DK945833
Clone id YMU02A01NGRL0010_J14
Library
Length 638
Definition Adiantum capillus-veneris mRNA. clone: YMU02A01NGRL0010_J14. 5' end sequence.
Accession
Tissue type young leaves
Developmental stage sporophyte
Contig ID -
Sequence
GCGGATTCGTACTTTATCGGTGTGAAGGCGATCGCCGTCAATGAGGTTACCCTCTCCATA
GATACCAATCTTCTCAAGATCAAGAATGATGGCACAGGAGGCTCAAAAGGGGGAACAATT
ATAAGCACAACTGTGAGGTACACACAGCTAGAGAGCTCTATATACAATGCACTGGCGAGC
CATTTCAAGACGGCGGCGAATGCGAGGGGGATCAAGAGTGTGACAGCGATAAGCCCATTC
GACACATGCTTTGATGCATCGACAGCATCGTCGACAAGGGTGGGATACAATGTGCCAACA
ATAGATCTGTTGTTGCAAGGGAGCGGGGGCGTGGTGTGGTCGATATTGGGTGCCAATTCT
GTGGTCTCGTTGGATGATGGCAAGGTGATATGCCTGGCATTTCAGAGAACAAGGGAATTT
GAGACAAGGGCAATAGTGATGGGCACCTCTCAACAACAGGATGCTCTTTTGCAATATGAC
TTGGCTACTTCTAGGCTTGGCTTTGTTTCTACTCTACTTGGGCGAATGGCTACTTGCTCC
AATTTCAACTTCACCTCCTCTTCTTAGGACTATAAAATGGTTCCCCTTCAAATAAAACCA
TGCAAATTCTTGGGCTTGCATTTGGGTTAAAAAAAAAA
■■Homology search results ■■ -
sp_hit_id Q8RVH5
Definition sp|Q8RVH5|7SBG2_SOYBN Basic 7S globulin 2 OS=Glycine max
Align length 124
Score (bit) 42.4
E-value 0.002
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= DK945833|Adiantum capillus-veneris mRNA, clone:
YMU02A01NGRL0010_J14, 5'
(628 letters)

Database: uniprot_sprot.fasta
412,525 sequences; 148,809,765 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

sp|Q8RVH5|7SBG2_SOYBN Basic 7S globulin 2 OS=Glycine max PE=1 SV=1 42 0.002
sp|P13917|7SB1_SOYBN Basic 7S globulin OS=Glycine max GN=BG PE=1... 40 0.008
sp|P08555|DSDX_ECOLI DsdX permease OS=Escherichia coli (strain K... 33 1.2
sp|Q09715|TUP11_SCHPO Transcriptional repressor tup11 OS=Schizos... 32 2.7
sp|Q0UJJ7|NST1_PHANO Stress response protein NST1 OS=Phaeosphaer... 32 3.5
sp|Q8CDW1|U638A_MOUSE UPF0638 protein A OS=Mus musculus PE=2 SV=1 31 4.6
sp|Q6ZCX3|FH6_ORYSJ Formin-like protein 6 OS=Oryza sativa subsp.... 31 4.6
sp|Q80ZA4|PKHL1_MOUSE Fibrocystin-L OS=Mus musculus GN=Pkhd1l1 P... 31 5.9
sp|Q6BI90|ARX1_DEBHA Probable metalloprotease ARX1 OS=Debaryomyc... 31 5.9
sp|P53971|FAP1_YEAST FKBP12-associated protein 1 OS=Saccharomyce... 27 7.1
sp|P98164|LRP2_HUMAN Low-density lipoprotein receptor-related pr... 30 7.7
sp|Q9I3S1|BDLA_PSEAE Biofilm dispersion protein bdlA OS=Pseudomo... 30 7.7
sp|Q9P107|GMIP_HUMAN GEM-interacting protein OS=Homo sapiens GN=... 30 7.8

>sp|Q8RVH5|7SBG2_SOYBN Basic 7S globulin 2 OS=Glycine max PE=1 SV=1
Length = 433

Score = 42.4 bits (98), Expect = 0.002
Identities = 30/124 (24%), Positives = 52/124 (41%)
Frame = +1

Query: 148 LESSIYNALASHFKTAANARGIKSVTAISPFDTCFDASTASSTRVGYNVPTIDLLLQGSG 327
L+ S+Y A F + V +++PF CF+++ ++ P++DL++
Sbjct: 303 LQQSLYQAFTQVFAQQLEKQA--QVKSVAPFGLCFNSNKINA------YPSVDLVMDKPN 354

Query: 328 GVVWSILGANSVVSLDDGKVICLAFQRTREFETRAIVMGTSXXXXXXXXXXXXTSRLGFV 507
G VW I G + +V G V CL + +GT SR+GF
Sbjct: 355 GPVWRISGEDLMVQAQPG-VTCLGVMNGGMQPRAEVTLGTRQLEEKLMVFDLARSRVGFS 413

Query: 508 STLL 519
++ L
Sbjct: 414 TSSL 417


>sp|P13917|7SB1_SOYBN Basic 7S globulin OS=Glycine max GN=BG PE=1
SV=2
Length = 427

Score = 40.4 bits (93), Expect = 0.008
Identities = 30/124 (24%), Positives = 51/124 (41%)
Frame = +1

Query: 148 LESSIYNALASHFKTAANARGIKSVTAISPFDTCFDASTASSTRVGYNVPTIDLLLQGSG 327
L+ S+Y A F + V +++PF CF+++ ++ P++DL++
Sbjct: 297 LQQSVYQAFTQVFAQQLPKQA--QVKSVAPFGLCFNSNKINA------YPSVDLVMDKPN 348

Query: 328 GVVWSILGANSVVSLDDGKVICLAFQRTREFETRAIVMGTSXXXXXXXXXXXXTSRLGFV 507
G VW I G + +V G V CL I +G SR+GF
Sbjct: 349 GPVWRISGEDLMVQAQPG-VTCLGVMNGGMQPRAEITLGARQLEENLVVFDLARSRVGFS 407

Query: 508 STLL 519
++ L
Sbjct: 408 TSSL 411


>sp|P08555|DSDX_ECOLI DsdX permease OS=Escherichia coli (strain K12)
GN=dsdX PE=1 SV=2
Length = 445

Score = 33.1 bits (74), Expect = 1.2
Identities = 17/41 (41%), Positives = 22/41 (53%)
Frame = -3

Query: 230 IAVTLLIPLAFAAVLKWLASALYIELSSCVYLTVVLIIVPP 108
+ V LLIPLAF+ K S L + + C L V +VPP
Sbjct: 120 VGVVLLIPLAFSIAKKTNTSLLKLAIPLCTALMAVHCVVPP 160


>sp|Q09715|TUP11_SCHPO Transcriptional repressor tup11
OS=Schizosaccharomyces pombe GN=tup11 PE=1 SV=1
Length = 614

Score = 32.0 bits (71), Expect = 2.7
Identities = 15/42 (35%), Positives = 22/42 (52%)
Frame = -1

Query: 481 SHIAKEHPVVERCPSLLPLSQIPLFSEMPGISPCHHPTRPQN 356
+HI +EHP + S P + +P F ++P P H PQN
Sbjct: 111 THIDQEHPSQTKSTSQPPSNHLPAFQQIP---PIHQSAYPQN 149


>sp|Q0UJJ7|NST1_PHANO Stress response protein NST1 OS=Phaeosphaeria
nodorum GN=NST1 PE=3 SV=3
Length = 1202

Score = 31.6 bits (70), Expect = 3.5
Identities = 28/86 (32%), Positives = 37/86 (43%), Gaps = 14/86 (16%)
Frame = -1

Query: 472 AKEHPVVERCPS---------LLPLSQIPLFSEMPGISPCHHPTR----PQNWHPIST-T 335
A + P CP+ LLP + P S I CH P P P+S T
Sbjct: 60 ATDTPTHSSCPAPPIAVPSSLLLPRTTHPS-SRSSHICACHTPVTARHSPNRLCPVSLPT 118

Query: 334 PRPRSLATTDLLLAHCIPPLSTMLSM 257
P PRS+A A +PP S++L+M
Sbjct: 119 PTPRSMAQGTKAPAAAMPPNSSVLNM 144


>sp|Q8CDW1|U638A_MOUSE UPF0638 protein A OS=Mus musculus PE=2 SV=1
Length = 299

Score = 31.2 bits (69), Expect = 4.6
Identities = 25/89 (28%), Positives = 39/89 (43%), Gaps = 11/89 (12%)
Frame = -1

Query: 481 SHIAKEHPVVERCPSLLP-------LSQIPLFSEMPGISPCHHPTRPQNWHPISTTPRP- 326
SH+ KE V R + LSQ +E G+ P RP++W + PRP
Sbjct: 210 SHLPKEEKTVSRSQLVFERQFRASRLSQDIKEAEKKGLVVGTGPQRPRSWAAADSVPRPS 269

Query: 325 ---RSLATTDLLLAHCIPPLSTMLSMHQS 248
R + T ++L H ++S+HQ+
Sbjct: 270 LVGRRVMTAEILGEH-------LVSLHQA 291


>sp|Q6ZCX3|FH6_ORYSJ Formin-like protein 6 OS=Oryza sativa subsp.
japonica GN=FH6 PE=2 SV=2
Length = 1364

Score = 31.2 bits (69), Expect = 4.6
Identities = 26/89 (29%), Positives = 41/89 (46%), Gaps = 8/89 (8%)
Frame = -1

Query: 481 SHIAKEHPVVERCPSLLPLSQIPLFSEM-PGISPCHHPTRPQNW--HPISTTPRPR---- 323
S A++HP + PSL P Q S++ I P +H N P+ +P P
Sbjct: 646 SQQAQKHPDLSSFPSLSPTQQKQSTSKLCQTILPTNHQLSSSNITKEPLQISPAPTPPPL 705

Query: 322 -SLATTDLLLAHCIPPLSTMLSMHQSMCR 239
+ +T+ HC+PP +MLS ++ R
Sbjct: 706 PTPSTSSSSSCHCLPP-DSMLSTTTALFR 733


>sp|Q80ZA4|PKHL1_MOUSE Fibrocystin-L OS=Mus musculus GN=Pkhd1l1 PE=2
SV=1
Length = 4249

Score = 30.8 bits (68), Expect = 5.9
Identities = 20/79 (25%), Positives = 34/79 (43%), Gaps = 8/79 (10%)
Frame = -3

Query: 380 PSSNETTELAPNIDHTTPPLPCNNRSIVGTLYPTLVDDA--------VDASKHVSNGLIA 225
PS+ EL I H LPC N+ +G+ YP +V+++ +D ++ G+
Sbjct: 1572 PSTGTANELITIIGHGFSSLPCANKVTIGS-YPCVVEESSENSIICHIDPQNSMNVGIRE 1630

Query: 224 VTLLIPLAFAAVLKWLASA 168
+ LI + L A
Sbjct: 1631 IVTLIVYNLGTAINTLTKA 1649


>sp|Q6BI90|ARX1_DEBHA Probable metalloprotease ARX1 OS=Debaryomyces
hansenii GN=ARX1 PE=3 SV=2
Length = 564

Score = 30.8 bits (68), Expect = 5.9
Identities = 26/86 (30%), Positives = 39/86 (45%), Gaps = 5/86 (5%)
Frame = -3

Query: 425 VSNSLVL*NARHITLPSSNETTELAPNIDHTTPPLPCNNRSIVGTLYPTLVDDAVD---- 258
V+ L L N+R + E T + HT+P P N + TL L+ + +
Sbjct: 354 VNYQLRLKNSRSLLGKIDKEFTVFPFKLSHTSPSFPATNSQDLATLKKELIANKLGLSEL 413

Query: 257 ASKHVSNGL-IAVTLLIPLAFAAVLK 183
A++H+ N I VT IP F +LK
Sbjct: 414 ANRHLINAKPIQVTKFIP--FETILK 437


>sp|P53971|FAP1_YEAST FKBP12-associated protein 1 OS=Saccharomyces
cerevisiae GN=FAP1 PE=1 SV=1
Length = 965

Score = 26.9 bits (58), Expect(2) = 7.1
Identities = 13/45 (28%), Positives = 17/45 (37%)
Frame = -1

Query: 460 PVVERCPSLLPLSQIPLFSEMPGISPCHHPTRPQNWHPISTTPRP 326
P RC + LP P + G S C H P H + + P
Sbjct: 503 PAPVRCGTKLPTCNHPCIKVVRGESTCGHKPMPHTCHSLDVSCPP 547



Score = 21.2 bits (43), Expect(2) = 7.1
Identities = 7/20 (35%), Positives = 8/20 (40%)
Frame = -2

Query: 303 YCWHIVSHPCRRCCRCIKAC 244
YC+H C C K C
Sbjct: 585 YCYHTCQKTCHLPGNCQKVC 604


tr_hit_id B8LN22
Definition tr|B8LN22|B8LN22_PICSI Putative uncharacterized protein OS=Picea sitchensis
Align length 172
Score (bit) 114.0
E-value 4.0e-24
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= DK945833|Adiantum capillus-veneris mRNA, clone:
YMU02A01NGRL0010_J14, 5'
(628 letters)

Database: uniprot_trembl.fasta
7,341,751 sequences; 2,391,615,440 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

tr|B8LN22|B8LN22_PICSI Putative uncharacterized protein OS=Picea... 114 4e-24
tr|Q8LF70|Q8LF70_ARATH EDGP OS=Arabidopsis thaliana PE=2 SV=1 110 7e-23
tr|Q9ZVS4|Q9ZVS4_ARATH F15K9.17 protein (Putative uncharacterize... 109 1e-22
tr|Q9ZVS5|Q9ZVS5_ARATH F15K9.16 protein (Putative uncharacterize... 108 3e-22
tr|A7PU90|A7PU90_VITVI Chromosome chr7 scaffold_31, whole genome... 105 2e-21
tr|A5ARQ0|A5ARQ0_VITVI Putative uncharacterized protein OS=Vitis... 103 6e-21
tr|Q7XJE7|Q7XJE7_SOLTU Putative xyloglucanase inhibitor OS=Solan... 102 2e-20
tr|Q05929|Q05929_DAUCA EDGP (Fragment) OS=Daucus carota GN=EDGP1... 101 3e-20
tr|A5BL34|A5BL34_VITVI Putative uncharacterized protein OS=Vitis... 100 5e-20
tr|Q8GT67|Q8GT67_SOLLC Xyloglucan-specific fungal endoglucanase ... 100 1e-19
tr|Q3SC86|Q3SC86_SOLLC Xyloglucan-specific fungal endoglucanase ... 99 2e-19
tr|Q3KU27|Q3KU27_NICLS Nectarin IV OS=Nicotiana langsdorffii x N... 99 2e-19
tr|A7Q1I5|A7Q1I5_VITVI Chromosome chr7 scaffold_44, whole genome... 98 4e-19
tr|B7FKF9|B7FKF9_MEDTR Putative uncharacterized protein OS=Medic... 93 1e-17
tr|A7NWG3|A7NWG3_VITVI Chromosome chr5 scaffold_2, whole genome ... 92 3e-17
tr|A2Y4I2|A2Y4I2_ORYSI Putative uncharacterized protein OS=Oryza... 82 2e-14
tr|Q6AUL1|Q6AUL1_ORYSJ Putative uncharacterized protein OSJNBb00... 81 5e-14
tr|Q6AUL3|Q6AUL3_ORYSJ Putative uncharacterized protein OSJNBb00... 80 1e-13
tr|Q0DIB3|Q0DIB3_ORYSJ Os05g0402900 protein OS=Oryza sativa subs... 80 1e-13
tr|A3B3W0|A3B3W0_ORYSJ Putative uncharacterized protein OS=Oryza... 80 1e-13
tr|A7PSD5|A7PSD5_VITVI Chromosome chr14 scaffold_27, whole genom... 79 2e-13
tr|A5C7L4|A5C7L4_VITVI Putative uncharacterized protein OS=Vitis... 79 2e-13
tr|Q6AUL0|Q6AUL0_ORYSJ Os05g0403300 protein OS=Oryza sativa subs... 79 3e-13
tr|A3B3W3|A3B3W3_ORYSJ Putative uncharacterized protein OS=Oryza... 79 3e-13
tr|Q3E9C7|Q3E9C7_ARATH Uncharacterized protein At5g19110.1 OS=Ar... 78 4e-13
tr|Q0WQH2|Q0WQH2_ARATH Dermal glycoprotein-like (Fragment) OS=Ar... 78 4e-13
tr|A7PU89|A7PU89_VITVI Chromosome chr7 scaffold_31, whole genome... 75 3e-12
tr|A3B3W2|A3B3W2_ORYSJ Putative uncharacterized protein OS=Oryza... 74 9e-12
tr|Q9FSZ9|Q9FSZ9_CICAR Putative extracellular dermal glycoprotei... 73 1e-11
tr|Q6AUL2|Q6AUL2_ORYSJ Putative uncharacterized protein OSJNBb00... 71 5e-11

>tr|B8LN22|B8LN22_PICSI Putative uncharacterized protein OS=Picea
sitchensis PE=2 SV=1
Length = 422

Score = 114 bits (286), Expect = 4e-24
Identities = 69/172 (40%), Positives = 94/172 (54%)
Frame = +1

Query: 4 DSYFIGVKAIAVNEVTLSIDTNLLKIKNDXXXXXXXXXXXXXXVRYTQLESSIYNALASH 183
D +++GV+ I V V ++ID L+ D VRYTQL S IYN+L
Sbjct: 241 DVFYLGVQRIEVGGVNVAIDAEKLRFDKDGRGGTKLSTV----VRYTQLASPIYNSLEGV 296

Query: 184 FKTAANARGIKSVTAISPFDTCFDASTASSTRVGYNVPTIDLLLQGSGGVVWSILGANSV 363
F + A I V ++SPF CFD+S STRVG VPTID++LQG+ W I GANS+
Sbjct: 297 FTSVAKKMNITRVASVSPFGACFDSSGVGSTRVGPAVPTIDIVLQGNSTTTWRIFGANSM 356

Query: 364 VSLDDGKVICLAFQRTREFETRAIVMGTSXXXXXXXXXXXXTSRLGFVSTLL 519
V +++ KV+CL F + ++IV+GT TS LGF S+LL
Sbjct: 357 VRVNN-KVLCLGFVDGGDNLQQSIVIGTYQMQDNLLQFDLATSTLGFSSSLL 407


>tr|Q8LF70|Q8LF70_ARATH EDGP OS=Arabidopsis thaliana PE=2 SV=1
Length = 433

Score = 110 bits (275), Expect = 7e-23
Identities = 73/175 (41%), Positives = 89/175 (50%)
Frame = +1

Query: 1 ADSYFIGVKAIAVNEVTLSIDTNLLKIKNDXXXXXXXXXXXXXXVRYTQLESSIYNALAS 180
+ YFIGV AI + E T+ I+ LLKI YT LESSIYNA S
Sbjct: 251 SSEYFIGVTAIQIVEKTVPINPTLLKINASTGFGGTKISSVNP---YTVLESSIYNAFTS 307

Query: 181 HFKTAANARGIKSVTAISPFDTCFDASTASSTRVGYNVPTIDLLLQGSGGVVWSILGANS 360
F A AR IK V ++ PF CF TR+GY VP I+L+L S VVW I GANS
Sbjct: 308 EFVKQALARSIKRVASVKPFGACFSTKNVGVTRLGYAVPEIELVLH-SKDVVWRIFGANS 366

Query: 361 VVSLDDGKVICLAFQRTREFETRAIVMGTSXXXXXXXXXXXXTSRLGFVSTLLGR 525
+VS+ D VICL F ++V+G ++R GF STLLGR
Sbjct: 367 MVSVSD-DVICLGFVDGGVNARTSVVIGGFQLEDNLIEFDLASNRFGFSSTLLGR 420


>tr|Q9ZVS4|Q9ZVS4_ARATH F15K9.17 protein (Putative uncharacterized
protein At1g03220) (Putative uncharacterized protein
F15K9.17) OS=Arabidopsis thaliana GN=At1g03220 PE=2 SV=1
Length = 433

Score = 109 bits (273), Expect = 1e-22
Identities = 72/175 (41%), Positives = 89/175 (50%)
Frame = +1

Query: 1 ADSYFIGVKAIAVNEVTLSIDTNLLKIKNDXXXXXXXXXXXXXXVRYTQLESSIYNALAS 180
+ YFIGV AI + E T+ I+ LLKI YT LESSIYNA S
Sbjct: 251 SSEYFIGVTAIQIVEKTVPINPTLLKINASTGIGGTKISSVNP---YTVLESSIYNAFTS 307

Query: 181 HFKTAANARGIKSVTAISPFDTCFDASTASSTRVGYNVPTIDLLLQGSGGVVWSILGANS 360
F A AR IK V ++ PF CF TR+GY VP I+L+L S VVW I GANS
Sbjct: 308 EFVKQAAARSIKRVASVKPFGACFSTKNVGVTRLGYAVPEIELVLH-SKDVVWRIFGANS 366

Query: 361 VVSLDDGKVICLAFQRTREFETRAIVMGTSXXXXXXXXXXXXTSRLGFVSTLLGR 525
+VS+ D VICL F ++V+G +++ GF STLLGR
Sbjct: 367 MVSVSD-DVICLGFVDGGVNARTSVVIGGFQLEDNLIEFDLASNKFGFSSTLLGR 420


>tr|Q9ZVS5|Q9ZVS5_ARATH F15K9.16 protein (Putative uncharacterized
protein At1g03230) OS=Arabidopsis thaliana GN=At1g03230
PE=2 SV=1
Length = 434

Score = 108 bits (270), Expect = 3e-22
Identities = 73/172 (42%), Positives = 86/172 (50%)
Frame = +1

Query: 10 YFIGVKAIAVNEVTLSIDTNLLKIKNDXXXXXXXXXXXXXXVRYTQLESSIYNALASHFK 189
YFIGV AI + E TL ID LLKI YT LESSIY A S F
Sbjct: 255 YFIGVTAIKIVEKTLPIDPTLLKINASTGIGGTKISSVNP---YTVLESSIYKAFTSEFI 311

Query: 190 TAANARGIKSVTAISPFDTCFDASTASSTRVGYNVPTIDLLLQGSGGVVWSILGANSVVS 369
A AR IK V ++ PF CF TR+GY VP I L+L S VVW I GANS+VS
Sbjct: 312 RQAAARSIKRVASVKPFGACFSTKNVGVTRLGYAVPEIQLVLH-SKDVVWRIFGANSMVS 370

Query: 370 LDDGKVICLAFQRTREFETRAIVMGTSXXXXXXXXXXXXTSRLGFVSTLLGR 525
+ D VICL F ++V+G +++ GF STLLGR
Sbjct: 371 VSD-DVICLGFVDGGVNPGASVVIGGFQLEDNLIEFDLASNKFGFSSTLLGR 421


>tr|A7PU90|A7PU90_VITVI Chromosome chr7 scaffold_31, whole genome
shotgun sequence OS=Vitis vinifera GN=GSVIVT00023703001
PE=4 SV=1
Length = 436

Score = 105 bits (263), Expect = 2e-21
Identities = 69/172 (40%), Positives = 93/172 (54%)
Frame = +1

Query: 10 YFIGVKAIAVNEVTLSIDTNLLKIKNDXXXXXXXXXXXXXXVRYTQLESSIYNALASHFK 189
YFI VK+I +NE +S++T+LL I ++ YT +E+SIY A F
Sbjct: 258 YFIRVKSIRINEKAISLNTSLLSIDSEGVGGTKISTVNP----YTVMETSIYKAFTKAFI 313

Query: 190 TAANARGIKSVTAISPFDTCFDASTASSTRVGYNVPTIDLLLQGSGGVVWSILGANSVVS 369
+AA A I V A++PF+ CF + STRVG +VP+IDL+LQ V W I GANS+V
Sbjct: 314 SAAAAINITRVAAVAPFNVCFSSKNVYSTRVGPSVPSIDLVLQNE-SVFWRIFGANSMVY 372

Query: 370 LDDGKVICLAFQRTREFETRAIVMGTSXXXXXXXXXXXXTSRLGFVSTLLGR 525
+ D V+CL F +IV+G TSRLGF S+LL R
Sbjct: 373 VSD-DVLCLGFVDGGANPRTSIVIGGYQLEDNLLQFDLATSRLGFSSSLLFR 423


>tr|A5ARQ0|A5ARQ0_VITVI Putative uncharacterized protein OS=Vitis
vinifera GN=VITISV_038701 PE=4 SV=1
Length = 436

Score = 103 bits (258), Expect = 6e-21
Identities = 68/172 (39%), Positives = 92/172 (53%)
Frame = +1

Query: 10 YFIGVKAIAVNEVTLSIDTNLLKIKNDXXXXXXXXXXXXXXVRYTQLESSIYNALASHFK 189
YFI VK+I +NE +S++T+LL I ++ YT +E+SIY F
Sbjct: 258 YFIRVKSIRINEKAISLNTSLLSIDSEGVGGTKISTVNP----YTVMETSIYKXFTKAFI 313

Query: 190 TAANARGIKSVTAISPFDTCFDASTASSTRVGYNVPTIDLLLQGSGGVVWSILGANSVVS 369
+AA A I V A++PF+ CF + STRVG +VP+IDL+LQ V W I GANS+V
Sbjct: 314 SAAAAINITRVAAVAPFNVCFSSKNVYSTRVGPSVPSIDLVLQNE-SVFWRIFGANSMVY 372

Query: 370 LDDGKVICLAFQRTREFETRAIVMGTSXXXXXXXXXXXXTSRLGFVSTLLGR 525
+ D V+CL F +IV+G TSRLGF S+LL R
Sbjct: 373 VSD-DVLCLGFVDGGANPRTSIVIGGYQLEDNLLQFDLATSRLGFSSSLLFR 423


>tr|Q7XJE7|Q7XJE7_SOLTU Putative xyloglucanase inhibitor OS=Solanum
tuberosum GN=XGIP PE=4 SV=1
Length = 437

Score = 102 bits (253), Expect = 2e-20
Identities = 68/176 (38%), Positives = 93/176 (52%), Gaps = 1/176 (0%)
Frame = +1

Query: 1 ADSYFIGVKAIAVNEVTLSIDTNLLKIKNDXXXXXXXXXXXXXXVRYTQLESSIYNALAS 180
+ YFIGVK+I +N+ + I+T LL I N YT LE+S+YNA+ +
Sbjct: 258 SSEYFIGVKSIKINQKVVPINTTLLSIDNQGVGGTKISTVNP----YTILETSLYNAITN 313

Query: 181 HF-KTAANARGIKSVTAISPFDTCFDASTASSTRVGYNVPTIDLLLQGSGGVVWSILGAN 357
F K AN + V A++PF CFD+ STRVG VP+IDL+LQ VVW+I GAN
Sbjct: 314 FFVKELAN---VTRVAAVAPFKVCFDSRNIGSTRVGPAVPSIDLVLQNE-NVVWTIFGAN 369

Query: 358 SVVSLDDGKVICLAFQRTREFETRAIVMGTSXXXXXXXXXXXXTSRLGFVSTLLGR 525
S+V + + V+CL +IV+G SRLGF S++L R
Sbjct: 370 SMVQVSE-NVLCLGVLDGGVNSRTSIVIGGHTIEDNLLQFDHAASRLGFTSSILFR 424


>tr|Q05929|Q05929_DAUCA EDGP (Fragment) OS=Daucus carota GN=EDGP1
PE=2 SV=1
Length = 433

Score = 101 bits (252), Expect = 3e-20
Identities = 65/171 (38%), Positives = 92/171 (53%)
Frame = +1

Query: 10 YFIGVKAIAVNEVTLSIDTNLLKIKNDXXXXXXXXXXXXXXVRYTQLESSIYNALASHFK 189
YFIGVK+I +N ++++T+LL I + YT LE+SIY A+ F
Sbjct: 257 YFIGVKSIKINSKIVALNTSLLSISSAGLGGTKISTINP----YTVLETSIYKAVTEAFI 312

Query: 190 TAANARGIKSVTAISPFDTCFDASTASSTRVGYNVPTIDLLLQGSGGVVWSILGANSVVS 369
+ AR I V +++PF CF STR+G +VP+IDL+LQ S VVW+I G+NS+V
Sbjct: 313 KESAARNITRVASVAPFGACFSTDNILSTRLGPSVPSIDLVLQ-SESVVWTITGSNSMVY 371

Query: 370 LDDGKVICLAFQRTREFETRAIVMGTSXXXXXXXXXXXXTSRLGFVSTLLG 522
++D V+CL +IV+G TSR+GF TLLG
Sbjct: 372 IND-NVVCLGVVDGGSNLRTSIVIGGHQLEDNLVQFDLATSRVGFSGTLLG 421


>tr|A5BL34|A5BL34_VITVI Putative uncharacterized protein OS=Vitis
vinifera GN=VITISV_011733 PE=4 SV=1
Length = 415

Score = 100 bits (250), Expect = 5e-20
Identities = 66/170 (38%), Positives = 90/170 (52%)
Frame = +1

Query: 10 YFIGVKAIAVNEVTLSIDTNLLKIKNDXXXXXXXXXXXXXXVRYTQLESSIYNALASHFK 189
YFIGVK+I +NE + ++T+LL I + YT +E+SIY+A F
Sbjct: 238 YFIGVKSIQINEKAVPLNTSLLSINSKGVGGTKISTVNP----YTVMETSIYSAFTKAFI 293

Query: 190 TAANARGIKSVTAISPFDTCFDASTASSTRVGYNVPTIDLLLQGSGGVVWSILGANSVVS 369
+AA + I V A++PF CF + STR G VPTI L+LQ + VVW I GANS+V
Sbjct: 294 SAAASMNITRVAAVAPFSVCFSSKNVYSTRGGAAVPTIGLVLQ-NNSVVWRIFGANSMVF 352

Query: 370 LDDGKVICLAFQRTREFETRAIVMGTSXXXXXXXXXXXXTSRLGFVSTLL 519
+ +G V+CL F +IV+G SRLGF S+LL
Sbjct: 353 V-NGDVLCLGFVDGGANPRTSIVIGGYQLEDNLLQFDLAASRLGFSSSLL 401


>tr|Q8GT67|Q8GT67_SOLLC Xyloglucan-specific fungal endoglucanase
inhibitor protein OS=Solanum lycopersicum GN=Xegip PE=2
SV=1
Length = 438

Score = 99.8 bits (247), Expect = 1e-19
Identities = 67/176 (38%), Positives = 93/176 (52%), Gaps = 1/176 (0%)
Frame = +1

Query: 1 ADSYFIGVKAIAVNEVTLSIDTNLLKIKNDXXXXXXXXXXXXXXVRYTQLESSIYNALAS 180
+ YFIGVK+I +N+ + I+T LL I N YT LE+S+YNA+ +
Sbjct: 259 SSEYFIGVKSIKINQKVVPINTTLLSIDNQGVGGTKISTVNP----YTILETSLYNAITN 314

Query: 181 HF-KTAANARGIKSVTAISPFDTCFDASTASSTRVGYNVPTIDLLLQGSGGVVWSILGAN 357
F K AN + V ++PF CFD+ STRVG VP+IDL+LQ + VVW+I GAN
Sbjct: 315 FFVKELAN---VTRVAVVAPFRVCFDSRDIGSTRVGPAVPSIDLVLQ-NANVVWTIFGAN 370

Query: 358 SVVSLDDGKVICLAFQRTREFETRAIVMGTSXXXXXXXXXXXXTSRLGFVSTLLGR 525
S+V + + V+CL +IV+G SRLGF S++L R
Sbjct: 371 SMVQVSE-NVLCLGVLDGGVNARTSIVIGGHTIEDNLLQFDHAASRLGFTSSILFR 425