Expect = 0.28
Identities = 21/45 (46%), Positives = 28/45 (62%)
Frame = +2

Query: 74 SSLRVSLGSVSTFSDVYRLVQFLCRFRDEDYLSFEALDFIEDHSL 208
S + +LG VSTF DVYRL F+ +F D D++ E L + HSL
Sbjct: 529 SVVTAALGFVSTFEDVYRLWAFVAKFLDADFVKREELLY---HSL 570


>tr|A3CJ02|A3CJ02_ORYSJ Putative uncharacterized protein OS=Oryza
sativa subsp. japonica GN=OsJ_035274 PE=4 SV=1
Length = 768

Score = 37.7 bits (86), Expect = 0.28
Identities = 20/59 (33%), Positives = 30/59 (50%)
Frame = +2

Query: 29 DGALDSSIFRETVSFSSLRVSLGSVSTFSDVYRLVQFLCRFRDEDYLSFEALDFIEDHS 205
+G DS + T+ + SLG ++ F DVY + F+ +F D +L E L DHS
Sbjct: 708 NGRKDSK--KVTIRVEVVTASLGFLTNFEDVYNMWAFVAKFLDPSFLESERLTIAADHS 764


>tr|A2ZM89|A2ZM89_ORYSI Putative uncharacterized protein OS=Oryza
sativa subsp. indica GN=OsI_38943 PE=4 SV=1
Length = 830

Score = 37.7 bits (86), Expect = 0.28
Identities = 20/59 (33%), Positives = 30/59 (50%)
Frame = +2

Query: 29 DGALDSSIFRETVSFSSLRVSLGSVSTFSDVYRLVQFLCRFRDEDYLSFEALDFIEDHS 205
+G DS + T+ + SLG ++ F DVY + F+ +F D +L E L DHS
Sbjct: 770 NGRKDSK--KVTIRVEVVTASLGFLTNFEDVYNMWAFVAKFLDPSFLESERLTIAADHS 826