DK945509
Clone id YMU02A01NGRL0009_I23
Library
Length 377
Definition Adiantum capillus-veneris mRNA. clone: YMU02A01NGRL0009_I23. 5' end sequence.
Accession
Tissue type young leaves
Developmental stage sporophyte
Contig ID -
Sequence
GTCAACTGGCTCTTGAAATTGAAAAGGAGAAAAGCACAATAGACATGTGGCTATTCTGCC
AAATGTGCAATAAGTGGAAAAAAGATGTAGTCTCCTCTATTTATCAATCCGGGGTTACTT
GAGGCAGCATATGAAAAGGAAGGAACTTTTATGGGAAAGAAAGGAAGGAGGTTTCATTTT
TCCTGTTCTATTGGCCAAAATGGCCAATGAATGGGGGTAGTAGGCTGCAAGCTGGCTATG
GATCTCATACAAGGTTCCCACCAGCTAGTGGTGCAGCTCTTGGGCATAAATACATTCAAC
ATGGCACTTTCAATTACTAAAGGCTTGGTGTAGAAGCCCTTCATGGAAAAAAAAAAAAAA
AAAAAAAAAAAAAAAAA
■■Homology search results ■■ -
sp_hit_id Q05A80
Definition sp|Q05A80|CAPR2_MOUSE Caprin-2 OS=Mus musculus
Align length 81
Score (bit) 35.0
E-value 0.12
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= DK945509|Adiantum capillus-veneris mRNA, clone:
YMU02A01NGRL0009_I23, 5'
(346 letters)

Database: uniprot_sprot.fasta
412,525 sequences; 148,809,765 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

sp|Q05A80|CAPR2_MOUSE Caprin-2 OS=Mus musculus GN=Caprin2 PE=2 SV=1 35 0.12
sp|P30680|SSR2_RAT Somatostatin receptor type 2 OS=Rattus norveg... 30 3.7
sp|P30875|SSR2_MOUSE Somatostatin receptor type 2 OS=Mus musculu... 30 3.7
sp|P34994|SSR2_PIG Somatostatin receptor type 2 OS=Sus scrofa GN... 30 4.9
sp|P30874|SSR2_HUMAN Somatostatin receptor type 2 OS=Homo sapien... 30 4.9
sp|P34993|SSR2_BOVIN Somatostatin receptor type 2 OS=Bos taurus ... 30 4.9

>sp|Q05A80|CAPR2_MOUSE Caprin-2 OS=Mus musculus GN=Caprin2 PE=2 SV=1
Length = 1031

Score = 35.0 bits (79), Expect = 0.12
Identities = 26/81 (32%), Positives = 41/81 (50%)
Frame = -3

Query: 326 KPLVIESAMLNVFMPKSCTTSWWEPCMRSIASLQPTTPIHWPFWPIEQEK*NLLPFFPIK 147
K L S ++V +S + SW P R AS+QP TP+ W E +K +L+P I
Sbjct: 416 KKLPPGSWAVSVQSEQSGSRSWTTPVCREQASVQPGTPVSWEN-NAENQKHSLVPQSQIS 474

Query: 146 VPSFSYAASSNPGLINRGDYI 84
+ S+ A++ GL+ G +
Sbjct: 475 LKSWGAASA---GLLPNGQVL 492


>sp|P30680|SSR2_RAT Somatostatin receptor type 2 OS=Rattus
norvegicus GN=Sstr2 PE=1 SV=1
Length = 369

Score = 30.0 bits (66), Expect = 3.7
Identities = 20/52 (38%), Positives = 25/52 (48%)
Frame = -3

Query: 167 LPFFPIKVPSFSYAASSNPGLINRGDYIFFPLIAHLAE*PHVYCAFLLFNFK 12
LPF+ V S S A S P L D++ A+ P +Y AFL NFK
Sbjct: 270 LPFYIFNVSSVSVAISPTPALKGMFDFVVILTYANSCANPILY-AFLSDNFK 320


>sp|P30875|SSR2_MOUSE Somatostatin receptor type 2 OS=Mus musculus
GN=Sstr2 PE=1 SV=1
Length = 369

Score = 30.0 bits (66), Expect = 3.7
Identities = 20/52 (38%), Positives = 25/52 (48%)
Frame = -3

Query: 167 LPFFPIKVPSFSYAASSNPGLINRGDYIFFPLIAHLAE*PHVYCAFLLFNFK 12
LPF+ V S S A S P L D++ A+ P +Y AFL NFK
Sbjct: 270 LPFYIFNVSSVSVAISPTPALKGMFDFVVILTYANSCANPILY-AFLSDNFK 320


>sp|P34994|SSR2_PIG Somatostatin receptor type 2 OS=Sus scrofa
GN=SSTR2 PE=3 SV=1
Length = 369

Score = 29.6 bits (65), Expect = 4.9
Identities = 20/52 (38%), Positives = 25/52 (48%)
Frame = -3

Query: 167 LPFFPIKVPSFSYAASSNPGLINRGDYIFFPLIAHLAE*PHVYCAFLLFNFK 12
LPF+ V S S A S P L D++ A+ P +Y AFL NFK
Sbjct: 270 LPFYIFNVSSVSVAISPTPALKGMFDFVVVLTYANSCANPILY-AFLSDNFK 320


>sp|P30874|SSR2_HUMAN Somatostatin receptor type 2 OS=Homo sapiens
GN=SSTR2 PE=1 SV=1
Length = 369

Score = 29.6 bits (65), Expect = 4.9
Identities = 20/52 (38%), Positives = 25/52 (48%)
Frame = -3

Query: 167 LPFFPIKVPSFSYAASSNPGLINRGDYIFFPLIAHLAE*PHVYCAFLLFNFK 12
LPF+ V S S A S P L D++ A+ P +Y AFL NFK
Sbjct: 270 LPFYIFNVSSVSMAISPTPALKGMFDFVVVLTYANSCANPILY-AFLSDNFK 320


>sp|P34993|SSR2_BOVIN Somatostatin receptor type 2 OS=Bos taurus
GN=SSTR2 PE=2 SV=1
Length = 368

Score = 29.6 bits (65), Expect = 4.9
Identities = 20/52 (38%), Positives = 25/52 (48%)
Frame = -3

Query: 167 LPFFPIKVPSFSYAASSNPGLINRGDYIFFPLIAHLAE*PHVYCAFLLFNFK 12
LPF+ V S S A S P L D++ A+ P +Y AFL NFK
Sbjct: 269 LPFYIFNVSSVSVAISPTPALKGMFDFVVVLTYANSCANPILY-AFLSDNFK 319


tr_hit_id B2KGD5
Definition tr|B2KGD5|B2KGD5_MOUSE Caprin family member 2 (Fragment) OS=Mus musculus
Align length 81
Score (bit) 35.0
E-value 1.9
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= DK945509|Adiantum capillus-veneris mRNA, clone:
YMU02A01NGRL0009_I23, 5'
(346 letters)

Database: uniprot_trembl.fasta
7,341,751 sequences; 2,391,615,440 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

tr|B2KGD5|B2KGD5_MOUSE Caprin family member 2 (Fragment) OS=Mus ... 35 1.9
tr|A3LRY6|A3LRY6_PICST Predicted protein OS=Pichia stipitis GN=P... 34 4.1
tr|A5DSJ8|A5DSJ8_LODEL Putative uncharacterized protein OS=Lodde... 33 7.1

>tr|B2KGD5|B2KGD5_MOUSE Caprin family member 2 (Fragment) OS=Mus
musculus GN=Caprin2 PE=4 SV=1
Length = 814

Score = 35.0 bits (79), Expect = 1.9
Identities = 26/81 (32%), Positives = 41/81 (50%)
Frame = -3

Query: 326 KPLVIESAMLNVFMPKSCTTSWWEPCMRSIASLQPTTPIHWPFWPIEQEK*NLLPFFPIK 147
K L S ++V +S + SW P R AS+QP TP+ W E +K +L+P I
Sbjct: 199 KKLPPGSWAVSVQSEQSGSRSWTTPVCREQASVQPGTPVSWEN-NAENQKHSLVPQSQIS 257

Query: 146 VPSFSYAASSNPGLINRGDYI 84
+ S+ A++ GL+ G +
Sbjct: 258 LKSWGAASA---GLLPNGQVL 275


>tr|A3LRY6|A3LRY6_PICST Predicted protein OS=Pichia stipitis
GN=PICST_44059 PE=4 SV=2
Length = 355

Score = 33.9 bits (76), Expect = 4.1
Identities = 17/45 (37%), Positives = 23/45 (51%)
Frame = +1

Query: 193 GQNGQ*MGVVGCKLAMDLIQGSHQLVVQLLGINTFNMALSITKGL 327
G N + +G GC L +D I GS +V + F AL+ T GL
Sbjct: 82 GNNAKGLGFQGCVLVLDEITGSLNALVNAKSLTAFRTALASTSGL 126


>tr|A5DSJ8|A5DSJ8_LODEL Putative uncharacterized protein
OS=Lodderomyces elongisporus GN=LELG_00334 PE=4 SV=1
Length = 353

Score = 33.1 bits (74), Expect = 7.1
Identities = 17/46 (36%), Positives = 24/46 (52%)
Frame = +1

Query: 193 GQNGQ*MGVVGCKLAMDLIQGSHQLVVQLLGINTFNMALSITKGLV 330
G N + +G VGC L MD + G + V+ + F AL+ GLV
Sbjct: 83 GNNSKGLGFVGCVLVMDEVTGELRAVLNANTLTAFRTALASILGLV 128