DK944434
Clone id YMU02A01NGRL0006_A20
Library
Length 197
Definition Adiantum capillus-veneris mRNA. clone: YMU02A01NGRL0006_A20. 5' end sequence.
Accession
Tissue type young leaves
Developmental stage sporophyte
Contig ID -
Sequence
GGCAGGGATGCAATATATTCTGTGTTGCCCAAACGATATTGATCTTTTTCTTTGTGCATC
TAAAGCCCCTTTCATTCAGGGGTGTCAGAGTGTATTTTTGTATGTTCAGCCTTTCTCGCT
TTTAAGTTTTTCGAAAGATTTTGTACCAAGAAGATATTTGAACCTGAGCCAATAGTTGCA
CATAATGTGATTGGTGA
■■Homology search results ■■ -
sp_hit_id -
Definition No hits.
Align length -
Score (bit) -
E-value -
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= DK944434|Adiantum capillus-veneris mRNA, clone:
YMU02A01NGRL0006_A20, 5'
(197 letters)

Database: uniprot_sprot.fasta
412,525 sequences; 148,809,765 total letters

Searching..................................................done

***** No hits found ******


tr_hit_id Q8L8F7
Definition tr|Q8L8F7|Q8L8F7_MAIZE NADPH HC toxin reductase (Fragment) OS=Zea mays
Align length 34
Score (bit) 34.7
E-value 2.4
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= DK944434|Adiantum capillus-veneris mRNA, clone:
YMU02A01NGRL0006_A20, 5'
(197 letters)

Database: uniprot_trembl.fasta
7,341,751 sequences; 2,391,615,440 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

tr|Q8L8F7|Q8L8F7_MAIZE NADPH HC toxin reductase (Fragment) OS=Ze... 35 2.4
tr|Q8L8D7|Q8L8D7_MAIZE NADPH HC toxin reductase (Fragment) OS=Ze... 34 3.2
tr|Q8L8E8|Q8L8E8_ZEAMP NADPH HC toxin reductase (Fragment) OS=Ze... 33 5.4
tr|Q8L8E7|Q8L8E7_ZEAMP NADPH HC toxin reductase (Fragment) OS=Ze... 33 5.4
tr|O49165|O49165_MAIZE NADPH HC toxin reductase OS=Zea mays GN=h... 33 5.4
tr|O49164|O49164_MAIZE NADPH HC toxin reductase OS=Zea mays GN=h... 33 5.4
tr|A0Q1B8|A0Q1B8_CLONN Diguanylate cyclase/phosphodiesterase dom... 33 7.1
tr|Q8L8F8|Q8L8F8_MAIZE NADPH HC toxin reductase (Fragment) OS=Ze... 33 7.1
tr|Q8L8F1|Q8L8F1_ZEAMP NADPH HC toxin reductase (Fragment) OS=Ze... 33 7.1
tr|Q8L8E9|Q8L8E9_ZEAMP NADPH HC toxin reductase (Fragment) OS=Ze... 33 7.1
tr|Q8L8E6|Q8L8E6_ZEAMP NADPH HC toxin reductase (Fragment) OS=Ze... 33 7.1
tr|Q8L4E1|Q8L4E1_MAIZE NADPH HC toxin reductase (Fragment) OS=Ze... 33 7.1
tr|Q41867|Q41867_MAIZE NADPH HC-toxin reductase OS=Zea mays PE=4... 33 7.1
tr|O49163|O49163_MAIZE NADPH HC toxin reductase OS=Zea mays GN=h... 33 7.1
tr|B1BA96|B1BA96_CLOBO Diguanylate cyclase/phosphodiesterase dom... 33 9.3
tr|Q8L8F6|Q8L8F6_MAIZE NADPH HC toxin reductase (Fragment) OS=Ze... 33 9.3
tr|Q8L8F5|Q8L8F5_MAIZE NADPH HC toxin reductase (Fragment) OS=Ze... 33 9.3
tr|Q8L8F4|Q8L8F4_MAIZE NADPH HC toxin reductase (Fragment) OS=Ze... 33 9.3
tr|Q8L8F3|Q8L8F3_MAIZE NADPH HC toxin reductase (Fragment) OS=Ze... 33 9.3
tr|Q8L8F2|Q8L8F2_MAIZE NADPH HC toxin reductase (Fragment) OS=Ze... 33 9.3
tr|Q8L8F0|Q8L8F0_ZEAMP NADPH HC toxin reductase (Fragment) OS=Ze... 33 9.3
tr|Q8L8E5|Q8L8E5_ZEAMP NADPH HC toxin reductase (Fragment) OS=Ze... 33 9.3
tr|Q8L8E4|Q8L8E4_ZEAMP NADPH HC toxin reductase (Fragment) OS=Ze... 33 9.3
tr|Q8L8E2|Q8L8E2_ZEAMP NADPH HC toxin reductase (Fragment) OS=Ze... 33 9.3
tr|O49166|O49166_MAIZE NADPH HC toxin reductase OS=Zea mays GN=h... 33 9.3

>tr|Q8L8F7|Q8L8F7_MAIZE NADPH HC toxin reductase (Fragment) OS=Zea
mays GN=hm1 PE=4 SV=1
Length = 238

Score = 34.7 bits (78), Expect = 2.4
Identities = 17/34 (50%), Positives = 19/34 (55%)
Frame = +2

Query: 41 DLFLCASKAPFIQGCQSVFLYVQPFSLLSFSKDF 142
DLF A+ AP I GCQ VFL PF L S +
Sbjct: 25 DLFYAATFAPAIDGCQFVFLVATPFGLDSAGSQY 58


>tr|Q8L8D7|Q8L8D7_MAIZE NADPH HC toxin reductase (Fragment) OS=Zea
mays GN=hm2 PE=4 SV=1
Length = 247

Score = 34.3 bits (77), Expect = 3.2
Identities = 16/29 (55%), Positives = 19/29 (65%)
Frame = +2

Query: 35 DIDLFLCASKAPFIQGCQSVFLYVQPFSL 121
+ DLF A+ AP I GCQSVFL P+ L
Sbjct: 33 EADLFDAATFAPAIAGCQSVFLVATPYGL 61


>tr|Q8L8E8|Q8L8E8_ZEAMP NADPH HC toxin reductase (Fragment) OS=Zea
mays subsp. parviglumis GN=hm1 PE=4 SV=1
Length = 238

Score = 33.5 bits (75), Expect = 5.4
Identities = 17/36 (47%), Positives = 20/36 (55%)
Frame = +2

Query: 35 DIDLFLCASKAPFIQGCQSVFLYVQPFSLLSFSKDF 142
+ DLF A+ AP I GCQ VFL PF L S +
Sbjct: 23 EADLFDAATFAPAIAGCQFVFLVATPFGLDSAGSQY 58


>tr|Q8L8E7|Q8L8E7_ZEAMP NADPH HC toxin reductase (Fragment) OS=Zea
mays subsp. parviglumis GN=hm1 PE=4 SV=1
Length = 238

Score = 33.5 bits (75), Expect = 5.4
Identities = 17/36 (47%), Positives = 20/36 (55%)
Frame = +2

Query: 35 DIDLFLCASKAPFIQGCQSVFLYVQPFSLLSFSKDF 142
+ DLF A+ AP I GCQ VFL PF L S +
Sbjct: 23 EADLFDAATFAPAIAGCQFVFLVATPFGLDSAGSQY 58


>tr|O49165|O49165_MAIZE NADPH HC toxin reductase OS=Zea mays GN=hm1
PE=4 SV=1
Length = 356

Score = 33.5 bits (75), Expect = 5.4
Identities = 17/34 (50%), Positives = 19/34 (55%)
Frame = +2

Query: 41 DLFLCASKAPFIQGCQSVFLYVQPFSLLSFSKDF 142
DLF A+ AP I GCQ VFL PF L S +
Sbjct: 68 DLFDAATFAPAIDGCQFVFLVATPFGLDSAGSQY 101


>tr|O49164|O49164_MAIZE NADPH HC toxin reductase OS=Zea mays GN=hm1
PE=4 SV=1
Length = 356

Score = 33.5 bits (75), Expect = 5.4
Identities = 17/34 (50%), Positives = 19/34 (55%)
Frame = +2

Query: 41 DLFLCASKAPFIQGCQSVFLYVQPFSLLSFSKDF 142
DLF A+ AP I GCQ VFL PF L S +
Sbjct: 68 DLFDAATFAPAIDGCQFVFLVATPFGLDSAGSQY 101


>tr|A0Q1B8|A0Q1B8_CLONN Diguanylate cyclase/phosphodiesterase domain
2 OS=Clostridium novyi (strain NT) GN=NT01CX_2347 PE=4
SV=1
Length = 961

Score = 33.1 bits (74), Expect = 7.1
Identities = 14/34 (41%), Positives = 19/34 (55%)
Frame = +2

Query: 17 ILCCPNDIDLFLCASKAPFIQGCQSVFLYVQPFS 118
I+CC ND F+ +SK F+ C VF + FS
Sbjct: 109 IICCDNDALNFILSSKIKFLNSCPLVFCGINEFS 142


>tr|Q8L8F8|Q8L8F8_MAIZE NADPH HC toxin reductase (Fragment) OS=Zea
mays GN=hm1 PE=4 SV=1
Length = 238

Score = 33.1 bits (74), Expect = 7.1
Identities = 17/34 (50%), Positives = 19/34 (55%)
Frame = +2

Query: 41 DLFLCASKAPFIQGCQSVFLYVQPFSLLSFSKDF 142
DLF A+ AP I GCQ VFL PF L S +
Sbjct: 25 DLFDAATFAPAIAGCQFVFLVATPFGLDSAGSQY 58


>tr|Q8L8F1|Q8L8F1_ZEAMP NADPH HC toxin reductase (Fragment) OS=Zea
mays subsp. parviglumis GN=hm1 PE=4 SV=1
Length = 238

Score = 33.1 bits (74), Expect = 7.1
Identities = 17/34 (50%), Positives = 19/34 (55%)
Frame = +2

Query: 41 DLFLCASKAPFIQGCQSVFLYVQPFSLLSFSKDF 142
DLF A+ AP I GCQ VFL PF L S +
Sbjct: 25 DLFDAATFAPAIAGCQFVFLVATPFGLDSAGSQY 58


>tr|Q8L8E9|Q8L8E9_ZEAMP NADPH HC toxin reductase (Fragment) OS=Zea
mays subsp. parviglumis GN=hm1 PE=4 SV=1
Length = 200

Score = 33.1 bits (74), Expect = 7.1
Identities = 17/34 (50%), Positives = 19/34 (55%)
Frame = +2

Query: 41 DLFLCASKAPFIQGCQSVFLYVQPFSLLSFSKDF 142
DLF A+ AP I GCQ VFL PF L S +
Sbjct: 25 DLFDAATFAPAIAGCQFVFLVATPFGLDSAGSQY 58