DK945310
Clone id YMU02A01NGRL0008_O12
Library
Length 581
Definition Adiantum capillus-veneris mRNA. clone: YMU02A01NGRL0008_O12. 5' end sequence.
Accession
Tissue type young leaves
Developmental stage sporophyte
Contig ID -
Sequence
ATGGTGACACAGAAATTATGGGGCTAAAAAAAACGTGCAACCATATAATTTTGGAGCAGT
AATATAATGCGAAGCTTCCTCTACTATAAAGCGCCATAGCTTCCTGCCGAAGCTTCAACA
AAACAGCAGCAACACAGTTCTTATAATCCACAATGGCGGCTGGTGGAAGAGGTAAGCCCA
AAAACAGCAAGTCTGTTTCTCGCTCCCAAAAGGCGGGCTTGCAGTTTCCGGTTGGAAGGA
TTGCCAGGTTTCTGAAGAAGGGAAAATACGCTGAGCGCGTAGGAGCTGGTGCTCCTGTCT
ACTTGGCTGCTGTCATGGAGTACCTTGCAGCGGAGGTTCTGGAGCTTGCAGGAAATGCTG
CCCGTGACAACAAGAAAAACAGGATCATTCCGAGGCACATTCAGCTTGCAGTCCGAAACG
ACGAGGAGCTCAGTAAACTTTTGGGCAATGTGGTAATTGCAAATGGAGGTGTTCTGCCTA
ATATTCATGCCACACTGCTACCAAAGAAGTCTGCCAAGGGAAAGGGTGAAGCCGGAGGAG
CATCACAGGAGTACTAGCGAAAGTCAGACAGGGAAGGAAAG
■■Homology search results ■■ -
sp_hit_id P35063
Definition sp|P35063|H2AX_PICAB Histone H2AX OS=Picea abies
Align length 119
Score (bit) 207.0
E-value 4.0e-53
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= DK945310|Adiantum capillus-veneris mRNA, clone:
YMU02A01NGRL0008_O12, 5'
(581 letters)

Database: uniprot_sprot.fasta
412,525 sequences; 148,809,765 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

sp|P35063|H2AX_PICAB Histone H2AX OS=Picea abies PE=2 SV=1 207 4e-53
sp|O65759|H2AX_CICAR Histone H2AX OS=Cicer arietinum GN=HIS2A PE... 206 7e-53
sp|O04848|H2AXA_ARATH Probable histone H2AXa OS=Arabidopsis thal... 205 2e-52
sp|Q9S9K7|H2AXB_ARATH Probable histone H2AXb OS=Arabidopsis thal... 204 2e-52
sp|Q2QPG9|H2AXB_ORYSJ Probable histone H2AXb OS=Oryza sativa sub... 199 6e-51
sp|A2ZL69|H2AXB_ORYSI Probable histone H2AXb OS=Oryza sativa sub... 199 6e-51
sp|P16866|H2A4_VOLCA Histone H2A-IV OS=Volvox carteri PE=3 SV=1 196 5e-50
sp|P50567|H2A_CHLRE Histone H2A OS=Chlamydomonas reinhardtii GN=... 196 7e-50
sp|P16865|H2A3_VOLCA Histone H2A-III OS=Volvox carteri PE=3 SV=1 196 7e-50
sp|Q8LLP5|H2AXA_ORYSJ Probable histone H2AXa OS=Oryza sativa sub... 194 2e-49
sp|A2XLI0|H2AXA_ORYSI Probable histone H2AXa OS=Oryza sativa sub... 194 2e-49
sp|O81826|H2A3_ARATH Probable histone H2A.3 OS=Arabidopsis thali... 189 1e-47
sp|Q9C681|H2A1_ARATH Probable histone H2A.1 OS=Arabidopsis thali... 189 1e-47
sp|Q9LHQ5|H2A2_ARATH Probable histone H2A.2 OS=Arabidopsis thali... 188 2e-47
sp|Q9LD28|H2A6_ARATH Histone H2A.6 OS=Arabidopsis thaliana GN=RA... 187 2e-47
sp|Q84NJ4|H2A3_ORYSJ Probable histone H2A.3 OS=Oryza sativa subs... 185 2e-46
sp|A2YVE5|H2A3_ORYSI Probable histone H2A.3 OS=Oryza sativa subs... 185 2e-46
sp|Q43312|H2A7_WHEAT Protein H2A.7 OS=Triticum aestivum GN=H2A-4... 184 3e-46
sp|Q6ZL42|H2A2_ORYSJ Probable histone H2A.2 OS=Oryza sativa subs... 184 3e-46
sp|A2YMC6|H2A2_ORYSI Probable histone H2A.2 OS=Oryza sativa subs... 184 3e-46
sp|P04735|H2A1_PSAMI Late histone H2A.1 OS=Psammechinus miliaris... 182 1e-45
sp|Q2QS71|H2A7_ORYSJ Probable histone H2A.7 OS=Oryza sativa subs... 181 2e-45
sp|A2ZK29|H2A7_ORYSI Probable histone H2A.7 OS=Oryza sativa subs... 181 2e-45
sp|Q43208|H2A4_WHEAT Histone H2A.4 OS=Triticum aestivum GN=TH254... 181 2e-45
sp|Q6ZL43|H2A1_ORYSJ Probable histone H2A.1 OS=Oryza sativa subs... 181 2e-45
sp|A2YMC5|H2A1_ORYSI Probable histone H2A.1 OS=Oryza sativa subs... 181 2e-45
sp|Q5KMT5|H2A_CRYNE Histone H2A OS=Cryptococcus neoformans GN=HT... 179 7e-45
sp|P35061|H2A_ACRFO Histone H2A OS=Acropora formosa PE=3 SV=2 179 7e-45
sp|A2ZK26|H2A8_ORYSI Probable histone H2A.8 OS=Oryza sativa subs... 179 7e-45
sp|P07793|H2A4_PSAMI Late histone H2A.2.2 OS=Psammechinus miliar... 179 7e-45

>sp|P35063|H2AX_PICAB Histone H2AX OS=Picea abies PE=2 SV=1
Length = 138

Score = 207 bits (526), Expect = 4e-53
Identities = 106/119 (89%), Positives = 111/119 (93%)
Frame = +3

Query: 147 STMAAGGRGKPKNSKSVSRSQKAGLQFPVGRIARFLKKGKYAERVGAGAPVYLAAVMEYL 326
S+ A GGRGK K++KSVSRSQKAGLQFPVGRIARFLK GKYAERVGAGAPVYLAAV+EYL
Sbjct: 3 SSGAKGGRGKAKSTKSVSRSQKAGLQFPVGRIARFLKAGKYAERVGAGAPVYLAAVLEYL 62

Query: 327 AAEVLELAGNAARDNKKNRIIPRHIQLAVRNDEELSKLLGNVVIANGGVLPNIHATLLP 503
AAEVLELAGNAARDNKKNRI+PRHIQLAVRNDEELSKLLG V IANGGVLPNIH LLP
Sbjct: 63 AAEVLELAGNAARDNKKNRIVPRHIQLAVRNDEELSKLLGAVTIANGGVLPNIHQVLLP 121


>sp|O65759|H2AX_CICAR Histone H2AX OS=Cicer arietinum GN=HIS2A PE=2
SV=1
Length = 139

Score = 206 bits (524), Expect = 7e-53
Identities = 104/114 (91%), Positives = 108/114 (94%)
Frame = +3

Query: 162 GGRGKPKNSKSVSRSQKAGLQFPVGRIARFLKKGKYAERVGAGAPVYLAAVMEYLAAEVL 341
GGRGKPK SKSVSRS KAGLQFPVGRIARFLK GKYAERVGAGAPVYL+AV+EYLAAEVL
Sbjct: 9 GGRGKPKASKSVSRSSKAGLQFPVGRIARFLKAGKYAERVGAGAPVYLSAVLEYLAAEVL 68

Query: 342 ELAGNAARDNKKNRIIPRHIQLAVRNDEELSKLLGNVVIANGGVLPNIHATLLP 503
ELAGNAARDNK NRI+PRHIQLAVRNDEELSKLLG+V IANGGVLPNIH TLLP
Sbjct: 69 ELAGNAARDNKNNRIVPRHIQLAVRNDEELSKLLGSVTIANGGVLPNIHQTLLP 122


>sp|O04848|H2AXA_ARATH Probable histone H2AXa OS=Arabidopsis
thaliana GN=At1g08880 PE=1 SV=1
Length = 142

Score = 205 bits (521), Expect = 2e-52
Identities = 103/114 (90%), Positives = 108/114 (94%)
Frame = +3

Query: 162 GGRGKPKNSKSVSRSQKAGLQFPVGRIARFLKKGKYAERVGAGAPVYLAAVMEYLAAEVL 341
GGRGKPK +KSVSRS KAGLQFPVGRIARFLK GKYAERVGAGAPVYL+AV+EYLAAEVL
Sbjct: 12 GGRGKPKATKSVSRSSKAGLQFPVGRIARFLKSGKYAERVGAGAPVYLSAVLEYLAAEVL 71

Query: 342 ELAGNAARDNKKNRIIPRHIQLAVRNDEELSKLLGNVVIANGGVLPNIHATLLP 503
ELAGNAARDNKK RI+PRHIQLAVRNDEELSKLLG+V IANGGVLPNIH TLLP
Sbjct: 72 ELAGNAARDNKKTRIVPRHIQLAVRNDEELSKLLGSVTIANGGVLPNIHQTLLP 125


>sp|Q9S9K7|H2AXB_ARATH Probable histone H2AXb OS=Arabidopsis
thaliana GN=At1g54690 PE=1 SV=1
Length = 142

Score = 204 bits (520), Expect = 2e-52
Identities = 103/114 (90%), Positives = 108/114 (94%)
Frame = +3

Query: 162 GGRGKPKNSKSVSRSQKAGLQFPVGRIARFLKKGKYAERVGAGAPVYLAAVMEYLAAEVL 341
GGRGKPK +KSVSRS KAGLQFPVGRIARFLK GKYAERVGAGAPVYL+AV+EYLAAEVL
Sbjct: 12 GGRGKPKATKSVSRSSKAGLQFPVGRIARFLKAGKYAERVGAGAPVYLSAVLEYLAAEVL 71

Query: 342 ELAGNAARDNKKNRIIPRHIQLAVRNDEELSKLLGNVVIANGGVLPNIHATLLP 503
ELAGNAARDNKK RI+PRHIQLAVRNDEELSKLLG+V IANGGVLPNIH TLLP
Sbjct: 72 ELAGNAARDNKKTRIVPRHIQLAVRNDEELSKLLGSVTIANGGVLPNIHQTLLP 125


>sp|Q2QPG9|H2AXB_ORYSJ Probable histone H2AXb OS=Oryza sativa subsp.
japonica GN=Os12g0530000 PE=2 SV=1
Length = 138

Score = 199 bits (507), Expect = 6e-51
Identities = 102/119 (85%), Positives = 107/119 (89%)
Frame = +3

Query: 147 STMAAGGRGKPKNSKSVSRSQKAGLQFPVGRIARFLKKGKYAERVGAGAPVYLAAVMEYL 326
S GGRGK K SKSVSRS KAGLQFPVGRIAR+LK GKYAERVGAGAPVYL+AV+EYL
Sbjct: 3 SAGGGGGRGKSKGSKSVSRSSKAGLQFPVGRIARYLKAGKYAERVGAGAPVYLSAVLEYL 62

Query: 327 AAEVLELAGNAARDNKKNRIIPRHIQLAVRNDEELSKLLGNVVIANGGVLPNIHATLLP 503
AAEVLELAGNAARDNKKNRI+PRHIQLAVRNDEELS+LLG V IA GGVLPNIH TLLP
Sbjct: 63 AAEVLELAGNAARDNKKNRIVPRHIQLAVRNDEELSRLLGAVTIAAGGVLPNIHQTLLP 121


>sp|A2ZL69|H2AXB_ORYSI Probable histone H2AXb OS=Oryza sativa subsp.
indica GN=OsI_037312 PE=3 SV=1
Length = 138

Score = 199 bits (507), Expect = 6e-51
Identities = 102/119 (85%), Positives = 107/119 (89%)
Frame = +3

Query: 147 STMAAGGRGKPKNSKSVSRSQKAGLQFPVGRIARFLKKGKYAERVGAGAPVYLAAVMEYL 326
S GGRGK K SKSVSRS KAGLQFPVGRIAR+LK GKYAERVGAGAPVYL+AV+EYL
Sbjct: 3 SAGGGGGRGKSKGSKSVSRSSKAGLQFPVGRIARYLKAGKYAERVGAGAPVYLSAVLEYL 62

Query: 327 AAEVLELAGNAARDNKKNRIIPRHIQLAVRNDEELSKLLGNVVIANGGVLPNIHATLLP 503
AAEVLELAGNAARDNKKNRI+PRHIQLAVRNDEELS+LLG V IA GGVLPNIH TLLP
Sbjct: 63 AAEVLELAGNAARDNKKNRIVPRHIQLAVRNDEELSRLLGAVTIAAGGVLPNIHQTLLP 121


>sp|P16866|H2A4_VOLCA Histone H2A-IV OS=Volvox carteri PE=3 SV=1
Length = 129

Score = 196 bits (499), Expect = 5e-50
Identities = 97/117 (82%), Positives = 106/117 (90%)
Frame = +3

Query: 153 MAAGGRGKPKNSKSVSRSQKAGLQFPVGRIARFLKKGKYAERVGAGAPVYLAAVMEYLAA 332
MA G+GK K+VSRS KAGLQFPVGRIAR+LKKGKYAER+GAGAPVYLAAV+EYL A
Sbjct: 1 MAGRGKGKTAGKKAVSRSSKAGLQFPVGRIARYLKKGKYAERIGAGAPVYLAAVLEYLTA 60

Query: 333 EVLELAGNAARDNKKNRIIPRHIQLAVRNDEELSKLLGNVVIANGGVLPNIHATLLP 503
EVLELAGNAARDNKKNRI+PRHIQLA+RNDEEL KLLG+V IA+GGVLPNIHA LLP
Sbjct: 61 EVLELAGNAARDNKKNRIVPRHIQLAIRNDEELGKLLGDVTIASGGVLPNIHAVLLP 117


>sp|P50567|H2A_CHLRE Histone H2A OS=Chlamydomonas reinhardtii
GN=H2A-II PE=3 SV=1
Length = 129

Score = 196 bits (498), Expect = 7e-50
Identities = 97/117 (82%), Positives = 105/117 (89%)
Frame = +3

Query: 153 MAAGGRGKPKNSKSVSRSQKAGLQFPVGRIARFLKKGKYAERVGAGAPVYLAAVMEYLAA 332
MA G+GK K+VSRS KAGLQFPVGRIAR+LKKGKYAER+GAGAPVYLAAV+EYL A
Sbjct: 1 MAGRGKGKTSGKKAVSRSAKAGLQFPVGRIARYLKKGKYAERIGAGAPVYLAAVLEYLTA 60

Query: 333 EVLELAGNAARDNKKNRIIPRHIQLAVRNDEELSKLLGNVVIANGGVLPNIHATLLP 503
EVLELAGNAARDNKKNRI+PRHIQLA+RNDEEL KLLG V IA+GGVLPNIHA LLP
Sbjct: 61 EVLELAGNAARDNKKNRIVPRHIQLAIRNDEELGKLLGEVTIASGGVLPNIHAVLLP 117


>sp|P16865|H2A3_VOLCA Histone H2A-III OS=Volvox carteri PE=3 SV=1
Length = 129

Score = 196 bits (498), Expect = 7e-50
Identities = 97/117 (82%), Positives = 106/117 (90%)
Frame = +3

Query: 153 MAAGGRGKPKNSKSVSRSQKAGLQFPVGRIARFLKKGKYAERVGAGAPVYLAAVMEYLAA 332
MA G+GK K+VSRS KAGLQFPVGRIAR+LKKGKYAER+GAGAPVYLAAV+EYL A
Sbjct: 1 MAGRGKGKTAGKKAVSRSAKAGLQFPVGRIARYLKKGKYAERIGAGAPVYLAAVLEYLTA 60

Query: 333 EVLELAGNAARDNKKNRIIPRHIQLAVRNDEELSKLLGNVVIANGGVLPNIHATLLP 503
EVLELAGNAARDNKKNRI+PRHIQLA+RNDEEL KLLG+V IA+GGVLPNIHA LLP
Sbjct: 61 EVLELAGNAARDNKKNRIVPRHIQLAIRNDEELGKLLGDVTIASGGVLPNIHAVLLP 117


>sp|Q8LLP5|H2AXA_ORYSJ Probable histone H2AXa OS=Oryza sativa subsp.
japonica GN=Os03g0721900 PE=3 SV=1
Length = 137

Score = 194 bits (494), Expect = 2e-49
Identities = 98/119 (82%), Positives = 106/119 (89%)
Frame = +3

Query: 147 STMAAGGRGKPKNSKSVSRSQKAGLQFPVGRIARFLKKGKYAERVGAGAPVYLAAVMEYL 326
S+ GGRGK K +K+VSRS KAGLQFPVGRIAR+LK GKYAERVGAGAPVYL+AV+EYL
Sbjct: 3 SSQGGGGRGKAKTTKAVSRSSKAGLQFPVGRIARYLKAGKYAERVGAGAPVYLSAVLEYL 62

Query: 327 AAEVLELAGNAARDNKKNRIIPRHIQLAVRNDEELSKLLGNVVIANGGVLPNIHATLLP 503
AAEVLELAGNAARDNKKNRI+PRHIQLAVRNDEELS+LLG V IA GGVLPNI LLP
Sbjct: 63 AAEVLELAGNAARDNKKNRIVPRHIQLAVRNDEELSRLLGTVTIAAGGVLPNIQQVLLP 121


tr_hit_id A5BCX3
Definition tr|A5BCX3|A5BCX3_VITVI Histone H2A OS=Vitis vinifera
Align length 114
Score (bit) 210.0
E-value 5.0e-53
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= DK945310|Adiantum capillus-veneris mRNA, clone:
YMU02A01NGRL0008_O12, 5'
(581 letters)

Database: uniprot_trembl.fasta
7,341,751 sequences; 2,391,615,440 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

tr|A5BCX3|A5BCX3_VITVI Histone H2A OS=Vitis vinifera GN=GSVIVT00... 210 5e-53
tr|Q711T3|Q711T3_PINPS Histone H2A OS=Pinus pinaster GN=h2B PE=2... 207 4e-52
tr|A9NKG5|A9NKG5_PICSI Histone H2A OS=Picea sitchensis PE=2 SV=1 207 4e-52
tr|A2Q3H4|A2Q3H4_MEDTR Histone H2A OS=Medicago truncatula GN=Mtr... 206 6e-52
tr|A9T9D3|A9T9D3_PHYPA Histone H2A OS=Physcomitrella patens subs... 205 1e-51
tr|A9U2Y0|A9U2Y0_PHYPA Histone H2A OS=Physcomitrella patens subs... 202 8e-51
tr|A9PA35|A9PA35_POPTR Histone H2A OS=Populus trichocarpa PE=2 SV=1 202 8e-51
tr|A5C2R7|A5C2R7_VITVI Histone H2A OS=Vitis vinifera GN=GSVIVT00... 202 8e-51
tr|B6UIQ0|B6UIQ0_MAIZE Histone H2A OS=Zea mays PE=2 SV=1 201 3e-50
tr|A9PHC6|A9PHC6_POPTR Histone H2A OS=Populus trichocarpa PE=2 SV=1 200 4e-50
tr|A9S826|A9S826_PHYPA Histone H2A OS=Physcomitrella patens subs... 200 5e-50
tr|B7F7P0|B7F7P0_ORYSJ cDNA clone:J033087P07, full insert sequen... 199 7e-50
tr|Q42680|Q42680_CHLRE Histone H2A OS=Chlamydomonas reinhardtii ... 196 8e-49
tr|A8HWM8|A8HWM8_CHLRE Histone H2A OS=Chlamydomonas reinhardtii ... 196 8e-49
tr|A8HWF6|A8HWF6_CHLRE Histone H2A OS=Chlamydomonas reinhardtii ... 196 8e-49
tr|A8HSB5|A8HSB5_CHLRE Histone H2A OS=Chlamydomonas reinhardtii ... 196 8e-49
tr|A8IR81|A8IR81_CHLRE Histone H2A OS=Chlamydomonas reinhardtii ... 196 1e-48
tr|B6T543|B6T543_MAIZE Histone H2A OS=Zea mays PE=2 SV=1 195 1e-48
tr|A5C1C4|A5C1C4_VITVI Histone H2A OS=Vitis vinifera GN=GSVIVT00... 193 7e-48
tr|B8RIG6|B8RIG6_PINSY Putative histone (Fragment) OS=Pinus sylv... 192 9e-48
tr|A9T090|A9T090_PHYPA Histone H2A OS=Physcomitrella patens subs... 191 3e-47
tr|A9S4I9|A9S4I9_PHYPA Histone H2A OS=Physcomitrella patens subs... 191 3e-47
tr|A9NK06|A9NK06_PICSI Histone H2A OS=Picea sitchensis PE=2 SV=1 189 7e-47
tr|Q0WRA6|Q0WRA6_ARATH Histone H2A OS=Arabidopsis thaliana GN=At... 189 1e-46
tr|A9NTX3|A9NTX3_PICSI Histone H2A OS=Picea sitchensis PE=2 SV=1 189 1e-46
tr|B8RIG5|B8RIG5_PINSY Putative histone (Fragment) OS=Pinus sylv... 188 2e-46
tr|A9PDD1|A9PDD1_POPTR Histone H2A OS=Populus trichocarpa PE=2 SV=1 187 3e-46
tr|A9PCS9|A9PCS9_POPTR Histone H2A OS=Populus trichocarpa PE=2 SV=1 187 3e-46
tr|A7P108|A7P108_VITVI Histone H2A OS=Vitis vinifera GN=GSVIVT00... 187 3e-46
tr|O22430|O22430_PINTA Histone H2A OS=Pinus taeda GN=lp15 PE=2 SV=1 187 5e-46

>tr|A5BCX3|A5BCX3_VITVI Histone H2A OS=Vitis vinifera
GN=GSVIVT00006109001 PE=3 SV=1
Length = 139

Score = 210 bits (534), Expect = 5e-53
Identities = 106/114 (92%), Positives = 110/114 (96%)
Frame = +3

Query: 162 GGRGKPKNSKSVSRSQKAGLQFPVGRIARFLKKGKYAERVGAGAPVYLAAVMEYLAAEVL 341
GGRGKPK SKSVSRSQKAGLQFPVGRIARFLK GKYAERVGAGAPVYL+AV+EYLAAEVL
Sbjct: 9 GGRGKPKASKSVSRSQKAGLQFPVGRIARFLKAGKYAERVGAGAPVYLSAVLEYLAAEVL 68

Query: 342 ELAGNAARDNKKNRIIPRHIQLAVRNDEELSKLLGNVVIANGGVLPNIHATLLP 503
ELAGNAARDNKKNRI+PRHIQLAVRNDEELSKLLG+V IANGGVLPNIH TLLP
Sbjct: 69 ELAGNAARDNKKNRIVPRHIQLAVRNDEELSKLLGSVTIANGGVLPNIHQTLLP 122


>tr|Q711T3|Q711T3_PINPS Histone H2A OS=Pinus pinaster GN=h2B PE=2
SV=1
Length = 138

Score = 207 bits (526), Expect = 4e-52
Identities = 106/119 (89%), Positives = 111/119 (93%)
Frame = +3

Query: 147 STMAAGGRGKPKNSKSVSRSQKAGLQFPVGRIARFLKKGKYAERVGAGAPVYLAAVMEYL 326
S+ A GGRGK K++KSVSRSQKAGLQFPVGRIARFLK GKYAERVGAGAPVYLAAV+EYL
Sbjct: 3 SSGAKGGRGKAKSTKSVSRSQKAGLQFPVGRIARFLKAGKYAERVGAGAPVYLAAVLEYL 62

Query: 327 AAEVLELAGNAARDNKKNRIIPRHIQLAVRNDEELSKLLGNVVIANGGVLPNIHATLLP 503
AAEVLELAGNAARDNKKNRI+PRHIQLAVRNDEELSKLLG V IANGGVLPNIH LLP
Sbjct: 63 AAEVLELAGNAARDNKKNRIVPRHIQLAVRNDEELSKLLGAVTIANGGVLPNIHQVLLP 121


>tr|A9NKG5|A9NKG5_PICSI Histone H2A OS=Picea sitchensis PE=2 SV=1
Length = 138

Score = 207 bits (526), Expect = 4e-52
Identities = 106/119 (89%), Positives = 111/119 (93%)
Frame = +3

Query: 147 STMAAGGRGKPKNSKSVSRSQKAGLQFPVGRIARFLKKGKYAERVGAGAPVYLAAVMEYL 326
S+ A GGRGK K++KSVSRSQKAGLQFPVGRIARFLK GKYAERVGAGAPVYLAAV+EYL
Sbjct: 3 SSGAKGGRGKAKSTKSVSRSQKAGLQFPVGRIARFLKAGKYAERVGAGAPVYLAAVLEYL 62

Query: 327 AAEVLELAGNAARDNKKNRIIPRHIQLAVRNDEELSKLLGNVVIANGGVLPNIHATLLP 503
AAEVLELAGNAARDNKKNRI+PRHIQLAVRNDEELSKLLG V IANGGVLPNIH LLP
Sbjct: 63 AAEVLELAGNAARDNKKNRIVPRHIQLAVRNDEELSKLLGAVTIANGGVLPNIHQVLLP 121


>tr|A2Q3H4|A2Q3H4_MEDTR Histone H2A OS=Medicago truncatula
GN=MtrDRAFT_AC155882g20v2 PE=3 SV=1
Length = 139

Score = 206 bits (525), Expect = 6e-52
Identities = 104/114 (91%), Positives = 108/114 (94%)
Frame = +3

Query: 162 GGRGKPKNSKSVSRSQKAGLQFPVGRIARFLKKGKYAERVGAGAPVYLAAVMEYLAAEVL 341
GGRGKPK +KSVSRS KAGLQFPVGRIARFLK GKYAERVGAGAPVYL+AV+EYLAAEVL
Sbjct: 9 GGRGKPKAAKSVSRSSKAGLQFPVGRIARFLKAGKYAERVGAGAPVYLSAVLEYLAAEVL 68

Query: 342 ELAGNAARDNKKNRIIPRHIQLAVRNDEELSKLLGNVVIANGGVLPNIHATLLP 503
ELAGNAARDNKKNRI+PRHIQLAVRNDEELSKLLG V IANGGVLPNIH TLLP
Sbjct: 69 ELAGNAARDNKKNRIVPRHIQLAVRNDEELSKLLGTVTIANGGVLPNIHQTLLP 122


>tr|A9T9D3|A9T9D3_PHYPA Histone H2A OS=Physcomitrella patens subsp.
patens GN=HTA1507 PE=3 SV=1
Length = 139

Score = 205 bits (522), Expect = 1e-51
Identities = 105/119 (88%), Positives = 109/119 (91%)
Frame = +3

Query: 147 STMAAGGRGKPKNSKSVSRSQKAGLQFPVGRIARFLKKGKYAERVGAGAPVYLAAVMEYL 326
ST A GGRGK K SKS+SRSQKAGLQFPVGRIARFLK GK+AERVGAGAPVYLAAV+EYL
Sbjct: 3 STGATGGRGKSKASKSISRSQKAGLQFPVGRIARFLKSGKFAERVGAGAPVYLAAVLEYL 62

Query: 327 AAEVLELAGNAARDNKKNRIIPRHIQLAVRNDEELSKLLGNVVIANGGVLPNIHATLLP 503
AAEVLELAGNAARDNKKNRI+PRHIQLAVRNDEELSKLLG V IA GGVLPNIH LLP
Sbjct: 63 AAEVLELAGNAARDNKKNRIVPRHIQLAVRNDEELSKLLGTVTIAAGGVLPNIHTVLLP 121


>tr|A9U2Y0|A9U2Y0_PHYPA Histone H2A OS=Physcomitrella patens subsp.
patens GN=HTA1505 PE=3 SV=1
Length = 140

Score = 202 bits (515), Expect = 8e-51
Identities = 104/115 (90%), Positives = 106/115 (92%)
Frame = +3

Query: 159 AGGRGKPKNSKSVSRSQKAGLQFPVGRIARFLKKGKYAERVGAGAPVYLAAVMEYLAAEV 338
AGGRGK K SKS SRSQKAGLQFPVGRIARFLK GKYAERVGAGAPVYLAAV+EYLAAEV
Sbjct: 8 AGGRGKSKASKSTSRSQKAGLQFPVGRIARFLKAGKYAERVGAGAPVYLAAVLEYLAAEV 67

Query: 339 LELAGNAARDNKKNRIIPRHIQLAVRNDEELSKLLGNVVIANGGVLPNIHATLLP 503
LELAGNAARDNKKNRI+PRHIQLAVRNDEELSKLLG V IA GGVLPNIH LLP
Sbjct: 68 LELAGNAARDNKKNRIVPRHIQLAVRNDEELSKLLGTVTIAAGGVLPNIHTILLP 122


>tr|A9PA35|A9PA35_POPTR Histone H2A OS=Populus trichocarpa PE=2 SV=1
Length = 144

Score = 202 bits (515), Expect = 8e-51
Identities = 102/114 (89%), Positives = 109/114 (95%)
Frame = +3

Query: 162 GGRGKPKNSKSVSRSQKAGLQFPVGRIARFLKKGKYAERVGAGAPVYLAAVMEYLAAEVL 341
GGRGKPK SK+VSRSQKAGLQFPVGRIARFLK GKYAER+GAG+PVYL+AV+EYLAAEVL
Sbjct: 13 GGRGKPKASKAVSRSQKAGLQFPVGRIARFLKTGKYAERLGAGSPVYLSAVLEYLAAEVL 72

Query: 342 ELAGNAARDNKKNRIIPRHIQLAVRNDEELSKLLGNVVIANGGVLPNIHATLLP 503
ELAGNAARDNKKNRIIPRHIQLAVRNDEEL KLLG+V IANGGVLPNI+ TLLP
Sbjct: 73 ELAGNAARDNKKNRIIPRHIQLAVRNDEELGKLLGSVTIANGGVLPNINQTLLP 126


>tr|A5C2R7|A5C2R7_VITVI Histone H2A OS=Vitis vinifera
GN=GSVIVT00023622001 PE=3 SV=1
Length = 137

Score = 202 bits (515), Expect = 8e-51
Identities = 103/119 (86%), Positives = 109/119 (91%)
Frame = +3

Query: 147 STMAAGGRGKPKNSKSVSRSQKAGLQFPVGRIARFLKKGKYAERVGAGAPVYLAAVMEYL 326
S+ GGRGKPK +KSVSRS KAGLQFPVGRIARFLK GKYAERVGAGAPVYL+AV+EYL
Sbjct: 2 SSSNKGGRGKPKATKSVSRSAKAGLQFPVGRIARFLKAGKYAERVGAGAPVYLSAVLEYL 61

Query: 327 AAEVLELAGNAARDNKKNRIIPRHIQLAVRNDEELSKLLGNVVIANGGVLPNIHATLLP 503
AAEVLELAGNAARDNKK+RI+PRHIQLAVRNDEELSKLLG V IANGGVLPNIH LLP
Sbjct: 62 AAEVLELAGNAARDNKKSRIVPRHIQLAVRNDEELSKLLGTVTIANGGVLPNIHQNLLP 120


>tr|B6UIQ0|B6UIQ0_MAIZE Histone H2A OS=Zea mays PE=2 SV=1
Length = 136

Score = 201 bits (510), Expect = 3e-50
Identities = 101/116 (87%), Positives = 107/116 (92%)
Frame = +3

Query: 156 AAGGRGKPKNSKSVSRSQKAGLQFPVGRIARFLKKGKYAERVGAGAPVYLAAVMEYLAAE 335
+ GGRGKPK SK+VSRS KAGLQFPVGRIAR+LK GKYAERVG GAPVYL+AV+EYLAAE
Sbjct: 3 SGGGRGKPKGSKAVSRSTKAGLQFPVGRIARYLKAGKYAERVGGGAPVYLSAVLEYLAAE 62

Query: 336 VLELAGNAARDNKKNRIIPRHIQLAVRNDEELSKLLGNVVIANGGVLPNIHATLLP 503
VLELAGNAARDNKKNRI+PRHIQLAVRNDEELSKLLG V IA GGVLPNIH TLLP
Sbjct: 63 VLELAGNAARDNKKNRIVPRHIQLAVRNDEELSKLLGAVTIAAGGVLPNIHQTLLP 118


>tr|A9PHC6|A9PHC6_POPTR Histone H2A OS=Populus trichocarpa PE=2 SV=1
Length = 142

Score = 200 bits (509), Expect = 4e-50
Identities = 99/114 (86%), Positives = 108/114 (94%)
Frame = +3

Query: 162 GGRGKPKNSKSVSRSQKAGLQFPVGRIARFLKKGKYAERVGAGAPVYLAAVMEYLAAEVL 341
GGRG+ K SK+VSRSQKAGLQFPVGR+ARFLK GKYAER+GAG+PVYL+AV+EYLAAEVL
Sbjct: 12 GGRGRAKASKAVSRSQKAGLQFPVGRVARFLKTGKYAERLGAGSPVYLSAVLEYLAAEVL 71

Query: 342 ELAGNAARDNKKNRIIPRHIQLAVRNDEELSKLLGNVVIANGGVLPNIHATLLP 503
ELAGNAARDNKKNRI+PRHIQLAVRNDEEL KLLG+V IANGGVLPNIH TLLP
Sbjct: 72 ELAGNAARDNKKNRIVPRHIQLAVRNDEELGKLLGSVTIANGGVLPNIHQTLLP 125