DK950310
Clone id TST38A01NGRL0008_F03
Library
Length 662
Definition Adiantum capillus-veneris mRNA. clone: TST38A01NGRL0008_F03. 5' end sequence.
Accession
Tissue type prothallia
Developmental stage gametophyte
Contig ID
Sequence
GTCCATTTTGCCAAAGTGGATTTGAATGGAAAGCCACACCAAACATTGGCACAAAATGCA
TCGTCCTGGCTCATGGATGATCTCTACAGAAACCCTGGACCCATCCAATACAGTGGTCCG
GGGGCCAATCTCAAAACTGTTACTCTCTCTCTTCAAGATCAAGACTACATTGGCCGCATT
CAGGAACTTTGGGCTTATCTAGAAAAGGTTAAAAAGATGGTCCAACCTGGATGCCCTGAG
GAGGTACTAAAGGCTGCCTTGAGCTCCATGAATTCAGTCATTGAGGTTCTTTCAGTCATC
TCTACGCCAGCATTCCGAGGAGCAACTCCTTATTGATCACCCTTGTTAGCAAAAAGCCCA
AAACACTGACTGCTTTTTTATTTATGCAAGTGGCTGTTCTAGAGTTTAGACACGTCAATG
ATTGGCGCAAGTTCGGCTAGCTTAGCTCTAATTTTCCATCGCTGAGCTTGAAATAGAGTC
TCATAGCGTGTGCTTACTAAGGTTTCTAGTTGAAAGCTGAGGAATGATGAGGCCGAGGCA
TTTTTTTTAATGGAGTAAAGGGTTTGCATCAGGTTCAGACAGTGTAATCAAAATTGGCTG
GGCATTGGTGCTTACTTTTGTTGACCGCATGGGATTGTCGTATGCAGCTGATTAATGGCT
TG
■■Homology search results ■■ -
sp_hit_id Q41140
Definition sp|Q41140|PFPA_RICCO Pyrophosphate--fructose 6-phosphate 1-phosphotransferase subunit alpha OS=Ricinus communis
Align length 110
Score (bit) 128.0
E-value 3.0e-29
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= DK950310|Adiantum capillus-veneris mRNA, clone:
TST38A01NGRL0008_F03, 5'
(662 letters)

Database: uniprot_sprot.fasta
412,525 sequences; 148,809,765 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

sp|Q41140|PFPA_RICCO Pyrophosphate--fructose 6-phosphate 1-phosp... 128 3e-29
sp|P21342|PFPA_SOLTU Pyrophosphate--fructose 6-phosphate 1-phosp... 126 9e-29
sp|P21343|PFPB_SOLTU Pyrophosphate--fructose 6-phosphate 1-phosp... 45 3e-04
sp|Q41141|PFPB_RICCO Pyrophosphate--fructose 6-phosphate 1-phosp... 43 0.001
sp|Q6NS15|MED15_XENLA Mediator of RNA polymerase II transcriptio... 35 0.27
sp|Q7ZVN7|MED15_DANRE Mediator of RNA polymerase II transcriptio... 35 0.35
sp|Q924H2|MED15_MOUSE Mediator of RNA polymerase II transcriptio... 33 1.0
sp|Q96RN5|MED15_HUMAN Mediator of RNA polymerase II transcriptio... 33 1.0
sp|Q5A5N6|ALG14_CANAL UDP-N-acetylglucosamine transferase subuni... 32 3.9
sp|P98167|SSPO_BOVIN SCO-spondin OS=Bos taurus GN=SSPO PE=2 SV=2 31 5.1
sp|Q9YA75|THYX_AERPE Thymidylate synthase thyX OS=Aeropyrum pern... 31 6.7
sp|Q8Q0L5|COOS1_METMA Carbon monoxide dehydrogenase 1 OS=Methano... 30 8.7

>sp|Q41140|PFPA_RICCO Pyrophosphate--fructose 6-phosphate
1-phosphotransferase subunit alpha OS=Ricinus communis
GN=PFP-ALPHA PE=3 SV=1
Length = 617

Score = 128 bits (321), Expect = 3e-29
Identities = 61/110 (55%), Positives = 83/110 (75%)
Frame = +1

Query: 1 VHFAKVDLNGKPHQTLAQNASSWLMDDLYRNPGPIQYSGPGANLKTVTLSLQDQDYIGRI 180
+H A VDL GK ++ L NA +LMDDLYRNPGP+Q+ GPGA+ K +TL ++DQDY+GRI
Sbjct: 507 IHPAAVDLKGKAYELLRLNAVKFLMDDLYRNPGPLQFEGPGADAKPITLCVEDQDYMGRI 566

Query: 181 QELWAYLEKVKKMVQPGCPEEVLKAALSSMNSVIEVLSVISTPAFRGATP 330
++L YL+KV+ +V+PGC +EVLKAALS M SV +VL +S+ + G P
Sbjct: 567 KKLQEYLDKVRTIVKPGCSQEVLKAALSVMASVTDVLLTMSSTSLDGQKP 616


>sp|P21342|PFPA_SOLTU Pyrophosphate--fructose 6-phosphate
1-phosphotransferase subunit alpha OS=Solanum tuberosum
PE=1 SV=1
Length = 616

Score = 126 bits (317), Expect = 9e-29
Identities = 58/104 (55%), Positives = 85/104 (81%)
Frame = +1

Query: 1 VHFAKVDLNGKPHQTLAQNASSWLMDDLYRNPGPIQYSGPGANLKTVTLSLQDQDYIGRI 180
+H A VDL GK ++ L+QNA+ +L+DD+YRNPGP+Q+ GPGA+ K +L ++D DYIG I
Sbjct: 507 LHPATVDLRGKSYELLSQNATKFLLDDVYRNPGPLQFDGPGADAKAGSLVVEDADYIGAI 566

Query: 181 QELWAYLEKVKKMVQPGCPEEVLKAALSSMNSVIEVLSVISTPA 312
++L YL+KV+ +V+PGC ++VLKAALS+M SV ++LSVIS+P+
Sbjct: 567 KKLQEYLDKVRTIVKPGCSQDVLKAALSAMASVTDILSVISSPS 610


>sp|P21343|PFPB_SOLTU Pyrophosphate--fructose 6-phosphate
1-phosphotransferase subunit beta OS=Solanum tuberosum
PE=1 SV=2
Length = 552

Score = 45.1 bits (105), Expect = 3e-04
Identities = 21/49 (42%), Positives = 28/49 (57%)
Frame = +1

Query: 10 AKVDLNGKPHQTLAQNASSWLMDDLYRNPGPIQYSGPGANLKTVTLSLQ 156
A V+L G P + A W +++ Y NPGPIQ+ GP AN TL L+
Sbjct: 499 AMVELEGAPFKKFASKREEWALNNRYINPGPIQFVGPVANKVNHTLLLE 547


>sp|Q41141|PFPB_RICCO Pyrophosphate--fructose 6-phosphate
1-phosphotransferase subunit beta OS=Ricinus communis
GN=PFP-BETA PE=3 SV=1
Length = 552

Score = 43.1 bits (100), Expect = 0.001
Identities = 19/49 (38%), Positives = 29/49 (59%)
Frame = +1

Query: 10 AKVDLNGKPHQTLAQNASSWLMDDLYRNPGPIQYSGPGANLKTVTLSLQ 156
A V+L G P + A W + + Y +PGPIQ+ GPG++ + TL L+
Sbjct: 499 AMVELEGAPFKKFASLREEWALKNRYVSPGPIQFMGPGSDAASHTLLLE 547


>sp|Q6NS15|MED15_XENLA Mediator of RNA polymerase II transcription
subunit 15 OS=Xenopus laevis GN=med15 PE=1 SV=1
Length = 777

Score = 35.4 bits (80), Expect = 0.27
Identities = 18/70 (25%), Positives = 40/70 (57%), Gaps = 2/70 (2%)
Frame = +1

Query: 91 NPGPIQYSGPGANLKTVTLSLQ--DQDYIGRIQELWAYLEKVKKMVQPGCPEEVLKAALS 264
+PGP+ G ++ + + Q +Q Y+ ++++L Y+E +++M+ E K LS
Sbjct: 494 SPGPLNTPGNPNSVMSPASNNQSEEQQYLDKLKQLSKYIEPLRRMINKIDKNEERKKDLS 553

Query: 265 SMNSVIEVLS 294
M S++++L+
Sbjct: 554 KMKSLLDILT 563


>sp|Q7ZVN7|MED15_DANRE Mediator of RNA polymerase II transcription
subunit 15 OS=Danio rerio GN=med15 PE=2 SV=1
Length = 809

Score = 35.0 bits (79), Expect = 0.35
Identities = 18/70 (25%), Positives = 40/70 (57%), Gaps = 2/70 (2%)
Frame = +1

Query: 91 NPGPIQYSGPGANLKTVTLSLQDQD--YIGRIQELWAYLEKVKKMVQPGCPEEVLKAALS 264
+PGP+ G +++ + + Q +D Y+ ++++L Y+E +++M+ E K LS
Sbjct: 527 SPGPLNTPGNPSSVMSPAGASQSEDQLYMDKLRQLSKYIEPLRRMINKIDKNEDRKKDLS 586

Query: 265 SMNSVIEVLS 294
M S++ +L+
Sbjct: 587 KMKSLLNILT 596


>sp|Q924H2|MED15_MOUSE Mediator of RNA polymerase II transcription
subunit 15 OS=Mus musculus GN=Med15 PE=2 SV=2
Length = 792

Score = 33.5 bits (75), Expect = 1.0
Identities = 18/70 (25%), Positives = 40/70 (57%), Gaps = 2/70 (2%)
Frame = +1

Query: 91 NPGPIQYSGPGANLKTVTLSLQ--DQDYIGRIQELWAYLEKVKKMVQPGCPEEVLKAALS 264
+PGP+ +++ + S Q +Q Y+ ++++L Y+E +++M+ E K LS
Sbjct: 506 SPGPLNTPVNPSSVMSPAGSSQAEEQQYLDKLKQLSKYIEPLRRMINKIDKNEDRKKDLS 565

Query: 265 SMNSVIEVLS 294
M S++++L+
Sbjct: 566 KMKSLLDILT 575


>sp|Q96RN5|MED15_HUMAN Mediator of RNA polymerase II transcription
subunit 15 OS=Homo sapiens GN=MED15 PE=1 SV=2
Length = 788

Score = 33.5 bits (75), Expect = 1.0
Identities = 18/70 (25%), Positives = 40/70 (57%), Gaps = 2/70 (2%)
Frame = +1

Query: 91 NPGPIQYSGPGANLKTVTLSLQ--DQDYIGRIQELWAYLEKVKKMVQPGCPEEVLKAALS 264
+PGP+ +++ + S Q +Q Y+ ++++L Y+E +++M+ E K LS
Sbjct: 505 SPGPLNTPVNPSSVMSPAGSSQAEEQQYLDKLKQLSKYIEPLRRMINKIDKNEDRKKDLS 564

Query: 265 SMNSVIEVLS 294
M S++++L+
Sbjct: 565 KMKSLLDILT 574


>sp|Q5A5N6|ALG14_CANAL UDP-N-acetylglucosamine transferase subunit
ALG14 OS=Candida albicans GN=ALG14 PE=3 SV=1
Length = 219

Score = 31.6 bits (70), Expect = 3.9
Identities = 18/63 (28%), Positives = 32/63 (50%), Gaps = 1/63 (1%)
Frame = +3

Query: 225 TWMP*GGTKGCL-ELHEFSH*GSFSHLYASIPRSNSLLITLVSKKPKTLTAFLFMQVAVL 401
TW+ G L + ++ S Y IPR+ ++ + +S P T+ +FLF +A+L
Sbjct: 78 TWIYTSGDNASLAKAQDYERKSGTSSQYIPIPRARTVGQSYISSIPTTIYSFLFSAIAML 137

Query: 402 EFR 410
+ R
Sbjct: 138 KHR 140


>sp|P98167|SSPO_BOVIN SCO-spondin OS=Bos taurus GN=SSPO PE=2 SV=2
Length = 5146

Score = 31.2 bits (69), Expect = 5.1
Identities = 13/26 (50%), Positives = 17/26 (65%)
Frame = +3

Query: 90 KPWTHPIQWSGGQSQNCYSLSSRSRL 167
+PW H W G+SQ C+S S+ SRL
Sbjct: 134 QPWGH--SWRDGRSQTCHSCSNHSRL 157


tr_hit_id A9T573
Definition tr|A9T573|A9T573_PHYPA Predicted protein OS=Physcomitrella patens subsp. patens
Align length 111
Score (bit) 165.0
E-value 3.0e-39
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= DK950310|Adiantum capillus-veneris mRNA, clone:
TST38A01NGRL0008_F03, 5'
(662 letters)

Database: uniprot_trembl.fasta
7,341,751 sequences; 2,391,615,440 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

tr|A9T573|A9T573_PHYPA Predicted protein OS=Physcomitrella paten... 165 3e-39
tr|A9RNJ2|A9RNJ2_PHYPA Predicted protein OS=Physcomitrella paten... 154 6e-36
tr|B8LPY8|B8LPY8_PICSI Putative uncharacterized protein OS=Picea... 149 1e-34
tr|Q69T78|Q69T78_ORYSJ Putative Pyrophosphate--fructose 6-phosph... 140 7e-32
tr|Q0DCI1|Q0DCI1_ORYSJ Os06g0326400 protein OS=Oryza sativa subs... 140 7e-32
tr|B8B1A6|B8B1A6_ORYSI Putative uncharacterized protein OS=Oryza... 140 7e-32
tr|A3BB97|A3BB97_ORYSJ Putative uncharacterized protein OS=Oryza... 140 7e-32
tr|A9PC61|A9PC61_POPTR Putative uncharacterized protein OS=Popul... 134 5e-30
tr|A9P835|A9P835_POPTR Putative uncharacterized protein OS=Popul... 134 5e-30
tr|A7QPI0|A7QPI0_VITVI Chromosome chr18 scaffold_137, whole geno... 134 7e-30
tr|B6SHF8|B6SHF8_MAIZE Pyrophosphate--fructose 6-phosphate 1-pho... 133 9e-30
tr|B4FEP0|B4FEP0_MAIZE Putative uncharacterized protein OS=Zea m... 133 9e-30
tr|B6SGB6|B6SGB6_MAIZE Pyrophosphate--fructose 6-phosphate 1-pho... 129 2e-28
tr|Q9ZST2|Q9ZST2_CITPA Pyrophosphate-dependent phosphofructokina... 127 6e-28
tr|Q6ZFT9|Q6ZFT9_ORYSJ Os02g0714200 protein OS=Oryza sativa subs... 127 6e-28
tr|B8AHL5|B8AHL5_ORYSI Putative uncharacterized protein OS=Oryza... 127 6e-28
tr|A3AAN9|A3AAN9_ORYSJ Putative uncharacterized protein OS=Oryza... 127 6e-28
tr|Q9SYP2|Q9SYP2_ARATH At1g20950 OS=Arabidopsis thaliana GN=At1g... 126 1e-27
tr|Q9C9K3|Q9C9K3_ARATH Putative pyrophosphate-dependent phosphof... 126 1e-27
tr|Q56WC4|Q56WC4_ARATH Putative pyrophosphate-dependent phosphof... 126 1e-27
tr|Q0WNI9|Q0WNI9_ARATH Putative pyrophosphate-dependent phosphof... 126 1e-27
tr|A9YVC8|A9YVC8_9ROSI Pyrophosphate-dependent phosphofructokina... 126 1e-27
tr|Q69TA0|Q69TA0_ORYSJ Putative pyrophosphate-dependent phosphof... 120 1e-25
tr|B8BE15|B8BE15_ORYSI Putative uncharacterized protein OS=Oryza... 120 1e-25
tr|A3BX38|A3BX38_ORYSJ Putative uncharacterized protein OS=Oryza... 120 1e-25
tr|Q84QT9|Q84QT9_ORYSJ Os08g0345700 protein OS=Oryza sativa subs... 117 8e-25
tr|B8B9Z2|B8B9Z2_ORYSI Putative uncharacterized protein OS=Oryza... 117 8e-25
tr|A3BS74|A3BS74_ORYSJ Putative uncharacterized protein OS=Oryza... 117 8e-25
tr|B7ZYR6|B7ZYR6_MAIZE Putative uncharacterized protein OS=Zea m... 116 1e-24
tr|B4FAE6|B4FAE6_MAIZE Putative uncharacterized protein OS=Zea m... 116 1e-24

>tr|A9T573|A9T573_PHYPA Predicted protein OS=Physcomitrella patens
subsp. patens GN=PHYPADRAFT_218994 PE=4 SV=1
Length = 613

Score = 165 bits (417), Expect = 3e-39
Identities = 77/111 (69%), Positives = 94/111 (84%)
Frame = +1

Query: 1 VHFAKVDLNGKPHQTLAQNASSWLMDDLYRNPGPIQYSGPGANLKTVTLSLQDQDYIGRI 180
VH KVDL GKP++ L Q ASSWLMDDLYRNPGPIQY+G GA+LKT+TL +D DYIG++
Sbjct: 503 VHRTKVDLKGKPYELLTQKASSWLMDDLYRNPGPIQYAGAGADLKTITLLAEDNDYIGKV 562

Query: 181 QELWAYLEKVKKMVQPGCPEEVLKAALSSMNSVIEVLSVISTPAFRGATPY 333
QEL AYL+KVK++V+PGCP EVLKAAL SM SV E+L+V+S P+FRG TP+
Sbjct: 563 QELCAYLDKVKEIVKPGCPGEVLKAALCSMASVTEILTVMSAPSFRGRTPF 613


>tr|A9RNJ2|A9RNJ2_PHYPA Predicted protein OS=Physcomitrella patens
subsp. patens GN=PHYPADRAFT_55781 PE=4 SV=1
Length = 621

Score = 154 bits (388), Expect = 6e-36
Identities = 73/114 (64%), Positives = 93/114 (81%), Gaps = 3/114 (2%)
Frame = +1

Query: 1 VHFAKVDLNGKPHQTLAQNASSWLMDDLYRNPGPIQYSGPGANLKTVTLSLQDQDYIGRI 180
VH +VDL GKP+ L Q+ASSWLMDDLYRNPGPIQY+GPGA+L T+TLS++D DYIG I
Sbjct: 508 VHTTEVDLKGKPYGLLTQHASSWLMDDLYRNPGPIQYAGPGADLTTITLSIEDNDYIGEI 567

Query: 181 QELWAYLEK---VKKMVQPGCPEEVLKAALSSMNSVIEVLSVISTPAFRGATPY 333
QE +AYL+K VK++V+PGC EVLKAALSSM SV ++L+ +S P++R TP+
Sbjct: 568 QEFYAYLDKAMQVKEIVKPGCAGEVLKAALSSMASVTDILTAMSAPSYRSLTPF 621


>tr|B8LPY8|B8LPY8_PICSI Putative uncharacterized protein OS=Picea
sitchensis PE=2 SV=1
Length = 351

Score = 149 bits (377), Expect = 1e-34
Identities = 69/106 (65%), Positives = 92/106 (86%)
Frame = +1

Query: 1 VHFAKVDLNGKPHQTLAQNASSWLMDDLYRNPGPIQYSGPGANLKTVTLSLQDQDYIGRI 180
VH A VDL G+P+Q L +NA+ +LMDD+YRNPGP+Q+ GPGAN KT+TLS++DQDYIGRI
Sbjct: 243 VHPANVDLKGRPYQLLMRNATRFLMDDIYRNPGPLQFEGPGANAKTITLSVEDQDYIGRI 302

Query: 181 QELWAYLEKVKKMVQPGCPEEVLKAALSSMNSVIEVLSVISTPAFR 318
Q+L +YL+KV+ +V+PGC EEVLKAALS+M SV +VL+V+S PA++
Sbjct: 303 QQLRSYLDKVRDIVKPGCAEEVLKAALSAMASVSDVLTVMSAPAYK 348


>tr|Q69T78|Q69T78_ORYSJ Putative Pyrophosphate--fructose 6-phosphate
1-phosphotransferase alpha subunit OS=Oryza sativa
subsp. japonica GN=P0652D10.35 PE=4 SV=1
Length = 617

Score = 140 bits (353), Expect = 7e-32
Identities = 61/107 (57%), Positives = 89/107 (83%)
Frame = +1

Query: 1 VHFAKVDLNGKPHQTLAQNASSWLMDDLYRNPGPIQYSGPGANLKTVTLSLQDQDYIGRI 180
VH A +DL GKP++ L QN+SS+LM+D+YRNPGP+Q+ GPG K ++L ++D+DY+GRI
Sbjct: 507 VHMASIDLKGKPYELLRQNSSSFLMEDIYRNPGPLQFEGPGGETKPISLCVEDRDYMGRI 566

Query: 181 QELWAYLEKVKKMVQPGCPEEVLKAALSSMNSVIEVLSVISTPAFRG 321
++L YLEKVK +V+PGC ++VLKAALS+M SV E+L+++S+P+F G
Sbjct: 567 KQLQEYLEKVKSIVKPGCSQDVLKAALSAMASVTEMLTIMSSPSFSG 613


>tr|Q0DCI1|Q0DCI1_ORYSJ Os06g0326400 protein OS=Oryza sativa subsp.
japonica GN=Os06g0326400 PE=2 SV=1
Length = 622

Score = 140 bits (353), Expect = 7e-32
Identities = 61/107 (57%), Positives = 89/107 (83%)
Frame = +1

Query: 1 VHFAKVDLNGKPHQTLAQNASSWLMDDLYRNPGPIQYSGPGANLKTVTLSLQDQDYIGRI 180
VH A +DL GKP++ L QN+SS+LM+D+YRNPGP+Q+ GPG K ++L ++D+DY+GRI
Sbjct: 512 VHMASIDLKGKPYELLRQNSSSFLMEDIYRNPGPLQFEGPGGETKPISLCVEDRDYMGRI 571

Query: 181 QELWAYLEKVKKMVQPGCPEEVLKAALSSMNSVIEVLSVISTPAFRG 321
++L YLEKVK +V+PGC ++VLKAALS+M SV E+L+++S+P+F G
Sbjct: 572 KQLQEYLEKVKSIVKPGCSQDVLKAALSAMASVTEMLTIMSSPSFSG 618


>tr|B8B1A6|B8B1A6_ORYSI Putative uncharacterized protein OS=Oryza
sativa subsp. indica GN=OsI_22776 PE=4 SV=1
Length = 622

Score = 140 bits (353), Expect = 7e-32
Identities = 61/107 (57%), Positives = 89/107 (83%)
Frame = +1

Query: 1 VHFAKVDLNGKPHQTLAQNASSWLMDDLYRNPGPIQYSGPGANLKTVTLSLQDQDYIGRI 180
VH A +DL GKP++ L QN+SS+LM+D+YRNPGP+Q+ GPG K ++L ++D+DY+GRI
Sbjct: 512 VHMASIDLKGKPYELLRQNSSSFLMEDIYRNPGPLQFEGPGGETKPISLCVEDRDYMGRI 571

Query: 181 QELWAYLEKVKKMVQPGCPEEVLKAALSSMNSVIEVLSVISTPAFRG 321
++L YLEKVK +V+PGC ++VLKAALS+M SV E+L+++S+P+F G
Sbjct: 572 KQLQEYLEKVKSIVKPGCSQDVLKAALSAMASVTEMLTIMSSPSFSG 618


>tr|A3BB97|A3BB97_ORYSJ Putative uncharacterized protein OS=Oryza
sativa subsp. japonica GN=OsJ_020319 PE=4 SV=1
Length = 602

Score = 140 bits (353), Expect = 7e-32
Identities = 61/107 (57%), Positives = 89/107 (83%)
Frame = +1

Query: 1 VHFAKVDLNGKPHQTLAQNASSWLMDDLYRNPGPIQYSGPGANLKTVTLSLQDQDYIGRI 180
VH A +DL GKP++ L QN+SS+LM+D+YRNPGP+Q+ GPG K ++L ++D+DY+GRI
Sbjct: 492 VHMASIDLKGKPYELLRQNSSSFLMEDIYRNPGPLQFEGPGGETKPISLCVEDRDYMGRI 551

Query: 181 QELWAYLEKVKKMVQPGCPEEVLKAALSSMNSVIEVLSVISTPAFRG 321
++L YLEKVK +V+PGC ++VLKAALS+M SV E+L+++S+P+F G
Sbjct: 552 KQLQEYLEKVKSIVKPGCSQDVLKAALSAMASVTEMLTIMSSPSFSG 598


>tr|A9PC61|A9PC61_POPTR Putative uncharacterized protein OS=Populus
trichocarpa PE=2 SV=1
Length = 617

Score = 134 bits (337), Expect = 5e-30
Identities = 64/110 (58%), Positives = 86/110 (78%)
Frame = +1

Query: 1 VHFAKVDLNGKPHQTLAQNASSWLMDDLYRNPGPIQYSGPGANLKTVTLSLQDQDYIGRI 180
+H A VDL GK ++ L QNA + MDDLYRNPGP+Q+ GPGA+ K VTL ++DQDY+G I
Sbjct: 507 IHPAAVDLKGKAYELLRQNAGRFWMDDLYRNPGPLQFDGPGADSKAVTLCVEDQDYMGGI 566

Query: 181 QELWAYLEKVKKMVQPGCPEEVLKAALSSMNSVIEVLSVISTPAFRGATP 330
++L YL+KV+ +V+PGC +EVLKAALS M+SV +VLSV+S+ + G TP
Sbjct: 567 KKLQEYLDKVRNIVKPGCSQEVLKAALSVMSSVTDVLSVMSSTSSNGQTP 616


>tr|A9P835|A9P835_POPTR Putative uncharacterized protein OS=Populus
trichocarpa PE=2 SV=1
Length = 353

Score = 134 bits (337), Expect = 5e-30
Identities = 64/110 (58%), Positives = 86/110 (78%)
Frame = +1

Query: 1 VHFAKVDLNGKPHQTLAQNASSWLMDDLYRNPGPIQYSGPGANLKTVTLSLQDQDYIGRI 180
+H A VDL GK ++ L QNA + MDDLYRNPGP+Q+ GPGA+ K VTL ++DQDY+G I
Sbjct: 243 IHPATVDLKGKAYELLRQNAGRFWMDDLYRNPGPLQFDGPGADSKAVTLCVEDQDYMGGI 302

Query: 181 QELWAYLEKVKKMVQPGCPEEVLKAALSSMNSVIEVLSVISTPAFRGATP 330
++L YL+KV+ +V+PGC +EVLKAALS M+SV +VLSV+S+ + G TP
Sbjct: 303 KKLQEYLDKVRNIVKPGCSQEVLKAALSVMSSVTDVLSVMSSTSSNGQTP 352


>tr|A7QPI0|A7QPI0_VITVI Chromosome chr18 scaffold_137, whole genome
shotgun sequence OS=Vitis vinifera GN=GSVIVT00002948001
PE=4 SV=1
Length = 524

Score = 134 bits (336), Expect = 7e-30
Identities = 63/110 (57%), Positives = 90/110 (81%)
Frame = +1

Query: 1 VHFAKVDLNGKPHQTLAQNASSWLMDDLYRNPGPIQYSGPGANLKTVTLSLQDQDYIGRI 180
VH +DL GK ++ L+QNA+ +L+DDLYRNPGP+Q+ GPGA+ K VTL ++DQDY+GRI
Sbjct: 415 VHPYALDLKGKAYELLSQNATKFLLDDLYRNPGPLQFDGPGADAKAVTLCVEDQDYMGRI 474

Query: 181 QELWAYLEKVKKMVQPGCPEEVLKAALSSMNSVIEVLSVISTPAFRGATP 330
++L YL+KV+ +V+PGC ++VLKAALS+M SV E+LSV+++P+ G TP
Sbjct: 475 KKLQQYLDKVRTIVKPGCSQDVLKAALSAMASVTEILSVMTSPS-SGQTP 523