DK944560
Clone id YMU02A01NGRL0006_H10
Library
Length 262
Definition Adiantum capillus-veneris mRNA. clone: YMU02A01NGRL0006_H10. 5' end sequence.
Accession
Tissue type young leaves
Developmental stage sporophyte
Contig ID -
Sequence
GGTTTCTTCTCTTTGTGGGTTTGGAAAAGAATGACTCTGTTTTTGAGCAATTTGCGGAAG
CCATTAGGGATGTAGGTCTTGTCTCTCGAGCCTCTGCAATCTCCCTTGGTAAGGGAATCT
ACAGTTTTTTTTAAAACCGTCTCATTTATTTCTCCTGTCATGTTTGCCAATGTAGAAAAT
GATCCCCTTTCCTCCCAAAATGAAAGAGAACAAAGCAAAAAGGTTCCTCCCCAAAAAAAA
AAAAAAAAAAAAAAAAAAAAAA
■■Homology search results ■■ -
sp_hit_id Q9RGR9
Definition sp|Q9RGR9|GALT_STACA Galactose-1-phosphate uridylyltransferase OS=Staphylococcus carnosus
Align length 37
Score (bit) 29.6
E-value 4.9
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= DK944560|Adiantum capillus-veneris mRNA, clone:
YMU02A01NGRL0006_H10, 5'
(232 letters)

Database: uniprot_sprot.fasta
412,525 sequences; 148,809,765 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

sp|Q9RGR9|GALT_STACA Galactose-1-phosphate uridylyltransferase O... 30 4.9
sp|Q6DDU8|FIGL1_XENLA Fidgetin-like protein 1 OS=Xenopus laevis ... 30 4.9
sp|A4IHT0|FIGL1_XENTR Fidgetin-like protein 1 OS=Xenopus tropica... 29 8.4

>sp|Q9RGR9|GALT_STACA Galactose-1-phosphate uridylyltransferase
OS=Staphylococcus carnosus GN=galT PE=3 SV=1
Length = 498

Score = 29.6 bits (65), Expect = 4.9
Identities = 16/37 (43%), Positives = 23/37 (62%), Gaps = 2/37 (5%)
Frame = -1

Query: 106 REIAEARETRPTSLMASANCSKTESFFSKPTK--RRN 2
+EIA+ARE + +S A+A C + E F T+ RRN
Sbjct: 161 KEIAKAREAKQSSYPANALCMENEGFVGSVTQAARRN 197


>sp|Q6DDU8|FIGL1_XENLA Fidgetin-like protein 1 OS=Xenopus laevis
GN=fignl1 PE=2 SV=1
Length = 655

Score = 29.6 bits (65), Expect = 4.9
Identities = 18/36 (50%), Positives = 22/36 (61%)
Frame = -1

Query: 142 RRF*KKL*IPLPREIAEARETRPTSLMASANCSKTE 35
RR K+L IPLP A AR+ SLM+ +CS TE
Sbjct: 538 RRLVKRLYIPLPE--ASARKQIVVSLMSKEHCSLTE 571


>sp|A4IHT0|FIGL1_XENTR Fidgetin-like protein 1 OS=Xenopus tropicalis
GN=fignl1 PE=2 SV=1
Length = 656

Score = 28.9 bits (63), Expect = 8.4
Identities = 18/36 (50%), Positives = 21/36 (58%)
Frame = -1

Query: 142 RRF*KKL*IPLPREIAEARETRPTSLMASANCSKTE 35
RR K+L IPLP A AR+ SLMA +CS E
Sbjct: 539 RRLVKRLYIPLPE--ASARKQIVVSLMAKEHCSLAE 572


tr_hit_id Q4HSS7
Definition tr|Q4HSS7|Q4HSS7_CAMUP DNA processing chain A (DprA) OS=Campylobacter upsaliensis RM3195
Align length 48
Score (bit) 32.7
E-value 9.3
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= DK944560|Adiantum capillus-veneris mRNA, clone:
YMU02A01NGRL0006_H10, 5'
(232 letters)

Database: uniprot_trembl.fasta
7,341,751 sequences; 2,391,615,440 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

tr|Q4HSS7|Q4HSS7_CAMUP DNA processing chain A (DprA) OS=Campylob... 33 9.3

>tr|Q4HSS7|Q4HSS7_CAMUP DNA processing chain A (DprA)
OS=Campylobacter upsaliensis RM3195 GN=dprA PE=4 SV=1
Length = 258

Score = 32.7 bits (73), Expect = 9.3
Identities = 17/48 (35%), Positives = 28/48 (58%)
Frame = -3

Query: 170 LANMTGEINETVLKKTVDSLTKGDCRGSRDKTYIPNGFRKLLKNRVIL 27
L+++ NE ++K+ TKG + TY+P GF LL+NR+I+
Sbjct: 96 LSHIYPRTNEKIIKEIY---TKGLALSENEDTYMPQGFDFLLRNRLII 140