DK945806
Clone id YMU02A01NGRL0010_I03
Library
Length 356
Definition Adiantum capillus-veneris mRNA. clone: YMU02A01NGRL0010_I03. 5' end sequence.
Accession
Tissue type young leaves
Developmental stage sporophyte
Contig ID -
Sequence
AATTCCTGGTAACAAAGAGGGGGCTTACCTACCAAATATCTCACTTGCCACACGGGATCT
CCCTGACACTAGATGGGATGATATATTGTATCCACGTCTCGGGAATTAGAATGAATTCGA
TCTAAATGATTAATAGAATATATTGTGACGGGCAAGTCTGGTGCCAGCAGCCGCGGTACT
TGCCGCCCCCCTCGCCCCTATATAAGTTTTTGCAACTATTCATTTGGCACTTGGATCTCG
TAGGCGAGTCAAGCGGTCCACCTCTTTTTCTGAGCACAGCTCGCTCCTCCCTTTCGGTCG
GATACTCACTCCTAGAACAATAACCTGGCTGGGACGCAGATTCCGCAATCTTTCCT
■■Homology search results ■■ -
sp_hit_id Q9NJ15
Definition sp|Q9NJ15|PCSK5_BRACL Proprotein convertase subtilisin/kexin type 5 OS=Branchiostoma californiensis
Align length 62
Score (bit) 30.0
E-value 3.8
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= DK945806|Adiantum capillus-veneris mRNA, clone:
YMU02A01NGRL0010_I03, 5'
(356 letters)

Database: uniprot_sprot.fasta
412,525 sequences; 148,809,765 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

sp|Q9NJ15|PCSK5_BRACL Proprotein convertase subtilisin/kexin typ... 30 3.8
sp|P23649|NU1M_ASTFO NADH-ubiquinone oxidoreductase chain 1 (Fra... 30 5.0
sp|P14188|CNTF_RABIT Ciliary neurotrophic factor OS=Oryctolagus ... 30 5.0
sp|Q16WU7|WSCD_AEDAE WSCD family member AAEL009094 OS=Aedes aegy... 29 6.5
sp|Q00566|MECP2_RAT Methyl-CpG-binding protein 2 OS=Rattus norve... 29 6.5
sp|Q9Z2D6|MECP2_MOUSE Methyl-CpG-binding protein 2 OS=Mus muscul... 29 6.5
sp|Q95LG8|MECP2_MACFA Methyl-CpG-binding protein 2 OS=Macaca fas... 29 6.5
sp|P51608|MECP2_HUMAN Methyl-CpG-binding protein 2 OS=Homo sapie... 29 6.5
sp|Q9IBG7|CRIM2_XENLA Cysteine-rich motor neuron 2 protein OS=Xe... 29 8.5

>sp|Q9NJ15|PCSK5_BRACL Proprotein convertase subtilisin/kexin type 5
OS=Branchiostoma californiensis GN=PC6 PE=2 SV=1
Length = 1696

Score = 30.0 bits (66), Expect = 3.8
Identities = 20/62 (32%), Positives = 24/62 (38%), Gaps = 4/62 (6%)
Frame = -2

Query: 322 YCSRSEYPTERE----ERAVLRKRGGPLDSPTRSKCQMNSCKNLYRGEGGGKYRGCWHQT 155
YC YP E + L GG ++ Q N C Y GE Y+G H T
Sbjct: 909 YCGNRRYPENGECHPCHPSCLGCIGGEIN-------QCNQCITDYEGEDHFLYQGTCHVT 961

Query: 154 CP 149
CP
Sbjct: 962 CP 963


>sp|P23649|NU1M_ASTFO NADH-ubiquinone oxidoreductase chain 1
(Fragment) OS=Asterias forbesii GN=ND1 PE=3 SV=1
Length = 127

Score = 29.6 bits (65), Expect = 5.0
Identities = 26/60 (43%), Positives = 33/60 (55%), Gaps = 4/60 (6%)
Frame = +3

Query: 177 YLPPPSP-LYKFLQLFIWHLDLVGESS---GPPLFLSTARSSLSVGYSLLEQ*PGWDADS 344
YL SP L+ FL + +W + VGES+ L L SSLSV YSLL GW ++S
Sbjct: 71 YLFYSSPALFLFLAILLWSIIPVGESTLNFNLSLVLILGLSSLSV-YSLLGS--GWSSNS 127


>sp|P14188|CNTF_RABIT Ciliary neurotrophic factor OS=Oryctolagus
cuniculus GN=CNTF PE=1 SV=1
Length = 199

Score = 29.6 bits (65), Expect = 5.0
Identities = 15/29 (51%), Positives = 19/29 (65%)
Frame = +2

Query: 263 SFSEHSSLLPFGRILTPRTITWLGRRFRN 349
+F EHS+L P R L RTI WL R+ R+
Sbjct: 2 AFMEHSALTPHRRELCSRTI-WLARKIRS 29


>sp|Q16WU7|WSCD_AEDAE WSCD family member AAEL009094 OS=Aedes aegypti
GN=AAEL009094 PE=3 SV=1
Length = 317

Score = 29.3 bits (64), Expect = 6.5
Identities = 14/24 (58%), Positives = 16/24 (66%), Gaps = 3/24 (12%)
Frame = +3

Query: 159 WCQQPRYL--PPPSP-LYKFLQLF 221
WC + RY+ PPPSP YK LQ F
Sbjct: 65 WCTELRYMDSPPPSPKAYKLLQTF 88


>sp|Q00566|MECP2_RAT Methyl-CpG-binding protein 2 OS=Rattus
norvegicus GN=Mecp2 PE=1 SV=1
Length = 492

Score = 29.3 bits (64), Expect = 6.5
Identities = 18/55 (32%), Positives = 23/55 (41%)
Frame = -2

Query: 340 SASQPGYCSRSEYPTEREERAVLRKRGGPLDSPTRSKCQMNSCKNLYRGEGGGKY 176
S S P S P +R R+++R RG D PT + K G GKY
Sbjct: 68 SGSAPAVPEASASPKQR--RSIIRDRGPMYDDPTLPEGWTRKLKQRKSGRSAGKY 120


>sp|Q9Z2D6|MECP2_MOUSE Methyl-CpG-binding protein 2 OS=Mus musculus
GN=Mecp2 PE=1 SV=1
Length = 484

Score = 29.3 bits (64), Expect = 6.5
Identities = 18/55 (32%), Positives = 23/55 (41%)
Frame = -2

Query: 340 SASQPGYCSRSEYPTEREERAVLRKRGGPLDSPTRSKCQMNSCKNLYRGEGGGKY 176
S S P S P +R R+++R RG D PT + K G GKY
Sbjct: 68 SGSAPAVPEASASPKQR--RSIIRDRGPMYDDPTLPEGWTRKLKQRKSGRSAGKY 120


>sp|Q95LG8|MECP2_MACFA Methyl-CpG-binding protein 2 OS=Macaca
fascicularis GN=MECP2 PE=2 SV=1
Length = 486

Score = 29.3 bits (64), Expect = 6.5
Identities = 18/55 (32%), Positives = 23/55 (41%)
Frame = -2

Query: 340 SASQPGYCSRSEYPTEREERAVLRKRGGPLDSPTRSKCQMNSCKNLYRGEGGGKY 176
S S P S P +R R+++R RG D PT + K G GKY
Sbjct: 68 SGSAPAVPEASASPKQR--RSIIRDRGPMYDDPTLPEGWTRKLKQRKSGRSAGKY 120


>sp|P51608|MECP2_HUMAN Methyl-CpG-binding protein 2 OS=Homo sapiens
GN=MECP2 PE=1 SV=1
Length = 486

Score = 29.3 bits (64), Expect = 6.5
Identities = 18/55 (32%), Positives = 23/55 (41%)
Frame = -2

Query: 340 SASQPGYCSRSEYPTEREERAVLRKRGGPLDSPTRSKCQMNSCKNLYRGEGGGKY 176
S S P S P +R R+++R RG D PT + K G GKY
Sbjct: 68 SGSAPAVPEASASPKQR--RSIIRDRGPMYDDPTLPEGWTRKLKQRKSGRSAGKY 120


>sp|Q9IBG7|CRIM2_XENLA Cysteine-rich motor neuron 2 protein OS=Xenopus
laevis GN=crim2 PE=2 SV=1
Length = 2327

Score = 28.9 bits (63), Expect = 8.5
Identities = 11/34 (32%), Positives = 22/34 (64%)
Frame = -2

Query: 247 SPTRSKCQMNSCKNLYRGEGGGKYRGCWHQTCPS 146
+P++ C++ +C++L G+ +YR C + CPS
Sbjct: 1747 NPSKDPCEICTCESLPNGQ---QYRHCTKKQCPS 1777


tr_hit_id A8JJG4
Definition tr|A8JJG4|A8JJG4_CHLRE Predicted protein OS=Chlamydomonas reinhardtii
Align length 23
Score (bit) 35.0
E-value 1.9
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= DK945806|Adiantum capillus-veneris mRNA, clone:
YMU02A01NGRL0010_I03, 5'
(356 letters)

Database: uniprot_trembl.fasta
7,341,751 sequences; 2,391,615,440 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

tr|A8JJG4|A8JJG4_CHLRE Predicted protein OS=Chlamydomonas reinha... 35 1.9
tr|A8DVV5|A8DVV5_NEMVE Predicted protein OS=Nematostella vectens... 35 2.5
tr|Q6ZJ97|Q6ZJ97_ORYSJ Os08g0206900 protein OS=Oryza sativa subs... 34 3.2
tr|B8BBW2|B8BBW2_ORYSI Putative uncharacterized protein OS=Oryza... 34 3.2
tr|A3BQM9|A3BQM9_ORYSJ Putative uncharacterized protein OS=Oryza... 34 3.2
tr|B4FZF7|B4FZF7_MAIZE Putative uncharacterized protein OS=Zea m... 33 9.4

>tr|A8JJG4|A8JJG4_CHLRE Predicted protein OS=Chlamydomonas
reinhardtii GN=CHLREDRAFT_155068 PE=4 SV=1
Length = 87

Score = 35.0 bits (79), Expect = 1.9
Identities = 13/23 (56%), Positives = 14/23 (60%)
Frame = -2

Query: 217 SCKNLYRGEGGGKYRGCWHQTCP 149
+C NL YRGCWHQTCP
Sbjct: 60 NCNNLNIRYWSWNYRGCWHQTCP 82


>tr|A8DVV5|A8DVV5_NEMVE Predicted protein OS=Nematostella vectensis
GN=v1g225826 PE=4 SV=1
Length = 135

Score = 34.7 bits (78), Expect = 2.5
Identities = 11/15 (73%), Positives = 12/15 (80%)
Frame = -2

Query: 193 EGGGKYRGCWHQTCP 149
+G YRGCWHQTCP
Sbjct: 116 DGSWNYRGCWHQTCP 130


>tr|Q6ZJ97|Q6ZJ97_ORYSJ Os08g0206900 protein OS=Oryza sativa subsp.
japonica GN=OJ1734_E04.4 PE=2 SV=1
Length = 489

Score = 34.3 bits (77), Expect = 3.2
Identities = 19/54 (35%), Positives = 25/54 (46%)
Frame = -2

Query: 313 RSEYPTEREERAVLRKRGGPLDSPTRSKCQMNSCKNLYRGEGGGKYRGCWHQTC 152
R YP E+ V R RGGPL S +M++ +G G+ R CW C
Sbjct: 295 RKAYPQEKVGVFVQRGRGGPLSVVEYS--EMDAAMTTEINQGTGRLRYCWSNVC 346


>tr|B8BBW2|B8BBW2_ORYSI Putative uncharacterized protein OS=Oryza
sativa subsp. indica GN=OsI_28227 PE=4 SV=1
Length = 489

Score = 34.3 bits (77), Expect = 3.2
Identities = 19/54 (35%), Positives = 25/54 (46%)
Frame = -2

Query: 313 RSEYPTEREERAVLRKRGGPLDSPTRSKCQMNSCKNLYRGEGGGKYRGCWHQTC 152
R YP E+ V R RGGPL S +M++ +G G+ R CW C
Sbjct: 295 RKAYPQEKVGVFVQRGRGGPLSVVEYS--EMDAAMTTEINQGTGRLRYCWSNVC 346


>tr|A3BQM9|A3BQM9_ORYSJ Putative uncharacterized protein OS=Oryza
sativa subsp. japonica GN=OsJ_025351 PE=4 SV=1
Length = 535

Score = 34.3 bits (77), Expect = 3.2
Identities = 19/54 (35%), Positives = 25/54 (46%)
Frame = -2

Query: 313 RSEYPTEREERAVLRKRGGPLDSPTRSKCQMNSCKNLYRGEGGGKYRGCWHQTC 152
R YP E+ V R RGGPL S +M++ +G G+ R CW C
Sbjct: 341 RKAYPQEKVGVFVQRGRGGPLSVVEYS--EMDAAMTTEINQGTGRLRYCWSNVC 392


>tr|B4FZF7|B4FZF7_MAIZE Putative uncharacterized protein OS=Zea mays
PE=2 SV=1
Length = 493

Score = 32.7 bits (73), Expect = 9.4
Identities = 21/66 (31%), Positives = 27/66 (40%)
Frame = -2

Query: 349 IAESASQPGYCSRSEYPTEREERAVLRKRGGPLDSPTRSKCQMNSCKNLYRGEGGGKYRG 170
I + AS R YP E V R RGGPL S +M++ + G+ R
Sbjct: 287 IDKGASSAAKVVRKAYPQENVGVFVQRGRGGPLSVVEYS--EMDAAMATEMNQSTGRLRY 344

Query: 169 CWHQTC 152
CW C
Sbjct: 345 CWSNIC 350