DK944594
Clone id YMU02A01NGRL0006_J05
Library
Length 441
Definition Adiantum capillus-veneris mRNA. clone: YMU02A01NGRL0006_J05. 5' end sequence.
Accession
Tissue type young leaves
Developmental stage sporophyte
Contig ID -
Sequence
AGGAAGGAAAAAAGCTCAAAGATTCTCCTGCTCCTGTGGGATATCATTGATTTGCTAGTG
GGCTTTAATTGTGCATCTTTTTACAATCTGTATATGTTGGATCTCATACAAGTTCCTAAA
CCTCTTCTTCAAAAGAAAGTGTAATGAGCACACGTAGGCGTAGGGCTAATAAGGTGATTG
TATATTCTTTTGACATGAATGAACAAGCGTATTGGTCGGATCTATAAATGAATAAAAAAA
AGCAAAATATCCCCTCCAGGTTTCCATTATGTGATAACGATAAAAAAAAAAAAGACTGAA
TAAAATCCCTTGTCGCCCGCCCCGCCCCCCAAAAAATTTTCTAAACCATTCTTTTGGCCC
GCGGGCCCTGAAGGAAAGTGAACATGGCCTTATCTTTTTCCAAGAAAATCCGGGCCATGA
CTAGGGTTTGGATTCCCCCCA
■■Homology search results ■■ -
sp_hit_id Q40578
Definition sp|Q40578|AOX2_TOBAC Alternative oxidase 2, mitochondrial OS=Nicotiana tabacum
Align length 15
Score (bit) 32.0
E-value 1.2
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= DK944594|Adiantum capillus-veneris mRNA, clone:
YMU02A01NGRL0006_J05, 5'
(441 letters)

Database: uniprot_sprot.fasta
412,525 sequences; 148,809,765 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

sp|Q40578|AOX2_TOBAC Alternative oxidase 2, mitochondrial OS=Nic... 32 1.2
sp|Q41224|AOX1_TOBAC Alternative oxidase 1, mitochondrial OS=Nic... 32 1.2
sp|Q40294|AOX1_MANIN Alternative oxidase, mitochondrial OS=Mangi... 32 1.5
sp|O03376|AOX3_SOYBN Alternative oxidase 3, mitochondrial OS=Gly... 31 2.6
sp|Q41266|AOX2_SOYBN Alternative oxidase 2, mitochondrial OS=Gly... 30 5.7
sp|O23913|AOX1B_ARATH Alternative oxidase 1b, mitochondrial OS=A... 30 5.7
sp|Q39219|AOX1A_ARATH Alternative oxidase 1a, mitochondrial OS=A... 30 5.7
sp|O13666|ERG32_SCHPO Probable C-5 sterol desaturase 2 OS=Schizo... 29 9.8

>sp|Q40578|AOX2_TOBAC Alternative oxidase 2, mitochondrial
OS=Nicotiana tabacum GN=AOX2 PE=1 SV=2
Length = 297

Score = 32.0 bits (71), Expect = 1.2
Identities = 11/15 (73%), Positives = 15/15 (100%)
Frame = +3

Query: 3 EGKKLKDSPAPVGYH 47
+G++LKDSPAP+GYH
Sbjct: 283 QGQQLKDSPAPIGYH 297


>sp|Q41224|AOX1_TOBAC Alternative oxidase 1, mitochondrial
OS=Nicotiana tabacum GN=AOX1 PE=1 SV=1
Length = 353

Score = 32.0 bits (71), Expect = 1.2
Identities = 11/15 (73%), Positives = 15/15 (100%)
Frame = +3

Query: 3 EGKKLKDSPAPVGYH 47
+G++LKDSPAP+GYH
Sbjct: 339 QGQQLKDSPAPIGYH 353


>sp|Q40294|AOX1_MANIN Alternative oxidase, mitochondrial
OS=Mangifera indica GN=AOMI 1 PE=1 SV=2
Length = 318

Score = 31.6 bits (70), Expect = 1.5
Identities = 11/15 (73%), Positives = 15/15 (100%)
Frame = +3

Query: 3 EGKKLKDSPAPVGYH 47
+GK+L+D+PAPVGYH
Sbjct: 304 QGKELRDAPAPVGYH 318


>sp|O03376|AOX3_SOYBN Alternative oxidase 3, mitochondrial
OS=Glycine max GN=AOX3 PE=1 SV=1
Length = 326

Score = 30.8 bits (68), Expect = 2.6
Identities = 10/15 (66%), Positives = 15/15 (100%)
Frame = +3

Query: 3 EGKKLKDSPAPVGYH 47
+GK+LK++PAP+GYH
Sbjct: 312 QGKELKEAPAPIGYH 326


>sp|Q41266|AOX2_SOYBN Alternative oxidase 2, mitochondrial
OS=Glycine max GN=AOX2 PE=1 SV=2
Length = 333

Score = 29.6 bits (65), Expect = 5.7
Identities = 9/15 (60%), Positives = 15/15 (100%)
Frame = +3

Query: 3 EGKKLKDSPAPVGYH 47
+GK+L+++PAP+GYH
Sbjct: 319 QGKELREAPAPIGYH 333


>sp|O23913|AOX1B_ARATH Alternative oxidase 1b, mitochondrial
OS=Arabidopsis thaliana GN=AOX1B PE=1 SV=1
Length = 325

Score = 29.6 bits (65), Expect = 5.7
Identities = 9/15 (60%), Positives = 15/15 (100%)
Frame = +3

Query: 3 EGKKLKDSPAPVGYH 47
+G++LK++PAP+GYH
Sbjct: 311 QGRELKEAPAPIGYH 325


>sp|Q39219|AOX1A_ARATH Alternative oxidase 1a, mitochondrial
OS=Arabidopsis thaliana GN=AOX1A PE=1 SV=2
Length = 354

Score = 29.6 bits (65), Expect = 5.7
Identities = 9/15 (60%), Positives = 15/15 (100%)
Frame = +3

Query: 3 EGKKLKDSPAPVGYH 47
+G++LK++PAP+GYH
Sbjct: 340 QGRELKEAPAPIGYH 354


>sp|O13666|ERG32_SCHPO Probable C-5 sterol desaturase 2
OS=Schizosaccharomyces pombe GN=SPBC27B12.03c PE=2 SV=1
Length = 329

Score = 28.9 bits (63), Expect = 9.8
Identities = 14/53 (26%), Positives = 27/53 (50%)
Frame = -2

Query: 302 YSVFFFFIVIT*WKPGGDILLFFIHL*IRPIRLFIHVKRIYNHLISPTPTCAH 144
Y F+ F I + D L+++IH + L+ + ++++ I PTP +H
Sbjct: 146 YGYFYLFFSIALFLLFSDFLIYWIHRALHHRWLYAPLHKLHHKWIVPTPYSSH 198


tr_hit_id Q9BIH8
Definition tr|Q9BIH8|Q9BIH8_ANOGA GSG2-like protein OS=Anopheles gambiae
Align length 47
Score (bit) 35.0
E-value 1.9
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= DK944594|Adiantum capillus-veneris mRNA, clone:
YMU02A01NGRL0006_J05, 5'
(441 letters)

Database: uniprot_trembl.fasta
7,341,751 sequences; 2,391,615,440 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

tr|Q9BIH8|Q9BIH8_ANOGA GSG2-like protein OS=Anopheles gambiae GN... 35 1.9

>tr|Q9BIH8|Q9BIH8_ANOGA GSG2-like protein OS=Anopheles gambiae
GN=gSG2-like PE=2 SV=1
Length = 168

Score = 35.0 bits (79), Expect = 1.9
Identities = 19/47 (40%), Positives = 23/47 (48%)
Frame = -2

Query: 437 GNPNPSHGPDFLGKR*GHVHFPSGPAGQKNGLENFLGGGAGDKGFYS 297
G+ G F G+ G PS +GQ+NG FLG G G GF S
Sbjct: 108 GDAQQGRGVPFFGQGGGQGGIPSFGSGQQNGGVPFLGNGQGQSGFPS 154