DK949072
Clone id TST38A01NGRL0005_A05
Library
Length 682
Definition Adiantum capillus-veneris mRNA. clone: TST38A01NGRL0005_A05. 5' end sequence.
Accession
Tissue type prothallia
Developmental stage gametophyte
Contig ID
Sequence
ATATCGTGAAGGAGTTCAAGGAATGGCGATGGCATCCGCTGCCTTATCCTCACCTGCTTC
GTCGTCTGCCCTTGCAGCGACTGCAGTCACATCTACTAACAGTTTGGCAACAACAGTCTC
TTCCTCGTCGATATCATCGCTTCTTCCACCAACGGCCCTGCGTGTCGGATCCTCTACTCT
CATTCTTTCTGGTAAGCACACGTCCTCCTCTGTCAGTTTTAGCTCATCTCGTAGAACAAA
ATGTACCCCAGCCATGGCGGTAGCCCTCCCTGTGCTGACATTCGAGGGGAAGGCCTCCGG
CACAGAAGTGGAATTGGACTTGAAGTGTGCTCGACCAGAGACAGCGCGTGCTGTGGTGCA
CAGAGGTTTGATAACGGAGCTACAAAACAAGAGGAGGGGGACTGCTTCGACTCTGACGAG
AGGGGAGGTGAGGGGAGGAGGAAGGAAGCCATATAAACAAAAGAAGACTGGGCGTGCAAG
GCGTGGATCTCAGAGGACTCCTCTACGGCCAGGAGGAGGTGTTATCTTTGGTCCAAAGCC
CAGGGATTGGACCATTAAGATAAATCGCAAGGAGAAGCGGCTTGCCATCAGCACGGCACT
TCAGCATGCTACTGGTAGTTTTATTGTCGTTGAAGATTTTGAGGACTCTATTGAACCTAA
AACCAAAGCCTTTCTTGCTGCC
■■Homology search results ■■ -
sp_hit_id O49937
Definition sp|O49937|RK4_SPIOL 50S ribosomal protein L4, chloroplastic OS=Spinacia oleracea
Align length 142
Score (bit) 202.0
E-value 2.0e-51
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= DK949072|Adiantum capillus-veneris mRNA, clone:
TST38A01NGRL0005_A05, 5'
(682 letters)

Database: uniprot_sprot.fasta
412,525 sequences; 148,809,765 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

sp|O49937|RK4_SPIOL 50S ribosomal protein L4, chloroplastic OS=S... 202 2e-51
sp|O50061|RK4_ARATH 50S ribosomal protein L4, chloroplastic OS=A... 197 4e-50
sp|O80361|RK4_TOBAC 50S ribosomal protein L4, chloroplastic OS=N... 191 4e-48
sp|Q7UZU8|RL4_PROMP 50S ribosomal protein L4 OS=Prochlorococcus ... 157 4e-38
sp|Q318I5|RL4_PROM9 50S ribosomal protein L4 OS=Prochlorococcus ... 155 2e-37
sp|Q8DMN0|RL4_THEEB 50S ribosomal protein L4 OS=Thermosynechococ... 154 3e-37
sp|A2BTD6|RL4_PROMS 50S ribosomal protein L4 OS=Prochlorococcus ... 154 3e-37
sp|A3PF46|RL4_PROM0 50S ribosomal protein L4 OS=Prochlorococcus ... 154 3e-37
sp|A8G761|RL4_PROM2 50S ribosomal protein L4 OS=Prochlorococcus ... 154 4e-37
sp|A2BYT5|RL4_PROM5 50S ribosomal protein L4 OS=Prochlorococcus ... 152 1e-36
sp|Q7U4J9|RL4_SYNPX 50S ribosomal protein L4 OS=Synechococcus sp... 149 1e-35
sp|A5GIU4|RL4_SYNPW 50S ribosomal protein L4 OS=Synechococcus sp... 149 1e-35
sp|B0JI02|RL4_MICAN 50S ribosomal protein L4 OS=Microcystis aeru... 149 1e-35
sp|Q46IR0|RL4_PROMT 50S ribosomal protein L4 OS=Prochlorococcus ... 149 1e-35
sp|Q7V9W3|RL4_PROMA 50S ribosomal protein L4 OS=Prochlorococcus ... 147 4e-35
sp|A2CC28|RL4_PROM3 50S ribosomal protein L4 OS=Prochlorococcus ... 147 5e-35
sp|Q3AMN1|RL4_SYNSC 50S ribosomal protein L4 OS=Synechococcus sp... 147 7e-35
sp|Q0ID06|RL4_SYNS3 50S ribosomal protein L4 OS=Synechococcus sp... 147 7e-35
sp|B0C1D4|RL4_ACAM1 50S ribosomal protein L4 OS=Acaryochloris ma... 147 7e-35
sp|Q3AUW2|RL4_SYNS9 50S ribosomal protein L4 OS=Synechococcus sp... 145 1e-34
sp|Q7V541|RL4_PROMM 50S ribosomal protein L4 OS=Prochlorococcus ... 145 2e-34
sp|Q110A8|RL4_TRIEI 50S ribosomal protein L4 OS=Trichodesmium er... 145 3e-34
sp|O24690|RL4_SYNP6 50S ribosomal protein L4 OS=Synechococcus sp... 145 3e-34
sp|Q31L08|RL4_SYNE7 50S ribosomal protein L4 OS=Synechococcus el... 145 3e-34
sp|Q7NPG9|RL4_GLOVI 50S ribosomal protein L4 OS=Gloeobacter viol... 145 3e-34
sp|Q3MFC0|RL4_ANAVT 50S ribosomal protein L4 OS=Anabaena variabi... 140 5e-33
sp|Q8YPI0|RL4_ANASP 50S ribosomal protein L4 OS=Anabaena sp. (st... 139 1e-32
sp|P73319|RL4_SYNY3 50S ribosomal protein L4 OS=Synechocystis sp... 137 5e-32
sp|Q2JV82|RL4_SYNJA 50S ribosomal protein L4 OS=Synechococcus sp... 135 2e-31
sp|Q2JIM6|RL4_SYNJB 50S ribosomal protein L4 OS=Synechococcus sp... 135 3e-31

>sp|O49937|RK4_SPIOL 50S ribosomal protein L4, chloroplastic
OS=Spinacia oleracea GN=RPL4 PE=1 SV=1
Length = 293

Score = 202 bits (513), Expect = 2e-51
Identities = 103/142 (72%), Positives = 118/142 (83%), Gaps = 1/142 (0%)
Frame = +2

Query: 260 VALPVLTFEGKASGTEVELDLKCARPETARAVVHRGLITELQNKRRGTASTLTRGEVRGG 439
+ LP+L F G+ G E L+LK A PE ARAVVHRGLIT LQNKRRGTASTLTR EVRGG
Sbjct: 53 IPLPILNFSGEKVG-ETFLNLKTAPPEKARAVVHRGLITHLQNKRRGTASTLTRAEVRGG 111

Query: 440 GRKPYKQKKTGRARRGSQRTPLRPGGGVIFGPKPRDWTIKINRKEKRLAISTALQHATGS 619
GRKPY QKKTGRARRGSQ +PLRPGGGVIFGPKPRDWTIK+N+KE+RLA+STA+ A G+
Sbjct: 112 GRKPYPQKKTGRARRGSQGSPLRPGGGVIFGPKPRDWTIKMNKKERRLALSTAIASAVGN 171

Query: 620 FIVVEDFEDSIE-PKTKAFLAA 682
VVE+F ++ E PKTK F+AA
Sbjct: 172 SFVVEEFAENFEKPKTKDFIAA 193


>sp|O50061|RK4_ARATH 50S ribosomal protein L4, chloroplastic
OS=Arabidopsis thaliana GN=RPL4 PE=2 SV=2
Length = 282

Score = 197 bits (501), Expect = 4e-50
Identities = 103/143 (72%), Positives = 117/143 (81%), Gaps = 4/143 (2%)
Frame = +2

Query: 266 LPVLTFEGKASGTEVELDLKCARPETARAVVHRGLITELQNKRRGTASTLTRGEVRGGGR 445
LP+L+FEG+ G E LDLK A +TARAVVHR ++T+L NKRRGTASTLTRGEVRGGG
Sbjct: 54 LPILSFEGEKVG-ETYLDLKAAPEDTARAVVHRAIVTDLNNKRRGTASTLTRGEVRGGGI 112

Query: 446 KPYKQKKTGRARRGSQRTPLRPGGGVIFGPKPRDWTIKINRKEKRLAISTALQHAT---G 616
KPY QKKTG ARRGSQRTPLRPGGGV+FGP+P+DW+IKINRKEK+LAISTAL A G
Sbjct: 113 KPYSQKKTGHARRGSQRTPLRPGGGVVFGPRPKDWSIKINRKEKKLAISTALSSAASAEG 172

Query: 617 SFIVVEDFEDSIE-PKTKAFLAA 682
IVVE+F + E PKTK FLAA
Sbjct: 173 GAIVVEEFGEKFEKPKTKDFLAA 195


>sp|O80361|RK4_TOBAC 50S ribosomal protein L4, chloroplastic
OS=Nicotiana tabacum GN=RPL4 PE=2 SV=1
Length = 282

Score = 191 bits (484), Expect = 4e-48
Identities = 96/138 (69%), Positives = 115/138 (83%), Gaps = 1/138 (0%)
Frame = +2

Query: 266 LPVLTFEGKASGTEVELDLKCARPETARAVVHRGLITELQNKRRGTASTLTRGEVRGGGR 445
+P+L+F+G G+ L+LK A +TARAVVHRGL T+L+N+RRGTASTLTR EVRGGG
Sbjct: 48 IPILSFDGAEVGSTT-LNLKSAPLDTARAVVHRGLTTDLRNQRRGTASTLTRSEVRGGGI 106

Query: 446 KPYKQKKTGRARRGSQRTPLRPGGGVIFGPKPRDWTIKINRKEKRLAISTALQHATGSFI 625
KPY QKKTGRARRGS RTPLRPGGGV+FGPKP+DW++KIN+KEKRLAISTAL A+ + I
Sbjct: 107 KPYPQKKTGRARRGSNRTPLRPGGGVVFGPKPKDWSVKINKKEKRLAISTALSSASENTI 166

Query: 626 VVEDFEDSIE-PKTKAFL 676
VVE+F D E PKTK F+
Sbjct: 167 VVEEFNDKFEKPKTKEFI 184


>sp|Q7UZU8|RL4_PROMP 50S ribosomal protein L4 OS=Prochlorococcus
marinus subsp. pastoris (strain CCMP1378 / MED4) GN=rplD
PE=3 SV=1
Length = 210

Score = 157 bits (398), Expect = 4e-38
Identities = 79/138 (57%), Positives = 103/138 (74%), Gaps = 1/138 (0%)
Frame = +2

Query: 266 LPVLTFEGKASGTEVELDLKCARPETARAVVHRGLITELQNKRRGTASTLTRGEVRGGGR 445
L L ++GK +G +V +DLK A+ ++ ++HR ++ +L NKR+GTASTLTR EVRGGGR
Sbjct: 4 LETLKWDGKKAG-KVSIDLKVAKETSSADLIHRAVLRQLANKRQGTASTLTRSEVRGGGR 62

Query: 446 KPYKQKKTGRARRGSQRTPLRPGGGVIFGPKPRDWTIKINRKEKRLAISTALQHATGSFI 625
KPYKQK TGRAR+GS RTPLRPGGGVIFGPKPR + + +NRKE+RLA+ TAL F
Sbjct: 63 KPYKQKGTGRARQGSIRTPLRPGGGVIFGPKPRSYNLDMNRKERRLALRTALMSRISDFK 122

Query: 626 VVEDFEDSI-EPKTKAFL 676
VEDF ++ +PKT +
Sbjct: 123 TVEDFGSTLDQPKTSEII 140


>sp|Q318I5|RL4_PROM9 50S ribosomal protein L4 OS=Prochlorococcus
marinus (strain MIT 9312) GN=rplD PE=3 SV=1
Length = 210

Score = 155 bits (391), Expect = 2e-37
Identities = 78/134 (58%), Positives = 101/134 (75%), Gaps = 1/134 (0%)
Frame = +2

Query: 266 LPVLTFEGKASGTEVELDLKCARPETARAVVHRGLITELQNKRRGTASTLTRGEVRGGGR 445
+ L ++GK SG EV+LDL A+ ++ ++HR ++ +L NKR+GTASTLTR EVRGGGR
Sbjct: 4 IETLKWDGKKSG-EVKLDLTVAKETSSADLIHRAVLRQLANKRQGTASTLTRSEVRGGGR 62

Query: 446 KPYKQKKTGRARRGSQRTPLRPGGGVIFGPKPRDWTIKINRKEKRLAISTALQHATGSFI 625
KPYKQK TGRAR+GS RTPLRPGGG+IFGPKPR + + +NRKE+RLA+ TAL
Sbjct: 63 KPYKQKGTGRARQGSIRTPLRPGGGIIFGPKPRSYNLDMNRKERRLALRTALMSRISDVK 122

Query: 626 VVEDFEDSI-EPKT 664
VEDF ++ +PKT
Sbjct: 123 AVEDFGSTLKQPKT 136


>sp|Q8DMN0|RL4_THEEB 50S ribosomal protein L4 OS=Thermosynechococcus
elongatus (strain BP-1) GN=rplD PE=3 SV=1
Length = 210

Score = 154 bits (390), Expect = 3e-37
Identities = 83/142 (58%), Positives = 101/142 (71%), Gaps = 1/142 (0%)
Frame = +2

Query: 260 VALPVLTFEGKASGTEVELDLKCARPETARAVVHRGLITELQNKRRGTASTLTRGEVRGG 439
VA V ++G SG E LDL A+PETA +VHR L+ +L N R+GT ST TR EVRGG
Sbjct: 2 VACVVKDWQGADSG-EATLDLATAKPETASHIVHRALVRQLANARQGTVSTKTRAEVRGG 60

Query: 440 GRKPYKQKKTGRARRGSQRTPLRPGGGVIFGPKPRDWTIKINRKEKRLAISTALQHATGS 619
GRKP++QK TGRAR GS R+PL GGGVIFGPKPRD++ K+NRKE+RLA+ TAL
Sbjct: 61 GRKPWRQKGTGRARAGSIRSPLWRGGGVIFGPKPRDYSQKMNRKERRLALRTALMSRVED 120

Query: 620 FIVVEDFEDSI-EPKTKAFLAA 682
IVV+DF D + PKTK + A
Sbjct: 121 LIVVQDFADHLPRPKTKELVTA 142


>sp|A2BTD6|RL4_PROMS 50S ribosomal protein L4 OS=Prochlorococcus
marinus (strain AS9601) GN=rplD PE=3 SV=1
Length = 210

Score = 154 bits (390), Expect = 3e-37
Identities = 78/134 (58%), Positives = 100/134 (74%), Gaps = 1/134 (0%)
Frame = +2

Query: 266 LPVLTFEGKASGTEVELDLKCARPETARAVVHRGLITELQNKRRGTASTLTRGEVRGGGR 445
L L ++GK SG +V LDL A+ ++ ++HR ++ +L NKR+GTASTLTR EVRGGGR
Sbjct: 4 LETLKWDGKKSG-KVSLDLAVAKETSSADLIHRAVLRQLANKRQGTASTLTRSEVRGGGR 62

Query: 446 KPYKQKKTGRARRGSQRTPLRPGGGVIFGPKPRDWTIKINRKEKRLAISTALQHATGSFI 625
KPYKQK TGRAR+GS RTPLRPGGG+IFGPKPR + + +NRKE+RLA+ TAL
Sbjct: 63 KPYKQKGTGRARQGSIRTPLRPGGGIIFGPKPRSYNLDMNRKERRLALRTALMSRVSDMK 122

Query: 626 VVEDFEDSI-EPKT 664
VEDF ++ +PKT
Sbjct: 123 AVEDFGSTLKQPKT 136


>sp|A3PF46|RL4_PROM0 50S ribosomal protein L4 OS=Prochlorococcus
marinus (strain MIT 9301) GN=rplD PE=3 SV=1
Length = 210

Score = 154 bits (390), Expect = 3e-37
Identities = 78/134 (58%), Positives = 100/134 (74%), Gaps = 1/134 (0%)
Frame = +2

Query: 266 LPVLTFEGKASGTEVELDLKCARPETARAVVHRGLITELQNKRRGTASTLTRGEVRGGGR 445
L L ++GK SG +V LDL A+ ++ ++HR ++ +L NKR+GTASTLTR EVRGGGR
Sbjct: 4 LETLKWDGKKSG-KVSLDLAVAKKTSSADLIHRAVLRQLANKRQGTASTLTRSEVRGGGR 62

Query: 446 KPYKQKKTGRARRGSQRTPLRPGGGVIFGPKPRDWTIKINRKEKRLAISTALQHATGSFI 625
KPYKQK TGRAR+GS RTPLRPGGG+IFGPKPR + + +NRKE+RLA+ TAL
Sbjct: 63 KPYKQKGTGRARQGSIRTPLRPGGGIIFGPKPRSYNLDMNRKERRLALRTALMSRVSDIK 122

Query: 626 VVEDFEDSI-EPKT 664
VEDF ++ +PKT
Sbjct: 123 AVEDFGSTLKQPKT 136


>sp|A8G761|RL4_PROM2 50S ribosomal protein L4 OS=Prochlorococcus
marinus (strain MIT 9215) GN=rplD PE=3 SV=1
Length = 210

Score = 154 bits (389), Expect = 4e-37
Identities = 78/134 (58%), Positives = 100/134 (74%), Gaps = 1/134 (0%)
Frame = +2

Query: 266 LPVLTFEGKASGTEVELDLKCARPETARAVVHRGLITELQNKRRGTASTLTRGEVRGGGR 445
L L ++GK SG +V LDL A+ ++ ++HR ++ +L NKR+GTASTLTR EVRGGGR
Sbjct: 4 LETLKWDGKKSG-KVTLDLTVAKETSSADLIHRAVLRQLANKRQGTASTLTRSEVRGGGR 62

Query: 446 KPYKQKKTGRARRGSQRTPLRPGGGVIFGPKPRDWTIKINRKEKRLAISTALQHATGSFI 625
KPYKQK TGRAR+GS RTPLRPGGG+IFGPKPR + + +NRKE+RLA+ TAL
Sbjct: 63 KPYKQKGTGRARQGSIRTPLRPGGGIIFGPKPRSYNLDMNRKERRLALRTALMSRVSDMK 122

Query: 626 VVEDFEDSI-EPKT 664
VEDF ++ +PKT
Sbjct: 123 AVEDFGSTLKQPKT 136


>sp|A2BYT5|RL4_PROM5 50S ribosomal protein L4 OS=Prochlorococcus
marinus (strain MIT 9515) GN=rplD PE=3 SV=1
Length = 210

Score = 152 bits (385), Expect = 1e-36
Identities = 77/138 (55%), Positives = 101/138 (73%), Gaps = 1/138 (0%)
Frame = +2

Query: 266 LPVLTFEGKASGTEVELDLKCARPETARAVVHRGLITELQNKRRGTASTLTRGEVRGGGR 445
L L ++GK G +V +DLK A+ ++ ++HR ++ +L N+R+GTASTLTR EVRGGGR
Sbjct: 4 LETLKWDGKKVG-KVSIDLKVAKETSSSDLIHRAVLRQLANQRQGTASTLTRSEVRGGGR 62

Query: 446 KPYKQKKTGRARRGSQRTPLRPGGGVIFGPKPRDWTIKINRKEKRLAISTALQHATGSFI 625
KPYKQK TGRAR+GS RTPLRPGGGVIFGPKPR + + +NRKE+RLA+ TAL
Sbjct: 63 KPYKQKGTGRARQGSIRTPLRPGGGVIFGPKPRSYNLDMNRKERRLALRTALMSRVDDIK 122

Query: 626 VVEDFEDSI-EPKTKAFL 676
VEDF ++ +PKT +
Sbjct: 123 AVEDFGSTLNQPKTSEII 140


tr_hit_id A9NU11
Definition tr|A9NU11|A9NU11_PICSI Putative uncharacterized protein OS=Picea sitchensis
Align length 151
Score (bit) 228.0
E-value 4.0e-58
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= DK949072|Adiantum capillus-veneris mRNA, clone:
TST38A01NGRL0005_A05, 5'
(682 letters)

Database: uniprot_trembl.fasta
7,341,751 sequences; 2,391,615,440 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

tr|A9NU11|A9NU11_PICSI Putative uncharacterized protein OS=Picea... 228 4e-58
tr|A9SXT3|A9SXT3_PHYPA Predicted protein (Fragment) OS=Physcomit... 221 3e-56
tr|A9TAZ7|A9TAZ7_PHYPA Predicted protein (Fragment) OS=Physcomit... 220 7e-56
tr|A7NYK1|A7NYK1_VITVI Chromosome chr6 scaffold_3, whole genome ... 209 2e-52
tr|A5B3D4|A5B3D4_VITVI Putative uncharacterized protein OS=Vitis... 209 2e-52
tr|B6TG27|B6TG27_MAIZE 50S ribosomal protein L4 OS=Zea mays PE=2... 204 4e-51
tr|B4G0S8|B4G0S8_MAIZE Putative uncharacterized protein OS=Zea m... 204 4e-51
tr|Q84QA8|Q84QA8_ORYSJ Putative uncharacterized protein OJ1012B0... 200 8e-50
tr|Q10NM5|Q10NM5_ORYSJ Os03g0265400 protein OS=Oryza sativa subs... 200 8e-50
tr|B8AKQ8|B8AKQ8_ORYSI Putative uncharacterized protein OS=Oryza... 200 8e-50
tr|A3AGC5|A3AGC5_ORYSJ Putative uncharacterized protein OS=Oryza... 199 2e-49
tr|Q3EDH2|Q3EDH2_ARATH Uncharacterized protein At1g07320.2 OS=Ar... 197 5e-49
tr|Q2V4Q3|Q2V4Q3_ARATH Uncharacterized protein At1g07320.4 (Unch... 197 5e-49
tr|Q0WW46|Q0WW46_ARATH Putative uncharacterized protein At1g0732... 197 5e-49
tr|A4S817|A4S817_OSTLU Plastid ribosomal protein L4 large riboso... 166 2e-39
tr|Q7XYP3|Q7XYP3_BIGNA Ribosomal protein rpL4 (Fragment) OS=Bige... 163 8e-39
tr|A3YUL8|A3YUL8_9SYNE 50S ribosomal protein L4 OS=Synechococcus... 159 1e-37
tr|A5GVW1|A5GVW1_SYNR3 50S ribosomal protein L4 OS=Synechococcus... 155 2e-36
tr|Q84U22|Q84U22_CHLRE Ribosomal protein L4 (Plastid ribosomal p... 151 4e-35
tr|B8HMQ5|B8HMQ5_9CHRO Ribosomal protein L4/L1e OS=Cyanothece sp... 150 6e-35
tr|A9BCP6|A9BCP6_PROM4 50S ribosomal protein L4 OS=Prochlorococc... 150 7e-35
tr|A2C4Z8|A2C4Z8_PROM1 50S ribosomal protein L4 OS=Prochlorococc... 150 1e-34
tr|B4WHE7|B4WHE7_9SYNE Ribosomal protein L4/L1 family OS=Synecho... 150 1e-34
tr|A8YFZ9|A8YFZ9_MICAE RplD protein OS=Microcystis aeruginosa PC... 149 1e-34
tr|B5IPQ4|B5IPQ4_9CHRO Ribosomal protein L4/L1 family OS=Cyanobi... 149 2e-34
tr|B4VPK7|B4VPK7_9CYAN Ribosomal protein L4/L1 family OS=Microco... 149 2e-34
tr|Q05QB4|Q05QB4_9SYNE 50S ribosomal protein L4 OS=Synechococcus... 148 3e-34
tr|A4CSL6|A4CSL6_SYNPV 50S ribosomal protein L4 OS=Synechococcus... 148 3e-34
tr|A3Z8Y0|A3Z8Y0_9SYNE 50S ribosomal protein L4 OS=Synechococcus... 147 5e-34
tr|Q05ZG0|Q05ZG0_9SYNE 50S ribosomal protein L4 OS=Synechococcus... 147 6e-34

>tr|A9NU11|A9NU11_PICSI Putative uncharacterized protein OS=Picea
sitchensis PE=2 SV=1
Length = 312

Score = 228 bits (580), Expect = 4e-58
Identities = 116/151 (76%), Positives = 129/151 (85%), Gaps = 1/151 (0%)
Frame = +2

Query: 233 RTKCTPAMAVALPVLTFEGKASGTEVELDLKCARPETARAVVHRGLITELQNKRRGTAST 412
RT A AV LPVLTF+G+ +G E LDLKCARP+TARAVVHRG+ITELQN+RRGTAST
Sbjct: 46 RTLSVRAQAVTLPVLTFDGERAG-EASLDLKCARPDTARAVVHRGVITELQNRRRGTAST 104

Query: 413 LTRGEVRGGGRKPYKQKKTGRARRGSQRTPLRPGGGVIFGPKPRDWTIKINRKEKRLAIS 592
LTR EVRGGGRKPY+QK TGRARRGSQRTPLRPGGGVIFGPKP+DW+IK+N+KEKRLAIS
Sbjct: 105 LTRAEVRGGGRKPYRQKGTGRARRGSQRTPLRPGGGVIFGPKPKDWSIKMNKKEKRLAIS 164

Query: 593 TALQHATGSFIVVEDFEDSIE-PKTKAFLAA 682
TAL AT S +VVEDF D E PKTK F+ A
Sbjct: 165 TALMSATVSTVVVEDFNDKFERPKTKEFIEA 195


>tr|A9SXT3|A9SXT3_PHYPA Predicted protein (Fragment)
OS=Physcomitrella patens subsp. patens
GN=PHYPADRAFT_17327 PE=4 SV=1
Length = 235

Score = 221 bits (563), Expect = 3e-56
Identities = 111/145 (76%), Positives = 130/145 (89%), Gaps = 1/145 (0%)
Frame = +2

Query: 251 AMAVALPVLTFEGKASGTEVELDLKCARPETARAVVHRGLITELQNKRRGTASTLTRGEV 430
AMAV LP+LTFEG+A+G EVE+DL+ ARPETA+AVVHRG+I E+QN+RRGTASTLTR EV
Sbjct: 8 AMAVTLPMLTFEGEAAG-EVEMDLRTARPETAKAVVHRGVICEMQNRRRGTASTLTRSEV 66

Query: 431 RGGGRKPYKQKKTGRARRGSQRTPLRPGGGVIFGPKPRDWTIKINRKEKRLAISTALQHA 610
RGGGRKPYKQK TGRAR+GS RTPLRPGGGV+FGPKP+DW+IKIN+KEKRLAISTALQ A
Sbjct: 67 RGGGRKPYKQKGTGRARQGSIRTPLRPGGGVVFGPKPKDWSIKINKKEKRLAISTALQSA 126

Query: 611 TGSFIVVEDFEDSI-EPKTKAFLAA 682
+ + +VVEDFED PKTK F++A
Sbjct: 127 SVNTVVVEDFEDKFTTPKTKEFISA 151


>tr|A9TAZ7|A9TAZ7_PHYPA Predicted protein (Fragment)
OS=Physcomitrella patens subsp. patens
GN=PHYPADRAFT_17333 PE=4 SV=1
Length = 230

Score = 220 bits (560), Expect = 7e-56
Identities = 111/145 (76%), Positives = 129/145 (88%), Gaps = 1/145 (0%)
Frame = +2

Query: 251 AMAVALPVLTFEGKASGTEVELDLKCARPETARAVVHRGLITELQNKRRGTASTLTRGEV 430
AMAVALP LTFEG+A+G EVE+DL+ ARPETA+AVVHRG+I E+QN+RRGTASTLTR EV
Sbjct: 3 AMAVALPKLTFEGEAAG-EVEMDLRTARPETAKAVVHRGVICEMQNRRRGTASTLTRSEV 61

Query: 431 RGGGRKPYKQKKTGRARRGSQRTPLRPGGGVIFGPKPRDWTIKINRKEKRLAISTALQHA 610
RGGGRKPYKQK TGRAR+GS RTPLRPGGGV+FGPKP+DW+IKIN+KEKRLAISTALQ A
Sbjct: 62 RGGGRKPYKQKGTGRARQGSIRTPLRPGGGVVFGPKPKDWSIKINKKEKRLAISTALQSA 121

Query: 611 TGSFIVVEDFEDSIE-PKTKAFLAA 682
+ +VVEDFE+ PKTK F++A
Sbjct: 122 GANTVVVEDFEEKFSTPKTKDFMSA 146


>tr|A7NYK1|A7NYK1_VITVI Chromosome chr6 scaffold_3, whole genome
shotgun sequence OS=Vitis vinifera GN=GSVIVT00024151001
PE=4 SV=1
Length = 278

Score = 209 bits (531), Expect = 2e-52
Identities = 105/142 (73%), Positives = 123/142 (86%), Gaps = 1/142 (0%)
Frame = +2

Query: 260 VALPVLTFEGKASGTEVELDLKCARPETARAVVHRGLITELQNKRRGTASTLTRGEVRGG 439
VA+P+L+F G+ G E +L+LK A +TARAVVHRG+IT+LQN+RRGTASTLTRGEVRGG
Sbjct: 51 VAIPILSFTGEKVG-ETQLNLKSAPLDTARAVVHRGIITDLQNRRRGTASTLTRGEVRGG 109

Query: 440 GRKPYKQKKTGRARRGSQRTPLRPGGGVIFGPKPRDWTIKINRKEKRLAISTALQHATGS 619
G+KPY QKKTGRARRGSQRTPLRPGGGV+FGPKPRDW+IKINRKEKRLAISTA+ A +
Sbjct: 110 GKKPYPQKKTGRARRGSQRTPLRPGGGVVFGPKPRDWSIKINRKEKRLAISTAMSSAAVN 169

Query: 620 FIVVEDFEDSIE-PKTKAFLAA 682
IVVEDF D + PKTK F++A
Sbjct: 170 TIVVEDFSDKFDKPKTKEFISA 191


>tr|A5B3D4|A5B3D4_VITVI Putative uncharacterized protein OS=Vitis
vinifera GN=VITISV_028922 PE=4 SV=1
Length = 306

Score = 209 bits (531), Expect = 2e-52
Identities = 105/142 (73%), Positives = 123/142 (86%), Gaps = 1/142 (0%)
Frame = +2

Query: 260 VALPVLTFEGKASGTEVELDLKCARPETARAVVHRGLITELQNKRRGTASTLTRGEVRGG 439
VA+P+L+F G+ G E +L+LK A +TARAVVHRG+IT+LQN+RRGTASTLTRGEVRGG
Sbjct: 51 VAIPILSFTGEKVG-ETQLNLKSAPLDTARAVVHRGIITDLQNRRRGTASTLTRGEVRGG 109

Query: 440 GRKPYKQKKTGRARRGSQRTPLRPGGGVIFGPKPRDWTIKINRKEKRLAISTALQHATGS 619
G+KPY QKKTGRARRGSQRTPLRPGGGV+FGPKPRDW+IKINRKEKRLAISTA+ A +
Sbjct: 110 GKKPYPQKKTGRARRGSQRTPLRPGGGVVFGPKPRDWSIKINRKEKRLAISTAMSSAAVN 169

Query: 620 FIVVEDFEDSIE-PKTKAFLAA 682
IVVEDF D + PKTK F++A
Sbjct: 170 TIVVEDFSDKFDKPKTKEFISA 191


>tr|B6TG27|B6TG27_MAIZE 50S ribosomal protein L4 OS=Zea mays PE=2
SV=1
Length = 314

Score = 204 bits (519), Expect = 4e-51
Identities = 106/146 (72%), Positives = 120/146 (82%), Gaps = 2/146 (1%)
Frame = +2

Query: 251 AMAVALPVLTFEGKASGTEVELDLKCARPETARAVVHRGLITELQNKRRGTASTLTRGEV 430
A A LPVL+F G+ G EV LDLK A P TARAVVHR +IT+ QN RRGTASTLTRGEV
Sbjct: 57 AEAATLPVLSFTGEKVG-EVTLDLKSAPPSTARAVVHRAIITDRQNARRGTASTLTRGEV 115

Query: 431 RGGGRKPYKQKKTGRARRGSQRTPLRPGGGVIFGPKPRDWTIKINRKEKRLAISTALQHA 610
RGGGRKPY+QKKTG+ARRGSQRTPLRPGGGV+FGPKPRDW+IKINRKEKRLAISTA+ A
Sbjct: 116 RGGGRKPYQQKKTGKARRGSQRTPLRPGGGVVFGPKPRDWSIKINRKEKRLAISTAIVSA 175

Query: 611 TGSFIVVEDFEDSIE--PKTKAFLAA 682
VVE+FE++ PKT+ F+AA
Sbjct: 176 AKDAFVVEEFEEAFASGPKTRDFVAA 201


>tr|B4G0S8|B4G0S8_MAIZE Putative uncharacterized protein OS=Zea mays
PE=2 SV=1
Length = 314

Score = 204 bits (519), Expect = 4e-51
Identities = 106/146 (72%), Positives = 120/146 (82%), Gaps = 2/146 (1%)
Frame = +2

Query: 251 AMAVALPVLTFEGKASGTEVELDLKCARPETARAVVHRGLITELQNKRRGTASTLTRGEV 430
A A LPVL+F G+ G EV LDLK A P TARAVVHR +IT+ QN RRGTASTLTRGEV
Sbjct: 57 AEAATLPVLSFTGEKVG-EVTLDLKSAPPSTARAVVHRAIITDRQNARRGTASTLTRGEV 115

Query: 431 RGGGRKPYKQKKTGRARRGSQRTPLRPGGGVIFGPKPRDWTIKINRKEKRLAISTALQHA 610
RGGGRKPY+QKKTG+ARRGSQRTPLRPGGGV+FGPKPRDW+IKINRKEKRLAISTA+ A
Sbjct: 116 RGGGRKPYQQKKTGKARRGSQRTPLRPGGGVVFGPKPRDWSIKINRKEKRLAISTAIVSA 175

Query: 611 TGSFIVVEDFEDSIE--PKTKAFLAA 682
VVE+FE++ PKT+ F+AA
Sbjct: 176 AKDAFVVEEFEEAFASGPKTRDFVAA 201


>tr|Q84QA8|Q84QA8_ORYSJ Putative uncharacterized protein
OJ1012B02.13 OS=Oryza sativa subsp. japonica
GN=OJ1012B02.13 PE=4 SV=1
Length = 426

Score = 200 bits (508), Expect = 8e-50
Identities = 107/148 (72%), Positives = 119/148 (80%), Gaps = 4/148 (2%)
Frame = +2

Query: 251 AMAVALPVLTFEGKASGTEVELDLKCARPETARAVVHRGLITELQNKRRGTASTLTRGEV 430
A A LPVL+F G+ G EV LDLK A P TARAVVHR +IT+ QNKRRGTASTLTRGEV
Sbjct: 62 AEAATLPVLSFTGEKVG-EVALDLKSAPPSTARAVVHRAIITDRQNKRRGTASTLTRGEV 120

Query: 431 RGGGRKPYKQKKTGRARRGSQRTPLRPGGGVIFGPKPRDWTIKINRKEKRLAISTALQHA 610
RGGGRKPY+QKKTG+ARRGS RTPLRPGGGVIFGPKPRDW+IKINRKEKRLAISTAL A
Sbjct: 121 RGGGRKPYQQKKTGKARRGSMRTPLRPGGGVIFGPKPRDWSIKINRKEKRLAISTALASA 180

Query: 611 --TGSFIVVEDFEDSIE--PKTKAFLAA 682
VVE+F++ PKT+ F+AA
Sbjct: 181 AVADDAFVVEEFDEEFAAGPKTRDFVAA 208


>tr|Q10NM5|Q10NM5_ORYSJ Os03g0265400 protein OS=Oryza sativa subsp.
japonica GN=Os03g0265400 PE=2 SV=1
Length = 323

Score = 200 bits (508), Expect = 8e-50
Identities = 107/148 (72%), Positives = 119/148 (80%), Gaps = 4/148 (2%)
Frame = +2

Query: 251 AMAVALPVLTFEGKASGTEVELDLKCARPETARAVVHRGLITELQNKRRGTASTLTRGEV 430
A A LPVL+F G+ G EV LDLK A P TARAVVHR +IT+ QNKRRGTASTLTRGEV
Sbjct: 62 AEAATLPVLSFTGEKVG-EVALDLKSAPPSTARAVVHRAIITDRQNKRRGTASTLTRGEV 120

Query: 431 RGGGRKPYKQKKTGRARRGSQRTPLRPGGGVIFGPKPRDWTIKINRKEKRLAISTALQHA 610
RGGGRKPY+QKKTG+ARRGS RTPLRPGGGVIFGPKPRDW+IKINRKEKRLAISTAL A
Sbjct: 121 RGGGRKPYQQKKTGKARRGSMRTPLRPGGGVIFGPKPRDWSIKINRKEKRLAISTALASA 180

Query: 611 --TGSFIVVEDFEDSIE--PKTKAFLAA 682
VVE+F++ PKT+ F+AA
Sbjct: 181 AVADDAFVVEEFDEEFAAGPKTRDFVAA 208


>tr|B8AKQ8|B8AKQ8_ORYSI Putative uncharacterized protein OS=Oryza
sativa subsp. indica GN=OsI_10864 PE=4 SV=1
Length = 324

Score = 200 bits (508), Expect = 8e-50
Identities = 107/148 (72%), Positives = 119/148 (80%), Gaps = 4/148 (2%)
Frame = +2

Query: 251 AMAVALPVLTFEGKASGTEVELDLKCARPETARAVVHRGLITELQNKRRGTASTLTRGEV 430
A A LPVL+F G+ G EV LDLK A P TARAVVHR +IT+ QNKRRGTASTLTRGEV
Sbjct: 63 AEAATLPVLSFTGEKVG-EVALDLKSAPPSTARAVVHRAIITDRQNKRRGTASTLTRGEV 121

Query: 431 RGGGRKPYKQKKTGRARRGSQRTPLRPGGGVIFGPKPRDWTIKINRKEKRLAISTALQHA 610
RGGGRKPY+QKKTG+ARRGS RTPLRPGGGVIFGPKPRDW+IKINRKEKRLAISTAL A
Sbjct: 122 RGGGRKPYQQKKTGKARRGSMRTPLRPGGGVIFGPKPRDWSIKINRKEKRLAISTALASA 181

Query: 611 --TGSFIVVEDFEDSIE--PKTKAFLAA 682
VVE+F++ PKT+ F+AA
Sbjct: 182 AVADDAFVVEEFDEEFAAGPKTRDFVAA 209