DK950369
Clone id TST38A01NGRL0008_H15
Library
Length 627
Definition Adiantum capillus-veneris mRNA. clone: TST38A01NGRL0008_H15. 5' end sequence.
Accession
Tissue type prothallia
Developmental stage gametophyte
Contig ID -
Sequence
AGCATGGAACACATTGCTTGCAGGCTATATCAACTATGGTTTTCCTGAAGAAGCAATCAA
CTGCTTTGAAAGAATGCAACAAGAGGGCGTCTCCCCTGTAGAAGTTACCTTCGTGCACAC
TTTGAAAGCATGTGGTGAAGGACGAGCCTTGACAACAGGCCATGCAGTACATGGTGAAAT
GATCAAAAGAGGATGGGAGGGAAATCTTGACCTGAACAACTCCTTGGTGGACTTCTATGG
AAAATGCGGCTCTGTATTGGAGGCGCGCATGCTTTTTGACTTGCTACCGGTTCGCTCTGC
TGTCTCATGGACAGCCCTCATTTCGGGGTATGCTGAAATTGGACTTGGTTATGAAGTGTT
GGATTGCTTTAGACAGATGCAAACGGAGGCCATCTTTCTAGACAGAGTAGTGTTTATATG
CAGTCTGAAGGCTTGCAATATGTTTGAAGCTTTTGAAATAGGTCGAATTCTACACTCTCA
TGTGGTTAAACGAGGATGGGAGAGGGACGTCACAATTGGCAACATGCTGTTGATTATGTA
TGCCAAATGTGGCTTCCTTGCTGAGGCACAAGTCTTGTTTGATGAACTGCAAGTTCAAAG
TGCAGAGTCTTGGGCTCTACTCATTGT
■■Homology search results ■■ -
sp_hit_id Q9SB36
Definition sp|Q9SB36|PP337_ARATH Pentatricopeptide repeat-containing protein At4g25270, chloroplastic OS=Arabidopsis thaliana
Align length 208
Score (bit) 149.0
E-value 9.0e-36
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= DK950369|Adiantum capillus-veneris mRNA, clone:
TST38A01NGRL0008_H15, 5'
(627 letters)

Database: uniprot_sprot.fasta
412,525 sequences; 148,809,765 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

sp|Q9SB36|PP337_ARATH Pentatricopeptide repeat-containing protei... 149 9e-36
sp|Q9CAY1|PP223_ARATH Putative pentatricopeptide repeat-containi... 139 1e-32
sp|Q9SN39|PP320_ARATH Pentatricopeptide repeat-containing protei... 138 2e-32
sp|P93005|PP181_ARATH Pentatricopeptide repeat-containing protei... 138 2e-32
sp|Q9M9E2|PPR45_ARATH Pentatricopeptide repeat-containing protei... 138 3e-32
sp|Q0WNP3|PP319_ARATH Pentatricopeptide repeat-containing protei... 137 3e-32
sp|P0C898|PP232_ARATH Putative pentatricopeptide repeat-containi... 136 8e-32
sp|Q9FXA9|PPR83_ARATH Putative pentatricopeptide repeat-containi... 134 5e-31
sp|Q9LIC3|PP227_ARATH Putative pentatricopeptide repeat-containi... 133 6e-31
sp|Q9LUJ2|PP249_ARATH Pentatricopeptide repeat-containing protei... 131 3e-30
sp|Q9LTV8|PP224_ARATH Pentatricopeptide repeat-containing protei... 130 6e-30
sp|Q9ZUW3|PP172_ARATH Pentatricopeptide repeat-containing protei... 130 6e-30
sp|Q9MA95|PP214_ARATH Putative pentatricopeptide repeat-containi... 130 7e-30
sp|Q9SVP7|PP307_ARATH Pentatricopeptide repeat-containing protei... 129 9e-30
sp|Q3E6Q1|PPR32_ARATH Pentatricopeptide repeat-containing protei... 129 2e-29
sp|A8MQA3|PP330_ARATH Pentatricopeptide repeat-containing protei... 127 4e-29
sp|P93011|PP182_ARATH Pentatricopeptide repeat-containing protei... 127 6e-29
sp|Q9SZK1|PP355_ARATH Pentatricopeptide repeat-containing protei... 126 8e-29
sp|Q9LN01|PPR21_ARATH Pentatricopeptide repeat-containing protei... 126 1e-28
sp|Q9FRI5|PPR57_ARATH Pentatricopeptide repeat-containing protei... 125 1e-28
sp|Q9LYV3|PP377_ARATH Putative pentatricopeptide repeat-containi... 125 1e-28
sp|Q9SY02|PP301_ARATH Pentatricopeptide repeat-containing protei... 125 1e-28
sp|Q9CAA8|PP108_ARATH Putative pentatricopeptide repeat-containi... 125 2e-28
sp|Q9CA56|PP121_ARATH Pentatricopeptide repeat-containing protei... 125 2e-28
sp|Q9LR69|PPR8_ARATH Pentatricopeptide repeat-containing protein... 124 3e-28
sp|Q9LJR6|PP253_ARATH Putative pentatricopeptide repeat-containi... 124 3e-28
sp|Q9SIT7|PP151_ARATH Pentatricopeptide repeat-containing protei... 124 4e-28
sp|O64705|PP184_ARATH Pentatricopeptide repeat-containing protei... 123 7e-28
sp|Q8VYH0|PP313_ARATH Pentatricopeptide repeat-containing protei... 122 1e-27
sp|Q9STF3|PP265_ARATH Pentatricopeptide repeat-containing protei... 122 2e-27

>sp|Q9SB36|PP337_ARATH Pentatricopeptide repeat-containing protein
At4g25270, chloroplastic OS=Arabidopsis thaliana
GN=PCMP-E53 PE=2 SV=1
Length = 527

Score = 149 bits (377), Expect = 9e-36
Identities = 77/208 (37%), Positives = 130/208 (62%)
Frame = +2

Query: 2 AWNTLLAGYINYGFPEEAINCFERMQQEGVSPVEVTFVHTLKACGEGRALTTGHAVHGEM 181
AWN+L++GY G E+A+ + +M ++GV P TF LKACG ++ G A+H ++
Sbjct: 162 AWNSLISGYAELGQYEDAMALYFQMAEDGVKPDRFTFPRVLKACGGIGSVQIGEAIHRDL 221

Query: 182 IKRGWEGNLDLNNSLVDFYGKCGSVLEARMLFDLLPVRSAVSWTALISGYAEIGLGYEVL 361
+K G+ ++ + N+LV Y KCG +++AR +FD++P + VSW ++++GY GL +E L
Sbjct: 222 VKEGFGYDVYVLNALVVMYAKCGDIVKARNVFDMIPHKDYVSWNSMLTGYLHHGLLHEAL 281

Query: 362 DCFRQMQTEAIFLDRVVFICSLKACNMFEAFEIGRILHSHVVKRGWERDVTIGNMLLIMY 541
D FR M I D+V I S+ A + +F+ GR LH V++RG E ++++ N L+++Y
Sbjct: 282 DIFRLMVQNGIEPDKVA-ISSVLARVL--SFKHGRQLHGWVIRRGMEWELSVANALIVLY 338

Query: 542 AKCGFLAEAQVLFDELQVQSAESWALLI 625
+K G L +A +FD++ + SW +I
Sbjct: 339 SKRGQLGQACFIFDQMLERDTVSWNAII 366



Score = 104 bits (260), Expect = 3e-22
Identities = 65/192 (33%), Positives = 98/192 (51%), Gaps = 3/192 (1%)
Frame = +2

Query: 47 EEAINCFERMQQEGVSPVEVT-FVHTLKACGEGRALTTGHAVHGEMIKRGWEGNLDLNNS 223
+ I E Q+G+S E F L+ C RA+ G VH + NL +++
Sbjct: 73 DSVITDLETSAQKGISLTEPEIFASLLETCYSLRAIDHGVRVHHLIPPYLLRNNLGISSK 132

Query: 224 LVDFYGKCGSVLEARMLFDLLPVR--SAVSWTALISGYAEIGLGYEVLDCFRQMQTEAIF 397
LV Y CG A +FD + R S +W +LISGYAE+G + + + QM + +
Sbjct: 133 LVRLYASCGYAEVAHEVFDRMSKRDSSPFAWNSLISGYAELGQYEDAMALYFQMAEDGVK 192

Query: 398 LDRVVFICSLKACNMFEAFEIGRILHSHVVKRGWERDVTIGNMLLIMYAKCGFLAEAQVL 577
DR F LKAC + +IG +H +VK G+ DV + N L++MYAKCG + +A+ +
Sbjct: 193 PDRFTFPRVLKACGGIGSVQIGEAIHRDLVKEGFGYDVYVLNALVVMYAKCGDIVKARNV 252

Query: 578 FDELQVQSAESW 613
FD + + SW
Sbjct: 253 FDMIPHKDYVSW 264



Score = 87.8 bits (216), Expect = 4e-17
Identities = 62/213 (29%), Positives = 105/213 (49%), Gaps = 5/213 (2%)
Frame = +2

Query: 2 AWNTLLAGYINYGFPEEAINCFERMQQEGVSPVEVTFVHTLKACGEGRALTTGHA--VHG 175
+WN++L GY+++G EA++ F M Q G+ P +V L R L+ H +HG
Sbjct: 263 SWNSMLTGYLHHGLLHEALDIFRLMVQNGIEPDKVAISSVL-----ARVLSFKHGRQLHG 317

Query: 176 EMIKRGWEGNLDLNNSLVDFYGKCGSVLEARMLFDLLPVRSAVSWTALISGYAEIGLGYE 355
+I+RG E L + N+L+ Y K G + +A +FD + R VSW A+IS +++ G
Sbjct: 318 WVIRRGMEWELSVANALIVLYSKRGQLGQACFIFDQMLERDTVSWNAIISAHSKNSNG-- 375

Query: 356 VLDCFRQMQTEAIFLDRVVFICSLKACNMFEAFEIGRILHSHVVKR-GWERDVTIGNMLL 532
L F QM D + F+ L C E G L S + K G + + ++
Sbjct: 376 -LKYFEQMHRANAKPDGITFVSVLSLCANTGMVEDGERLFSLMSKEYGIDPKMEHYACMV 434

Query: 533 IMYAKCGFLAEA-QVLFDELQVQSAES-WALLI 625
+Y + G + EA ++ E+ +++ + W L+
Sbjct: 435 NLYGRAGMMEEAYSMIVQEMGLEAGPTVWGALL 467



Score = 31.6 bits (70), Expect = 3.5
Identities = 16/69 (23%), Positives = 32/69 (46%)
Frame = +2

Query: 410 VFICSLKACNMFEAFEIGRILHSHVVKRGWERDVTIGNMLLIMYAKCGFLAEAQVLFDEL 589
+F L+ C A + G +H + ++ I + L+ +YA CG+ A +FD +
Sbjct: 94 IFASLLETCYSLRAIDHGVRVHHLIPPYLLRNNLGISSKLVRLYASCGYAEVAHEVFDRM 153

Query: 590 QVQSAESWA 616
+ + +A
Sbjct: 154 SKRDSSPFA 162


>sp|Q9CAY1|PP223_ARATH Putative pentatricopeptide repeat-containing
protein At3g11460 OS=Arabidopsis thaliana GN=PCMP-H52
PE=3 SV=1
Length = 623

Score = 139 bits (350), Expect = 1e-32
Identities = 72/207 (34%), Positives = 116/207 (56%)
Frame = +2

Query: 5 WNTLLAGYINYGFPEEAINCFERMQQEGVSPVEVTFVHTLKACGEGRALTTGHAVHGEMI 184
+N L++GY +A F RM++ GVS VT + + C L G ++HG+ +
Sbjct: 124 YNALISGYTANSKVTDAAYMFRRMKETGVSVDSVTMLGLVPLCTVPEYLWLGRSLHGQCV 183

Query: 185 KRGWEGNLDLNNSLVDFYGKCGSVLEARMLFDLLPVRSAVSWTALISGYAEIGLGYEVLD 364
K G + + + NS + Y KCGSV R LFD +PV+ ++W A+ISGY++ GL Y+VL+
Sbjct: 184 KGGLDSEVAVLNSFITMYMKCGSVEAGRRLFDEMPVKGLITWNAVISGYSQNGLAYDVLE 243

Query: 365 CFRQMQTEAIFLDRVVFICSLKACNMFEAFEIGRILHSHVVKRGWERDVTIGNMLLIMYA 544
+ QM++ + D + L +C A +IG + V G+ +V + N + MYA
Sbjct: 244 LYEQMKSSGVCPDPFTLVSVLSSCAHLGAKKIGHEVGKLVESNGFVPNVFVSNASISMYA 303

Query: 545 KCGFLAEAQVLFDELQVQSAESWALLI 625
+CG LA+A+ +FD + V+S SW +I
Sbjct: 304 RCGNLAKARAVFDIMPVKSLVSWTAMI 330



Score = 104 bits (259), Expect = 4e-22
Identities = 64/209 (30%), Positives = 100/209 (47%), Gaps = 2/209 (0%)
Frame = +2

Query: 5 WNTLLAGYINYGFPEEAINCFERMQQEGVSPVEVTFVHTLKACGEGRALTTGHAVHGEMI 184
WN L E+I+ + M + G SP +F LK+C +G +H +
Sbjct: 21 WNVRLRELAYQSLFSESISLYRSMLRSGSSPDAFSFPFILKSCASLSLPVSGQQLHCHVT 80

Query: 185 KRGWEGNLDLNNSLVDFYGKCGSVLEARMLFDLLPVRSAVS--WTALISGYAEIGLGYEV 358
K G E + +L+ Y KCG V +AR +F+ P S +S + ALISGY +
Sbjct: 81 KGGCETEPFVLTALISMYCKCGLVADARKVFEENPQSSQLSVCYNALISGYTANSKVTDA 140

Query: 359 LDCFRQMQTEAIFLDRVVFICSLKACNMFEAFEIGRILHSHVVKRGWERDVTIGNMLLIM 538
FR+M+ + +D V + + C + E +GR LH VK G + +V + N + M
Sbjct: 141 AYMFRRMKETGVSVDSVTMLGLVPLCTVPEYLWLGRSLHGQCVKGGLDSEVAVLNSFITM 200

Query: 539 YAKCGFLAEAQVLFDELQVQSAESWALLI 625
Y KCG + + LFDE+ V+ +W +I
Sbjct: 201 YMKCGSVEAGRRLFDEMPVKGLITWNAVI 229



Score = 98.6 bits (244), Expect = 2e-20
Identities = 50/145 (34%), Positives = 78/145 (53%)
Frame = +2

Query: 5 WNTLLAGYINYGFPEEAINCFERMQQEGVSPVEVTFVHTLKACGEGRALTTGHAVHGEMI 184
WN +++GY G + + +E+M+ GV P T V L +C A GH V +
Sbjct: 225 WNAVISGYSQNGLAYDVLELYEQMKSSGVCPDPFTLVSVLSSCAHLGAKKIGHEVGKLVE 284

Query: 185 KRGWEGNLDLNNSLVDFYGKCGSVLEARMLFDLLPVRSAVSWTALISGYAEIGLGYEVLD 364
G+ N+ ++N+ + Y +CG++ +AR +FD++PV+S VSWTA+I Y G+G L
Sbjct: 285 SNGFVPNVFVSNASISMYARCGNLAKARAVFDIMPVKSLVSWTAMIGCYGMHGMGEIGLM 344

Query: 365 CFRQMQTEAIFLDRVVFICSLKACN 439
F M I D VF+ L AC+
Sbjct: 345 LFDDMIKRGIRPDGAVFVMVLSACS 369



Score = 48.9 bits (115), Expect = 2e-05
Identities = 29/97 (29%), Positives = 44/97 (45%)
Frame = +2

Query: 296 SAVSWTALISGYAEIGLGYEVLDCFRQMQTEAIFLDRVVFICSLKACNMFEAFEIGRILH 475
++ W + A L E + +R M D F LK+C G+ LH
Sbjct: 17 ASTPWNVRLRELAYQSLFSESISLYRSMLRSGSSPDAFSFPFILKSCASLSLPVSGQQLH 76

Query: 476 SHVVKRGWERDVTIGNMLLIMYAKCGFLAEAQVLFDE 586
HV K G E + + L+ MY KCG +A+A+ +F+E
Sbjct: 77 CHVTKGGCETEPFVLTALISMYCKCGLVADARKVFEE 113



Score = 40.0 bits (92), Expect = 0.010
Identities = 30/110 (27%), Positives = 47/110 (42%), Gaps = 3/110 (2%)
Frame = +2

Query: 2 AWNTLLAGYINYGFPEEAINCFERMQQEGVSPVEVTFVHTLKACGEGRALTTGHAVHGEM 181
+W ++ Y +G E + F+ M + G+ P FV L AC G + M
Sbjct: 325 SWTAMIGCYGMHGMGEIGLMLFDDMIKRGIRPDGAVFVMVLSACSHSGLTDKGLELFRAM 384

Query: 182 IKRGW--EGNLDLNNSLVDFYGKCGSVLEARMLFDLLPVR-SAVSWTALI 322
KR + E + + LVD G+ G + EA + +PV W AL+
Sbjct: 385 -KREYKLEPGPEHYSCLVDLLGRAGRLDEAMEFIESMPVEPDGAVWGALL 433


>sp|Q9SN39|PP320_ARATH Pentatricopeptide repeat-containing protein
At4g18750, chloroplastic OS=Arabidopsis thaliana
GN=PCMP-H45 PE=2 SV=1
Length = 871

Score = 138 bits (348), Expect = 2e-32
Identities = 75/210 (35%), Positives = 115/210 (54%), Gaps = 2/210 (0%)
Frame = +2

Query: 2 AWNTLLAGYINYGFPEEAINCFERMQQEGVSPVEVTFVHTLKACGEGRALTTGHAVHGEM 181
++ +++AGY G EA+ FE M++EG+SP T L C R L G VH E
Sbjct: 364 SYTSMIAGYAREGLAGEAVKLFEEMEEEGISPDVYTVTAVLNCCARYRLLDEGKRVH-EW 422

Query: 182 IKRGWEG-NLDLNNSLVDFYGKCGSVLEARMLFDLLPVRSAVSWTALISGYAEIGLGYEV 358
IK G ++ ++N+L+D Y KCGS+ EA ++F + V+ +SW +I GY++ E
Sbjct: 423 IKENDLGFDIFVSNALMDMYAKCGSMQEAELVFSEMRVKDIISWNTIIGGYSKNCYANEA 482

Query: 359 LDCFRQMQTEAIFL-DRVVFICSLKACNMFEAFEIGRILHSHVVKRGWERDVTIGNMLLI 535
L F + E F D C L AC AF+ GR +H ++++ G+ D + N L+
Sbjct: 483 LSLFNLLLEEKRFSPDERTVACVLPACASLSAFDKGREIHGYIMRNGYFSDRHVANSLVD 542

Query: 536 MYAKCGFLAEAQVLFDELQVQSAESWALLI 625
MYAKCG L A +LFD++ + SW ++I
Sbjct: 543 MYAKCGALLLAHMLFDDIASKDLVSWTVMI 572



Score = 129 bits (325), Expect = 9e-30
Identities = 65/208 (31%), Positives = 111/208 (53%)
Frame = +2

Query: 2 AWNTLLAGYINYGFPEEAINCFERMQQEGVSPVEVTFVHTLKACGEGRALTTGHAVHGEM 181
+WN+++ GY++ G E+ ++ F +M G+ T V C + R ++ G AVH
Sbjct: 263 SWNSIINGYVSNGLAEKGLSVFVQMLVSGIEIDLATIVSVFAGCADSRLISLGRAVHSIG 322

Query: 182 IKRGWEGNLDLNNSLVDFYGKCGSVLEARMLFDLLPVRSAVSWTALISGYAEIGLGYEVL 361
+K + N+L+D Y KCG + A+ +F + RS VS+T++I+GYA GL E +
Sbjct: 323 VKACFSREDRFCNTLLDMYSKCGDLDSAKAVFREMSDRSVVSYTSMIAGYAREGLAGEAV 382

Query: 362 DCFRQMQTEAIFLDRVVFICSLKACNMFEAFEIGRILHSHVVKRGWERDVTIGNMLLIMY 541
F +M+ E I D L C + + G+ +H + + D+ + N L+ MY
Sbjct: 383 KLFEEMEEEGISPDVYTVTAVLNCCARYRLLDEGKRVHEWIKENDLGFDIFVSNALMDMY 442

Query: 542 AKCGFLAEAQVLFDELQVQSAESWALLI 625
AKCG + EA+++F E++V+ SW +I
Sbjct: 443 AKCGSMQEAELVFSEMRVKDIISWNTII 470



Score = 109 bits (273), Expect = 1e-23
Identities = 60/167 (35%), Positives = 87/167 (52%), Gaps = 1/167 (0%)
Frame = +2

Query: 2 AWNTLLAGYINYGFPEEAINCFERMQQEG-VSPVEVTFVHTLKACGEGRALTTGHAVHGE 178
+WNT++ GY + EA++ F + +E SP E T L AC A G +HG
Sbjct: 465 SWNTIIGGYSKNCYANEALSLFNLLLEEKRFSPDERTVACVLPACASLSAFDKGREIHGY 524

Query: 179 MIKRGWEGNLDLNNSLVDFYGKCGSVLEARMLFDLLPVRSAVSWTALISGYAEIGLGYEV 358
+++ G+ + + NSLVD Y KCG++L A MLFD + + VSWT +I+GY G G E
Sbjct: 525 IMRNGYFSDRHVANSLVDMYAKCGALLLAHMLFDDIASKDLVSWTVMIAGYGMHGFGKEA 584

Query: 359 LDCFRQMQTEAIFLDRVVFICSLKACNMFEAFEIGRILHSHVVKRGW 499
+ F QM+ I D + F+ L AC+ HS +V GW
Sbjct: 585 IALFNQMRQAGIEADEISFVSLLYACS-----------HSGLVDEGW 620



Score = 107 bits (268), Expect = 4e-23
Identities = 67/207 (32%), Positives = 99/207 (47%)
Frame = +2

Query: 5 WNTLLAGYINYGFPEEAINCFERMQQEGVSPVEVTFVHTLKACGEGRALTTGHAVHGEMI 184
WN L+ G +I F++M GV TF K+ R++ G +HG ++
Sbjct: 163 WNILMNELAKSGDFSGSIGLFKKMMSSGVEMDSYTFSCVSKSFSSLRSVHGGEQLHGFIL 222

Query: 185 KRGWEGNLDLNNSLVDFYGKCGSVLEARMLFDLLPVRSAVSWTALISGYAEIGLGYEVLD 364
K G+ + NSLV FY K V AR +FD + R +SW ++I+GY GL + L
Sbjct: 223 KSGFGERNSVGNSLVAFYLKNQRVDSARKVFDEMTERDVISWNSIINGYVSNGLAEKGLS 282

Query: 365 CFRQMQTEAIFLDRVVFICSLKACNMFEAFEIGRILHSHVVKRGWERDVTIGNMLLIMYA 544
F QM I +D + C +GR +HS VK + R+ N LL MY+
Sbjct: 283 VFVQMLVSGIEIDLATIVSVFAGCADSRLISLGRAVHSIGVKACFSREDRFCNTLLDMYS 342

Query: 545 KCGFLAEAQVLFDELQVQSAESWALLI 625
KCG L A+ +F E+ +S S+ +I
Sbjct: 343 KCGDLDSAKAVFREMSDRSVVSYTSMI 369



Score = 77.0 bits (188), Expect = 7e-14
Identities = 51/206 (24%), Positives = 93/206 (45%)
Frame = +2

Query: 8 NTLLAGYINYGFPEEAINCFERMQQEGVSPVEVTFVHTLKACGEGRALTTGHAVHGEMIK 187
NT L + G E A+ + + P T L+ C + ++L G V +
Sbjct: 65 NTQLRRFCESGNLENAVKLLCVSGKWDIDPR--TLCSVLQLCADSKSLKDGKEVDNFIRG 122

Query: 188 RGWEGNLDLNNSLVDFYGKCGSVLEARMLFDLLPVRSAVSWTALISGYAEIGLGYEVLDC 367
G+ + +L + L Y CG + EA +FD + + A+ W L++ A+ G +
Sbjct: 123 NGFVIDSNLGSKLSLMYTNCGDLKEASRVFDEVKIEKALFWNILMNELAKSGDFSGSIGL 182

Query: 368 FRQMQTEAIFLDRVVFICSLKACNMFEAFEIGRILHSHVVKRGWERDVTIGNMLLIMYAK 547
F++M + + +D F C K+ + + G LH ++K G+ ++GN L+ Y K
Sbjct: 183 FKKMMSSGVEMDSYTFSCVSKSFSSLRSVHGGEQLHGFILKSGFGERNSVGNSLVAFYLK 242

Query: 548 CGFLAEAQVLFDELQVQSAESWALLI 625
+ A+ +FDE+ + SW +I
Sbjct: 243 NQRVDSARKVFDEMTERDVISWNSII 268


>sp|P93005|PP181_ARATH Pentatricopeptide repeat-containing protein
At2g33680 OS=Arabidopsis thaliana GN=PCMP-E19 PE=2 SV=1
Length = 727

Score = 138 bits (348), Expect = 2e-32
Identities = 73/207 (35%), Positives = 107/207 (51%)
Frame = +2

Query: 5 WNTLLAGYINYGFPEEAINCFERMQQEGVSPVEVTFVHTLKACGEGRALTTGHAVHGEMI 184
W+ ++ GY G EA+ F RM G+ P E T V L AC + L G +H ++
Sbjct: 290 WSAMVTGYSQNGESLEAVKLFSRMFSAGIKPSEYTIVGVLNACSDICYLEEGKQLHSFLL 349

Query: 185 KRGWEGNLDLNNSLVDFYGKCGSVLEARMLFDLLPVRSAVSWTALISGYAEIGLGYEVLD 364
K G+E +L +LVD Y K G + +AR FD L R WT+LISGY + E L
Sbjct: 350 KLGFERHLFATTALVDMYAKAGCLADARKGFDCLQERDVALWTSLISGYVQNSDNEEALI 409

Query: 365 CFRQMQTEAIFLDRVVFICSLKACNMFEAFEIGRILHSHVVKRGWERDVTIGNMLLIMYA 544
+R+M+T I + LKAC+ E+G+ +H H +K G+ +V IG+ L MY+
Sbjct: 410 LYRRMKTAGIIPNDPTMASVLKACSSLATLELGKQVHGHTIKHGFGLEVPIGSALSTMYS 469

Query: 545 KCGFLAEAQVLFDELQVQSAESWALLI 625
KCG L + ++F + SW +I
Sbjct: 470 KCGSLEDGNLVFRRTPNKDVVSWNAMI 496



Score = 115 bits (288), Expect = 2e-25
Identities = 73/210 (34%), Positives = 112/210 (53%), Gaps = 3/210 (1%)
Frame = +2

Query: 5 WNTLLAGYINYGFPEEAI---NCFERMQQEGVSPVEVTFVHTLKACGEGRALTTGHAVHG 175
W+T+++GY G EEAI N F R ++EG S + F L + + G +H
Sbjct: 187 WSTMVSGYATRGRVEEAIKVFNLFLREKEEG-SDSDYVFTAVLSSLAATIYVGLGRQIHC 245

Query: 176 EMIKRGWEGNLDLNNSLVDFYGKCGSVLEARMLFDLLPVRSAVSWTALISGYAEIGLGYE 355
IK G G + L+N+LV Y KC S+ EA +FD R++++W+A+++GY++ G E
Sbjct: 246 ITIKNGLLGFVALSNALVTMYSKCESLNEACKMFDSSGDRNSITWSAMVTGYSQNGESLE 305

Query: 356 VLDCFRQMQTEAIFLDRVVFICSLKACNMFEAFEIGRILHSHVVKRGWERDVTIGNMLLI 535
+ F +M + I + L AC+ E G+ LHS ++K G+ER + L+
Sbjct: 306 AVKLFSRMFSAGIKPSEYTIVGVLNACSDICYLEEGKQLHSFLLKLGFERHLFATTALVD 365

Query: 536 MYAKCGFLAEAQVLFDELQVQSAESWALLI 625
MYAK G LA+A+ FD LQ + W LI
Sbjct: 366 MYAKAGCLADARKGFDCLQERDVALWTSLI 395



Score = 106 bits (265), Expect = 9e-23
Identities = 56/165 (33%), Positives = 84/165 (50%)
Frame = +2

Query: 5 WNTLLAGYINYGFPEEAINCFERMQQEGVSPVEVTFVHTLKACGEGRALTTGHAVHGEMI 184
W +L++GY+ EEA+ + RM+ G+ P + T LKAC L G VHG I
Sbjct: 391 WTSLISGYVQNSDNEEALILYRRMKTAGIIPNDPTMASVLKACSSLATLELGKQVHGHTI 450

Query: 185 KRGWEGNLDLNNSLVDFYGKCGSVLEARMLFDLLPVRSAVSWTALISGYAEIGLGYEVLD 364
K G+ + + ++L Y KCGS+ + ++F P + VSW A+ISG + G G E L+
Sbjct: 451 KHGFGLEVPIGSALSTMYSKCGSLEDGNLVFRRTPNKDVVSWNAMISGLSHNGQGDEALE 510

Query: 365 CFRQMQTEAIFLDRVVFICSLKACNMFEAFEIGRILHSHVVKRGW 499
F +M E + D V F+ + AC+ H V+RGW
Sbjct: 511 LFEEMLAEGMEPDDVTFVNIISACS-----------HKGFVERGW 544



Score = 94.7 bits (234), Expect = 3e-19
Identities = 53/185 (28%), Positives = 95/185 (51%), Gaps = 3/185 (1%)
Frame = +2

Query: 80 QEGVSPVEVTFVHTLKACGEGRALTTGHAVHGEMIKRGWEGNLDLNNSLVDFYGKCGSVL 259
Q ++P T + L + R L G AVHG++I+ G + N LV+FY KCG +
Sbjct: 7 QTELNPHTSTLLKKLTHHSQQRNLVAGRAVHGQIIRTGASTCIQHANVLVNFYAKCGKLA 66

Query: 260 EARMLFDLLPVRSAVSWTALISGYAE---IGLGYEVLDCFRQMQTEAIFLDRVVFICSLK 430
+A +F+ + + VSW +LI+GY++ I Y V+ FR+M+ + I + K
Sbjct: 67 KAHSIFNAIICKDVVSWNSLITGYSQNGGISSSYTVMQLFREMRAQDILPNAYTLAGIFK 126

Query: 431 ACNMFEAFEIGRILHSHVVKRGWERDVTIGNMLLIMYAKCGFLAEAQVLFDELQVQSAES 610
A + ++ +GR H+ VVK D+ + L+ MY K G + + +F + ++ +
Sbjct: 127 AESSLQSSTVGRQAHALVVKMSSFGDIYVDTSLVGMYCKAGLVEDGLKVFAYMPERNTYT 186

Query: 611 WALLI 625
W+ ++
Sbjct: 187 WSTMV 191



Score = 86.7 bits (213), Expect = 9e-17
Identities = 58/214 (27%), Positives = 101/214 (47%), Gaps = 6/214 (2%)
Frame = +2

Query: 2 AWNTLLAGYINYGFPEEA---INCFERMQQEGVSPVEVTFVHTLKACGEGRALTTGHAVH 172
+WN+L+ GY G + + F M+ + + P T KA ++ T G H
Sbjct: 82 SWNSLITGYSQNGGISSSYTVMQLFREMRAQDILPNAYTLAGIFKAESSLQSSTVGRQAH 141

Query: 173 GEMIKRGWEGNLDLNNSLVDFYGKCGSVLEARMLFDLLPVRSAVSWTALISGYAEIGL-- 346
++K G++ ++ SLV Y K G V + +F +P R+ +W+ ++SGYA G
Sbjct: 142 ALVVKMSSFGDIYVDTSLVGMYCKAGLVEDGLKVFAYMPERNTYTWSTMVSGYATRGRVE 201

Query: 347 -GYEVLDCFRQMQTEAIFLDRVVFICSLKACNMFEAFEIGRILHSHVVKRGWERDVTIGN 523
+V + F + + E D VF L + +GR +H +K G V + N
Sbjct: 202 EAIKVFNLFLREKEEGSDSD-YVFTAVLSSLAATIYVGLGRQIHCITIKNGLLGFVALSN 260

Query: 524 MLLIMYAKCGFLAEAQVLFDELQVQSAESWALLI 625
L+ MY+KC L EA +FD +++ +W+ ++
Sbjct: 261 ALVTMYSKCESLNEACKMFDSSGDRNSITWSAMV 294



Score = 51.2 bits (121), Expect = 4e-06
Identities = 33/122 (27%), Positives = 58/122 (47%), Gaps = 7/122 (5%)
Frame = +2

Query: 2 AWNTLLAGYINYGFPEEAINCFERMQQEGVSPVEVTFVHTLKACGEGRALTTGHAVHGEM 181
+WN +++G + G +EA+ FE M EG+ P +VTFV+ + AC + G M
Sbjct: 491 SWNAMISGLSHNGQGDEALELFEEMLAEGMEPDDVTFVNIISACSHKGFVERGWFYFNMM 550

Query: 182 IKR-GWEGNLDLNNSLVDFYGKCGSVLEARMLFDLLPVRSAVS-WTALIS-----GYAEI 340
+ G + +D +VD + G + EA+ + + + W L+S G E+
Sbjct: 551 SDQIGLDPKVDHYACMVDLLSRAGQLKEAKEFIESANIDHGLCLWRILLSACKNHGKCEL 610

Query: 341 GL 346
G+
Sbjct: 611 GV 612


>sp|Q9M9E2|PPR45_ARATH Pentatricopeptide repeat-containing protein
At1g15510, chloroplastic OS=Arabidopsis thaliana
GN=PCMP-H73 PE=2 SV=1
Length = 866

Score = 138 bits (347), Expect = 3e-32
Identities = 73/209 (34%), Positives = 116/209 (55%), Gaps = 1/209 (0%)
Frame = +2

Query: 2 AWNTLLAGYINYGFPEEAINCFERMQQEG-VSPVEVTFVHTLKACGEGRALTTGHAVHGE 178
+WN L+ GY G+ +EA+ + RM G V P TF L+ CG L G VH
Sbjct: 162 SWNVLVGGYAKQGYFDEAMCLYHRMLWVGGVKPDVYTFPCVLRTCGGIPDLARGKEVHVH 221

Query: 179 MIKRGWEGNLDLNNSLVDFYGKCGSVLEARMLFDLLPVRSAVSWTALISGYAEIGLGYEV 358
+++ G+E ++D+ N+L+ Y KCG V AR+LFD +P R +SW A+ISGY E G+ +E
Sbjct: 222 VVRYGYELDIDVVNALITMYVKCGDVKSARLLFDRMPRRDIISWNAMISGYFENGMCHEG 281

Query: 359 LDCFRQMQTEAIFLDRVVFICSLKACNMFEAFEIGRILHSHVVKRGWERDVTIGNMLLIM 538
L+ F M+ ++ D + + AC + +GR +H++V+ G+ D+++ N L M
Sbjct: 282 LELFFAMRGLSVDPDLMTLTSVISACELLGDRRLGRDIHAYVITTGFAVDISVCNSLTQM 341

Query: 539 YAKCGFLAEAQVLFDELQVQSAESWALLI 625
Y G EA+ LF ++ + SW +I
Sbjct: 342 YLNAGSWREAEKLFSRMERKDIVSWTTMI 370



Score = 106 bits (264), Expect = 1e-22
Identities = 63/208 (30%), Positives = 107/208 (51%)
Frame = +2

Query: 2 AWNTLLAGYINYGFPEEAINCFERMQQEGVSPVEVTFVHTLKACGEGRALTTGHAVHGEM 181
+W T+++GY P++AI+ + M Q+ V P E+T L AC L TG +H
Sbjct: 365 SWTTMISGYEYNFLPDKAIDTYRMMDQDSVKPDEITVAAVLSACATLGDLDTGVELHKLA 424

Query: 182 IKRGWEGNLDLNNSLVDFYGKCGSVLEARMLFDLLPVRSAVSWTALISGYAEIGLGYEVL 361
IK + + N+L++ Y KC + +A +F +P ++ +SWT++I+G +E L
Sbjct: 425 IKARLISYVIVANNLINMYSKCKCIDKALDIFHNIPRKNVISWTSIIAGLRLNNRCFEAL 484

Query: 362 DCFRQMQTEAIFLDRVVFICSLKACNMFEAFEIGRILHSHVVKRGWERDVTIGNMLLIMY 541
RQM+ + + + +L AC A G+ +H+HV++ G D + N LL MY
Sbjct: 485 IFLRQMKM-TLQPNAITLTAALAACARIGALMCGKEIHAHVLRTGVGLDDFLPNALLDMY 543

Query: 542 AKCGFLAEAQVLFDELQVQSAESWALLI 625
+CG + A F+ Q + SW +L+
Sbjct: 544 VRCGRMNTAWSQFNS-QKKDVTSWNILL 570



Score = 100 bits (248), Expect = 8e-21
Identities = 59/208 (28%), Positives = 95/208 (45%)
Frame = +2

Query: 2 AWNTLLAGYINYGFPEEAINCFERMQQEGVSPVEVTFVHTLKACGEGRALTTGHAVHGEM 181
+WN +++GY G E + F M+ V P +T + AC G +H +
Sbjct: 264 SWNAMISGYFENGMCHEGLELFFAMRGLSVDPDLMTLTSVISACELLGDRRLGRDIHAYV 323

Query: 182 IKRGWEGNLDLNNSLVDFYGKCGSVLEARMLFDLLPVRSAVSWTALISGYAEIGLGYEVL 361
I G+ ++ + NSL Y GS EA LF + + VSWT +ISGY L + +
Sbjct: 324 ITTGFAVDISVCNSLTQMYLNAGSWREAEKLFSRMERKDIVSWTTMISGYEYNFLPDKAI 383

Query: 362 DCFRQMQTEAIFLDRVVFICSLKACNMFEAFEIGRILHSHVVKRGWERDVTIGNMLLIMY 541
D +R M +++ D + L AC + G LH +K V + N L+ MY
Sbjct: 384 DTYRMMDQDSVKPDEITVAAVLSACATLGDLDTGVELHKLAIKARLISYVIVANNLINMY 443

Query: 542 AKCGFLAEAQVLFDELQVQSAESWALLI 625
+KC + +A +F + ++ SW +I
Sbjct: 444 SKCKCIDKALDIFHNIPRKNVISWTSII 471



Score = 97.4 bits (241), Expect = 5e-20
Identities = 60/207 (28%), Positives = 101/207 (48%), Gaps = 1/207 (0%)
Frame = +2

Query: 8 NTLLAGYINYGFPEEAINCFERMQQEGVSPVEVTFVHTLKACGEGRALTTGHAVHGEMIK 187
N+ L G G EEA+ MQ+ V+ E FV ++ C RA G V+ +
Sbjct: 63 NSQLHGLCANGKLEEAMKLLNSMQELRVAVDEDVFVALVRLCEWKRAQEEGSKVYSIALS 122

Query: 188 RGWEGNLDLNNSLVDFYGKCGSVLEARMLFDLLPVRSAVSWTALISGYAEIGLGYEVLDC 367
++L N+ + + + G++++A +F + R+ SW L+ GYA+ G E +
Sbjct: 123 SMSSLGVELGNAFLAMFVRFGNLVDAWYVFGKMSERNLFSWNVLVGGYAKQGYFDEAMCL 182

Query: 368 F-RQMQTEAIFLDRVVFICSLKACNMFEAFEIGRILHSHVVKRGWERDVTIGNMLLIMYA 544
+ R + + D F C L+ C G+ +H HVV+ G+E D+ + N L+ MY
Sbjct: 183 YHRMLWVGGVKPDVYTFPCVLRTCGGIPDLARGKEVHVHVVRYGYELDIDVVNALITMYV 242

Query: 545 KCGFLAEAQVLFDELQVQSAESWALLI 625
KCG + A++LFD + + SW +I
Sbjct: 243 KCGDVKSARLLFDRMPRRDIISWNAMI 269



Score = 67.4 bits (163), Expect = 6e-11
Identities = 50/198 (25%), Positives = 89/198 (44%)
Frame = +2

Query: 2 AWNTLLAGYINYGFPEEAINCFERMQQEGVSPVEVTFVHTLKACGEGRALTTGHAVHGEM 181
+W +++AG EA+ F R + + P +T L AC AL G +H +
Sbjct: 466 SWTSIIAGLRLNNRCFEAL-IFLRQMKMTLQPNAITLTAALAACARIGALMCGKEIHAHV 524

Query: 182 IKRGWEGNLDLNNSLVDFYGKCGSVLEARMLFDLLPVRSAVSWTALISGYAEIGLGYEVL 361
++ G + L N+L+D Y +CG + A F+ + SW L++GY+E G G V+
Sbjct: 525 LRTGVGLDDFLPNALLDMYVRCGRMNTAWSQFNSQK-KDVTSWNILLTGYSERGQGSMVV 583

Query: 362 DCFRQMQTEAIFLDRVVFICSLKACNMFEAFEIGRILHSHVVKRGWERDVTIGNMLLIMY 541
+ F +M + D + FI L C+ + G + S + G ++ ++ +
Sbjct: 584 ELFDRMVKSRVRPDEITFISLLCGCSKSQMVRQGLMYFSKMEDYGVTPNLKHYACVVDLL 643

Query: 542 AKCGFLAEAQVLFDELQV 595
+ G L EA ++ V
Sbjct: 644 GRAGELQEAHKFIQKMPV 661



Score = 56.6 bits (135), Expect = 1e-07
Identities = 42/153 (27%), Positives = 67/153 (43%), Gaps = 5/153 (3%)
Frame = +2

Query: 2 AWNTLLAGYINYGFPEEAINCFERMQQEGVSPVEVTFVHTLKACGEGRALTTGHAVHGEM 181
+WN LL GY G + F+RM + V P E+TF+ L C + + + G +M
Sbjct: 565 SWNILLTGYSERGQGSMVVELFDRMVKSRVRPDEITFISLLCGCSKSQMVRQGLMYFSKM 624

Query: 182 IKRGWEGNLDLNNSLVDFYGKCGSVLEARMLFDLLPVR-SAVSWTALISG---YAEIGLG 349
G NL +VD G+ G + EA +PV W AL++ + +I LG
Sbjct: 625 EDYGVTPNLKHYACVVDLLGRAGELQEAHKFIQKMPVTPDPAVWGALLNACRIHHKIDLG 684

Query: 350 YEVLDCFRQMQTEAIF-LDRVVFICSLKACNMF 445
++ + IF LD+ + CN++
Sbjct: 685 --------ELSAQHIFELDKKSVGYYILLCNLY 709


>sp|Q0WNP3|PP319_ARATH Pentatricopeptide repeat-containing protein
At4g18520 OS=Arabidopsis thaliana GN=PCMP-A2 PE=2 SV=1
Length = 617

Score = 137 bits (346), Expect = 3e-32
Identities = 76/207 (36%), Positives = 117/207 (56%)
Frame = +2

Query: 5 WNTLLAGYINYGFPEEAINCFERMQQEGVSPVEVTFVHTLKACGEGRALTTGHAVHGEMI 184
W +++A + GF EEAI+ F M++ + +T V L+ACG AL G +H ++I
Sbjct: 353 WTSIIAAHAREGFGEEAISLFRIMKRRHLIANNLTVVSILRACGSVGALLLGKELHAQII 412

Query: 185 KRGWEGNLDLNNSLVDFYGKCGSVLEARMLFDLLPVRSAVSWTALISGYAEIGLGYEVLD 364
K E N+ + ++LV Y KCG +A + LP R VSWTA+ISG + +G E LD
Sbjct: 413 KNSIEKNVYIGSTLVWLYCKCGESRDAFNVLQQLPSRDVVSWTAMISGCSSLGHESEALD 472

Query: 365 CFRQMQTEAIFLDRVVFICSLKACNMFEAFEIGRILHSHVVKRGWERDVTIGNMLLIMYA 544
++M E + + + +LKAC E+ IGR +HS K +V +G+ L+ MYA
Sbjct: 473 FLKEMIQEGVEPNPFTYSSALKACANSESLLIGRSIHSIAKKNHALSNVFVGSALIHMYA 532

Query: 545 KCGFLAEAQVLFDELQVQSAESWALLI 625
KCGF++EA +FD + ++ SW +I
Sbjct: 533 KCGFVSEAFRVFDSMPEKNLVSWKAMI 559



Score = 130 bits (326), Expect = 7e-30
Identities = 76/209 (36%), Positives = 112/209 (53%), Gaps = 2/209 (0%)
Frame = +2

Query: 5 WNTLLAGYINYGFPEEAINCFERMQQEGVSPV-EVTFVHTLKACGEGRALTTGHAVHGEM 181
W ++ GY+ YG +EA FE + G+ E FV L C G VHG M
Sbjct: 151 WTAMIDGYLKYGLEDEAFALFEDYVKHGIRFTNERMFVCLLNLCSRRAEFELGRQVHGNM 210

Query: 182 IKRGWEGNLDLNNSLVDFYGKCGSVLEARMLFDLLPVRSAVSWTALISGYAEIGLGYEVL 361
+K G GNL + +SLV FY +CG + A FD++ + +SWTA+IS + G G + +
Sbjct: 211 VKVG-VGNLIVESSLVYFYAQCGELTSALRAFDMMEEKDVISWTAVISACSRKGHGIKAI 269

Query: 362 DCFRQMQTEAIFLDRVVFICS-LKACNMFEAFEIGRILHSHVVKRGWERDVTIGNMLLIM 538
F M FL +CS LKAC+ +A GR +HS VVKR + DV +G L+ M
Sbjct: 270 GMFIGMLNH-WFLPNEFTVCSILKACSEEKALRFGRQVHSLVVKRMIKTDVFVGTSLMDM 328

Query: 539 YAKCGFLAEAQVLFDELQVQSAESWALLI 625
YAKCG +++ + +FD + ++ +W +I
Sbjct: 329 YAKCGEISDCRKVFDGMSNRNTVTWTSII 357



Score = 125 bits (314), Expect = 2e-28
Identities = 65/208 (31%), Positives = 110/208 (52%)
Frame = +2

Query: 2 AWNTLLAGYINYGFPEEAINCFERMQQEGVSPVEVTFVHTLKACGEGRALTTGHAVHGEM 181
+W +++ G +AI F M P E T LKAC E +AL G VH +
Sbjct: 251 SWTAVISACSRKGHGIKAIGMFIGMLNHWFLPNEFTVCSILKACSEEKALRFGRQVHSLV 310

Query: 182 IKRGWEGNLDLNNSLVDFYGKCGSVLEARMLFDLLPVRSAVSWTALISGYAEIGLGYEVL 361
+KR + ++ + SL+D Y KCG + + R +FD + R+ V+WT++I+ +A G G E +
Sbjct: 311 VKRMIKTDVFVGTSLMDMYAKCGEISDCRKVFDGMSNRNTVTWTSIIAAHAREGFGEEAI 370

Query: 362 DCFRQMQTEAIFLDRVVFICSLKACNMFEAFEIGRILHSHVVKRGWERDVTIGNMLLIMY 541
FR M+ + + + + L+AC A +G+ LH+ ++K E++V IG+ L+ +Y
Sbjct: 371 SLFRIMKRRHLIANNLTVVSILRACGSVGALLLGKELHAQIIKNSIEKNVYIGSTLVWLY 430

Query: 542 AKCGFLAEAQVLFDELQVQSAESWALLI 625
KCG +A + +L + SW +I
Sbjct: 431 CKCGESRDAFNVLQQLPSRDVVSWTAMI 458



Score = 98.2 bits (243), Expect = 3e-20
Identities = 51/152 (33%), Positives = 77/152 (50%)
Frame = +2

Query: 2 AWNTLLAGYINYGFPEEAINCFERMQQEGVSPVEVTFVHTLKACGEGRALTTGHAVHGEM 181
+W +++G + G EA++ + M QEGV P T+ LKAC +L G ++H
Sbjct: 453 SWTAMISGCSSLGHESEALDFLKEMIQEGVEPNPFTYSSALKACANSESLLIGRSIHSIA 512

Query: 182 IKRGWEGNLDLNNSLVDFYGKCGSVLEARMLFDLLPVRSAVSWTALISGYAEIGLGYEVL 361
K N+ + ++L+ Y KCG V EA +FD +P ++ VSW A+I GYA G E L
Sbjct: 513 KKNHALSNVFVGSALIHMYAKCGFVSEAFRVFDSMPEKNLVSWKAMIMGYARNGFCREAL 572

Query: 362 DCFRQMQTEAIFLDRVVFICSLKACNMFEAFE 457
+M+ E +D +F L C E E
Sbjct: 573 KLMYRMEAEGFEVDDYIFATILSTCGDIELDE 604



Score = 83.2 bits (204), Expect = 1e-15
Identities = 47/154 (30%), Positives = 81/154 (52%), Gaps = 1/154 (0%)
Frame = +2

Query: 167 VHGEMIKRGWEGNLDLNNSLVDFYGKCGSVLEARMLFDLLPVRSAVSWTALISGYAEIGL 346
+H +K + + N+L+ + G ++ AR +FD +P ++ V+WTA+I GY + GL
Sbjct: 104 IHAMALKCFDDQVIYFGNNLISSCVRLGDLVYARKVFDSMPEKNTVTWTAMIDGYLKYGL 163

Query: 347 GYEVLDCFRQMQTEAI-FLDRVVFICSLKACNMFEAFEIGRILHSHVVKRGWERDVTIGN 523
E F I F + +F+C L C+ FE+GR +H ++VK G ++ + +
Sbjct: 164 EDEAFALFEDYVKHGIRFTNERMFVCLLNLCSRRAEFELGRQVHGNMVKVG-VGNLIVES 222

Query: 524 MLLIMYAKCGFLAEAQVLFDELQVQSAESWALLI 625
L+ YA+CG L A FD ++ + SW +I
Sbjct: 223 SLVYFYAQCGELTSALRAFDMMEEKDVISWTAVI 256


>sp|P0C898|PP232_ARATH Putative pentatricopeptide repeat-containing
protein At3g15130 OS=Arabidopsis thaliana GN=PCMP-H86
PE=3 SV=1
Length = 689

Score = 136 bits (343), Expect = 8e-32
Identities = 75/212 (35%), Positives = 118/212 (55%), Gaps = 4/212 (1%)
Frame = +2

Query: 2 AWNTLLAGYINYGFPEEAINCFERMQQEGVSPVEVTFVHTLKACGEGRALTTGHAVHGEM 181
+W+ L++G++ G + +++ F M ++G+ P E TF LKACG AL G +HG
Sbjct: 74 SWSALMSGHVLNGDLKGSLSLFSEMGRQGIYPNEFTFSTNLKACGLLNALEKGLQIHGFC 133

Query: 182 IKRGWEGNLDLNNSLVDFYGKCGSVLEARMLFDLLPVRSAVSWTALISGYAEIGLGYEVL 361
+K G+E +++ NSLVD Y KCG + EA +F + RS +SW A+I+G+ G G + L
Sbjct: 134 LKIGFEMMVEVGNSLVDMYSKCGRINEAEKVFRRIVDRSLISWNAMIAGFVHAGYGSKAL 193

Query: 362 DCFRQMQTEAI--FLDRVVFICSLKACNMFEAFEIGRILHSHVVKRGWE--RDVTIGNML 529
D F MQ I D LKAC+ G+ +H +V+ G+ TI L
Sbjct: 194 DTFGMMQEANIKERPDEFTLTSLLKACSSTGMIYAGKQIHGFLVRSGFHCPSSATITGSL 253

Query: 530 LIMYAKCGFLAEAQVLFDELQVQSAESWALLI 625
+ +Y KCG+L A+ FD+++ ++ SW+ LI
Sbjct: 254 VDLYVKCGYLFSARKAFDQIKEKTMISWSSLI 285



Score = 116 bits (290), Expect = 1e-25
Identities = 62/212 (29%), Positives = 111/212 (52%), Gaps = 4/212 (1%)
Frame = +2

Query: 2 AWNTLLAGYINYGFPEEAINCFERMQQEGVS--PVEVTFVHTLKACGEGRALTTGHAVHG 175
+WN ++AG+++ G+ +A++ F MQ+ + P E T LKAC + G +HG
Sbjct: 175 SWNAMIAGFVHAGYGSKALDTFGMMQEANIKERPDEFTLTSLLKACSSTGMIYAGKQIHG 234

Query: 176 EMIKRGWE--GNLDLNNSLVDFYGKCGSVLEARMLFDLLPVRSAVSWTALISGYAEIGLG 349
+++ G+ + + SLVD Y KCG + AR FD + ++ +SW++LI GYA+ G
Sbjct: 235 FLVRSGFHCPSSATITGSLVDLYVKCGYLFSARKAFDQIKEKTMISWSSLILGYAQEGEF 294

Query: 350 YEVLDCFRQMQTEAIFLDRVVFICSLKACNMFEAFEIGRILHSHVVKRGWERDVTIGNML 529
E + F+++Q +D + F G+ + + VK + ++ N +
Sbjct: 295 VEAMGLFKRLQELNSQIDSFALSSIIGVFADFALLRQGKQMQALAVKLPSGLETSVLNSV 354

Query: 530 LIMYAKCGFLAEAQVLFDELQVQSAESWALLI 625
+ MY KCG + EA+ F E+Q++ SW ++I
Sbjct: 355 VDMYLKCGLVDEAEKCFAEMQLKDVISWTVVI 386



Score = 106 bits (264), Expect = 1e-22
Identities = 62/171 (36%), Positives = 91/171 (53%)
Frame = +2

Query: 113 VHTLKACGEGRALTTGHAVHGEMIKRGWEGNLDLNNSLVDFYGKCGSVLEARMLFDLLPV 292
V L+ C G VH ++K G NL +N L+D Y KC L A +FD +P
Sbjct: 10 VSILRVCTRKGLSDQGGQVHCYLLKSGSGLNLITSNYLIDMYCKCREPLMAYKVFDSMPE 69

Query: 293 RSAVSWTALISGYAEIGLGYEVLDCFRQMQTEAIFLDRVVFICSLKACNMFEAFEIGRIL 472
R+ VSW+AL+SG+ G L F +M + I+ + F +LKAC + A E G +
Sbjct: 70 RNVVSWSALMSGHVLNGDLKGSLSLFSEMGRQGIYPNEFTFSTNLKACGLLNALEKGLQI 129

Query: 473 HSHVVKRGWERDVTIGNMLLIMYAKCGFLAEAQVLFDELQVQSAESWALLI 625
H +K G+E V +GN L+ MY+KCG + EA+ +F + +S SW +I
Sbjct: 130 HGFCLKIGFEMMVEVGNSLVDMYSKCGRINEAEKVFRRIVDRSLISWNAMI 180



Score = 76.6 bits (187), Expect = 9e-14
Identities = 54/204 (26%), Positives = 94/204 (46%), Gaps = 5/204 (2%)
Frame = +2

Query: 2 AWNTLLAGYINYGFPEEAINCFERMQQEGVSPVEVTFVHTLKACGEGRALTTGHAVHGEM 181
+W++L+ GY G EA+ F+R+Q+ + + L G +
Sbjct: 280 SWSSLILGYAQEGEFVEAMGLFKRLQELNSQIDSFALSSIIGVFADFALLRQGKQMQALA 339

Query: 182 IKRGWEGNLDLNNSLVDFYGKCGSVLEARMLFDLLPVRSAVSWTALISGYAEIGLGYEVL 361
+K + NS+VD Y KCG V EA F + ++ +SWT +I+GY + GLG + +
Sbjct: 340 VKLPSGLETSVLNSVVDMYLKCGLVDEAEKCFAEMQLKDVISWTVVITGYGKHGLGKKSV 399

Query: 362 DCFRQMQTEAIFLDRVVFICSLKACNMFEAFEIG-----RILHSHVVKRGWERDVTIGNM 526
F +M I D V ++ L AC+ + G ++L +H +K E + ++
Sbjct: 400 RIFYEMLRHNIEPDEVCYLAVLSACSHSGMIKEGEELFSKLLETHGIKPRVEHYACVVDL 459

Query: 527 LLIMYAKCGFLAEAQVLFDELQVQ 598
L + G L EA+ L D + ++
Sbjct: 460 L----GRAGRLKEAKHLIDTMPIK 479


>sp|Q9FXA9|PPR83_ARATH Putative pentatricopeptide repeat-containing
protein At1g56570 OS=Arabidopsis thaliana GN=PCMP-E64
PE=3 SV=1
Length = 611

Score = 134 bits (336), Expect = 5e-31
Identities = 65/209 (31%), Positives = 119/209 (56%), Gaps = 1/209 (0%)
Frame = +2

Query: 2 AWNTLLAGYINYGFPEEAINCFERMQQEGVSPVEVTFVHTLKACGEGRALTTGHAVHGEM 181
AW ++ GY + + A CF M ++G SP E T LK+C + L G VHG +
Sbjct: 78 AWTAMITGYASSNYNARAWECFHEMVKQGTSPNEFTLSSVLKSCRNMKVLAYGALVHGVV 137

Query: 182 IKRGWEGNLDLNNSLVDFYGKCGSVLEAR-MLFDLLPVRSAVSWTALISGYAEIGLGYEV 358
+K G EG+L ++N++++ Y C +EA ++F + V++ V+WT LI+G+ +G G
Sbjct: 138 VKLGMEGSLYVDNAMMNMYATCSVTMEAACLIFRDIKVKNDVTWTTLITGFTHLGDGIGG 197

Query: 359 LDCFRQMQTEAIFLDRVVFICSLKACNMFEAFEIGRILHSHVVKRGWERDVTIGNMLLIM 538
L ++QM E + +++A ++ G+ +H+ V+KRG++ ++ + N +L +
Sbjct: 198 LKMYKQMLLENAEVTPYCITIAVRASASIDSVTTGKQIHASVIKRGFQSNLPVMNSILDL 257

Query: 539 YAKCGFLAEAQVLFDELQVQSAESWALLI 625
Y +CG+L+EA+ F E++ + +W LI
Sbjct: 258 YCRCGYLSEAKHYFHEMEDKDLITWNTLI 286



Score = 109 bits (273), Expect = 1e-23
Identities = 64/210 (30%), Positives = 112/210 (53%), Gaps = 3/210 (1%)
Frame = +2

Query: 5 WNTLLAGYINYGFPEEAINCFERMQQEGVSPVEVTFVHTLKACGEGRALTTGHAVHGEMI 184
WNTL++ + EA+ F+R + +G P TF + AC AL G +HG +
Sbjct: 282 WNTLISE-LERSDSSEALLMFQRFESQGFVPNCYTFTSLVAACANIAALNCGQQLHGRIF 340

Query: 185 KRGWEGNLDLNNSLVDFYGKCGSVLEARMLF-DLLPVRSAVSWTALISGYAEIGLGYEVL 361
+RG+ N++L N+L+D Y KCG++ +++ +F +++ R+ VSWT+++ GY G G E +
Sbjct: 341 RRGFNKNVELANALIDMYAKCGNIPDSQRVFGEIVDRRNLVSWTSMMIGYGSHGYGAEAV 400

Query: 362 DCFRQMQTEAIFLDRVVFICSLKACNMFEAFEIG-RILHSHVVKRGWERDVTIGNMLLIM 538
+ F +M + I DR+VF+ L AC E G + + + G D I N ++ +
Sbjct: 401 ELFDKMVSSGIRPDRIVFMAVLSACRHAGLVEKGLKYFNVMESEYGINPDRDIYNCVVDL 460

Query: 539 YAKCGFLAEAQVLFDELQVQSAES-WALLI 625
+ G + EA L + + + ES W ++
Sbjct: 461 LGRAGKIGEAYELVERMPFKPDESTWGAIL 490



Score = 107 bits (266), Expect = 7e-23
Identities = 56/195 (28%), Positives = 101/195 (51%)
Frame = +2

Query: 5 WNTLLAGYINYGFPEEAINCFERMQQEGVSPVEVTFVHTLKACGEGRALTTGHAVHGEMI 184
W TL+ G+ + G + +++M E ++A ++TTG +H +I
Sbjct: 181 WTTLITGFTHLGDGIGGLKMYKQMLLENAEVTPYCITIAVRASASIDSVTTGKQIHASVI 240

Query: 185 KRGWEGNLDLNNSLVDFYGKCGSVLEARMLFDLLPVRSAVSWTALISGYAEIGLGYEVLD 364
KRG++ NL + NS++D Y +CG + EA+ F + + ++W LIS E E L
Sbjct: 241 KRGFQSNLPVMNSILDLYCRCGYLSEAKHYFHEMEDKDLITWNTLIS-ELERSDSSEALL 299

Query: 365 CFRQMQTEAIFLDRVVFICSLKACNMFEAFEIGRILHSHVVKRGWERDVTIGNMLLIMYA 544
F++ +++ + F + AC A G+ LH + +RG+ ++V + N L+ MYA
Sbjct: 300 MFQRFESQGFVPNCYTFTSLVAACANIAALNCGQQLHGRIFRRGFNKNVELANALIDMYA 359

Query: 545 KCGFLAEAQVLFDEL 589
KCG + ++Q +F E+
Sbjct: 360 KCGNIPDSQRVFGEI 374



Score = 84.7 bits (208), Expect = 3e-16
Identities = 46/137 (33%), Positives = 73/137 (53%), Gaps = 1/137 (0%)
Frame = +2

Query: 218 NSLVDFYGKCGSVLEARMLFDLLPVRSAVSWTALISGYAEIGLGYEVLDCFRQMQTEAIF 397
N +V ++ K G V EAR LFD +P R V+WTA+I+GYA +CF +M +
Sbjct: 50 NLIVSYFEK-GLVEEARSLFDEMPDRDVVAWTAMITGYASSNYNARAWECFHEMVKQGTS 108

Query: 398 LDRVVFICSLKACNMFEAFEIGRILHSHVVKRGWERDVTIGNMLLIMYAKCGFLAEAQ-V 574
+ LK+C + G ++H VVK G E + + N ++ MYA C EA +
Sbjct: 109 PNEFTLSSVLKSCRNMKVLAYGALVHGVVVKLGMEGSLYVDNAMMNMYATCSVTMEAACL 168

Query: 575 LFDELQVQSAESWALLI 625
+F +++V++ +W LI
Sbjct: 169 IFRDIKVKNDVTWTTLI 185



Score = 55.8 bits (133), Expect = 2e-07
Identities = 30/109 (27%), Positives = 55/109 (50%), Gaps = 2/109 (1%)
Frame = +2

Query: 2 AWNTLLAGYINYGFPEEAINCFERMQQEGVSPVEVTFVHTLKACGEGRALTTGHAVHGEM 181
+W +++ GY ++G+ EA+ F++M G+ P + F+ L AC + G M
Sbjct: 382 SWTSMMIGYGSHGYGAEAVELFDKMVSSGIRPDRIVFMAVLSACRHAGLVEKGLKYFNVM 441

Query: 182 -IKRGWEGNLDLNNSLVDFYGKCGSVLEARMLFDLLPVRSAVS-WTALI 322
+ G + D+ N +VD G+ G + EA L + +P + S W A++
Sbjct: 442 ESEYGINPDRDIYNCVVDLLGRAGKIGEAYELVERMPFKPDESTWGAIL 490


>sp|Q9LIC3|PP227_ARATH Putative pentatricopeptide repeat-containing
protein At3g13770, mitochondrial OS=Arabidopsis thaliana
GN=PCMP-H85 PE=3 SV=1
Length = 628

Score = 133 bits (335), Expect = 6e-31
Identities = 68/208 (32%), Positives = 114/208 (54%)
Frame = +2

Query: 2 AWNTLLAGYINYGFPEEAINCFERMQQEGVSPVEVTFVHTLKACGEGRALTTGHAVHGEM 181
+W +++ Y G EA+ F M + P E TF L +C L G +HG +
Sbjct: 120 SWTAMISRYSQTGHSSEALTVFAEMMRSDGKPNEFTFATVLTSCIRASGLGLGKQIHGLI 179

Query: 182 IKRGWEGNLDLNNSLVDFYGKCGSVLEARMLFDLLPVRSAVSWTALISGYAEIGLGYEVL 361
+K ++ ++ + +SL+D Y K G + EAR +F+ LP R VS TA+I+GYA++GL E L
Sbjct: 180 VKWNYDSHIFVGSSLLDMYAKAGQIKEAREIFECLPERDVVSCTAIIAGYAQLGLDEEAL 239

Query: 362 DCFRQMQTEAIFLDRVVFICSLKACNMFEAFEIGRILHSHVVKRGWERDVTIGNMLLIMY 541
+ F ++ +E + + V + L A + + G+ H HV++R + N L+ MY
Sbjct: 240 EMFHRLHSEGMSPNYVTYASLLTALSGLALLDHGKQAHCHVLRRELPFYAVLQNSLIDMY 299

Query: 542 AKCGFLAEAQVLFDELQVQSAESWALLI 625
+KCG L+ A+ LFD + ++A SW ++
Sbjct: 300 SKCGNLSYARRLFDNMPERTAISWNAML 327



Score = 106 bits (264), Expect = 1e-22
Identities = 57/143 (39%), Positives = 81/143 (56%), Gaps = 1/143 (0%)
Frame = +2

Query: 14 LLAGYINYGFPEEAINCFERMQQEGVSPVEVTFVHTLKACGEGRALTTGHAVHGEMIKRG 193
++AGY G EEA+ F R+ EG+SP VT+ L A L G H +++R
Sbjct: 225 IIAGYAQLGLDEEALEMFHRLHSEGMSPNYVTYASLLTALSGLALLDHGKQAHCHVLRRE 284

Query: 194 WEGNLDLNNSLVDFYGKCGSVLEARMLFDLLPVRSAVSWTALISGYAEIGLGYEVLDCFR 373
L NSL+D Y KCG++ AR LFD +P R+A+SW A++ GY++ GLG EVL+ FR
Sbjct: 285 LPFYAVLQNSLIDMYSKCGNLSYARRLFDNMPERTAISWNAMLVGYSKHGLGREVLELFR 344

Query: 374 QMQTE-AIFLDRVVFICSLKACN 439
M+ E + D V + L C+
Sbjct: 345 LMRDEKRVKPDAVTLLAVLSGCS 367



Score = 99.4 bits (246), Expect = 1e-20
Identities = 57/168 (33%), Positives = 87/168 (51%)
Frame = +2

Query: 122 LKACGEGRALTTGHAVHGEMIKRGWEGNLDLNNSLVDFYGKCGSVLEARMLFDLLPVRSA 301
L AC + RAL G VH MIK + L L+ FYGKC + +AR + D +P ++
Sbjct: 59 LNACLDKRALRDGQRVHAHMIKTRYLPATYLRTRLLIFYGKCDCLEDARKVLDEMPEKNV 118

Query: 302 VSWTALISGYAEIGLGYEVLDCFRQMQTEAIFLDRVVFICSLKACNMFEAFEIGRILHSH 481
VSWTA+IS Y++ G E L F +M + F L +C +G+ +H
Sbjct: 119 VSWTAMISRYSQTGHSSEALTVFAEMMRSDGKPNEFTFATVLTSCIRASGLGLGKQIHGL 178

Query: 482 VVKRGWERDVTIGNMLLIMYAKCGFLAEAQVLFDELQVQSAESWALLI 625
+VK ++ + +G+ LL MYAK G + EA+ +F+ L + S +I
Sbjct: 179 IVKWNYDSHIFVGSSLLDMYAKAGQIKEAREIFECLPERDVVSCTAII 226



Score = 50.1 bits (118), Expect = 9e-06
Identities = 31/122 (25%), Positives = 51/122 (41%), Gaps = 3/122 (2%)
Frame = +2

Query: 2 AWNTLLAGYINYGFPEEAINCFERMQQE-GVSPVEVTFVHTLKACGEGRALTTGHAVHGE 178
+WN +L GY +G E + F M+ E V P VT + L C GR TG +
Sbjct: 322 SWNAMLVGYSKHGLGREVLELFRLMRDEKRVKPDAVTLLAVLSGCSHGRMEDTGLNIFDG 381

Query: 179 MI--KRGWEGNLDLNNSLVDFYGKCGSVLEARMLFDLLPVRSAVSWTALISGYAEIGLGY 352
M+ + G + + +VD G+ G + EA +P + + G + L
Sbjct: 382 MVAGEYGTKPGTEHYGCIVDMLGRAGRIDEAFEFIKRMPSKPTAGVLGSLLGACRVHLSV 441

Query: 353 EV 358
++
Sbjct: 442 DI 443


>sp|Q9LUJ2|PP249_ARATH Pentatricopeptide repeat-containing protein
At3g22690 OS=Arabidopsis thaliana GN=PCMP-H56 PE=2 SV=1
Length = 842

Score = 131 bits (329), Expect = 3e-30
Identities = 71/195 (36%), Positives = 109/195 (55%), Gaps = 1/195 (0%)
Frame = +2

Query: 5 WNTLLAGYINYGFPEEAINCFERMQQEGVSPVEVTFVHTLKACGEGRALTTGHAVHGEMI 184
+N+L+ GY + G EAI F RM G+SP + TF L AC + RA G +HG ++
Sbjct: 102 YNSLIRGYASSGLCNEAILLFLRMMNSGISPDKYTFPFGLSACAKSRAKGNGIQIHGLIV 161

Query: 185 KRGWEGNLDLNNSLVDFYGKCGSVLEARMLFDLLPVRSAVSWTALISGYAEIGLGYEVLD 364
K G+ +L + NSLV FY +CG + AR +FD + R+ VSWT++I GYA + +D
Sbjct: 162 KMGYAKDLFVQNSLVHFYAECGELDSARKVFDEMSERNVVSWTSMICGYARRDFAKDAVD 221

Query: 365 C-FRQMQTEAIFLDRVVFICSLKACNMFEAFEIGRILHSHVVKRGWERDVTIGNMLLIMY 541
FR ++ E + + V +C + AC E E G +++ + G E + + + L+ MY
Sbjct: 222 LFFRMVRDEEVTPNSVTMVCVISACAKLEDLETGEKVYAFIRNSGIEVNDLMVSALVDMY 281

Query: 542 AKCGFLAEAQVLFDE 586
KC + A+ LFDE
Sbjct: 282 MKCNAIDVAKRLFDE 296



Score = 102 bits (253), Expect = 2e-21
Identities = 61/209 (29%), Positives = 103/209 (49%), Gaps = 1/209 (0%)
Frame = +2

Query: 2 AWNTLLAGYINYGFPEEAINCFERM-QQEGVSPVEVTFVHTLKACGEGRALTTGHAVHGE 178
+W +++ GY F ++A++ F RM + E V+P VT V + AC + L TG V+
Sbjct: 202 SWTSMICGYARRDFAKDAVDLFFRMVRDEEVTPNSVTMVCVISACAKLEDLETGEKVYAF 261

Query: 179 MIKRGWEGNLDLNNSLVDFYGKCGSVLEARMLFDLLPVRSAVSWTALISGYAEIGLGYEV 358
+ G E N + ++LVD Y KC ++ A+ LFD + A+ S Y GL E
Sbjct: 262 IRNSGIEVNDLMVSALVDMYMKCNAIDVAKRLFDEYGASNLDLCNAMASNYVRQGLTREA 321

Query: 359 LDCFRQMQTEAIFLDRVVFICSLKACNMFEAFEIGRILHSHVVKRGWERDVTIGNMLLIM 538
L F M + DR+ + ++ +C+ G+ H +V++ G+E I N L+ M
Sbjct: 322 LGVFNLMMDSGVRPDRISMLSAISSCSQLRNILWGKSCHGYVLRNGFESWDNICNALIDM 381

Query: 539 YAKCGFLAEAQVLFDELQVQSAESWALLI 625
Y KC A +FD + ++ +W ++
Sbjct: 382 YMKCHRQDTAFRIFDRMSNKTVVTWNSIV 410



Score = 100 bits (249), Expect = 6e-21
Identities = 57/238 (23%), Positives = 108/238 (45%), Gaps = 32/238 (13%)
Frame = +2

Query: 8 NTLLAGYINYGFPEEAINCFERMQQEGVSPVEVTFVHTLKACGEGRALTTGHAVHGEMIK 187
N + + Y+ G EA+ F M GV P ++ + + +C + R + G + HG +++
Sbjct: 306 NAMASNYVRQGLTREALGVFNLMMDSGVRPDRISMLSAISSCSQLRNILWGKSCHGYVLR 365

Query: 188 RGWEGNLDLNNSLVDFYGKCGSVLEARMLFDLLPVRSAVSWTALISGYAEIG-------- 343
G+E ++ N+L+D Y KC A +FD + ++ V+W ++++GY E G
Sbjct: 366 NGFESWDNICNALIDMYMKCHRQDTAFRIFDRMSNKTVVTWNSIVAGYVENGEVDAAWET 425

Query: 344 -----------------------LGYEVLDCFRQMQT-EAIFLDRVVFICSLKACNMFEA 451
L E ++ F MQ+ E + D V + AC A
Sbjct: 426 FETMPEKNIVSWNTIISGLVQGSLFEEAIEVFCSMQSQEGVNADGVTMMSIASACGHLGA 485

Query: 452 FEIGRILHSHVVKRGWERDVTIGNMLLIMYAKCGFLAEAQVLFDELQVQSAESWALLI 625
++ + ++ ++ K G + DV +G L+ M+++CG A +F+ L + +W I
Sbjct: 486 LDLAKWIYYYIEKNGIQLDVRLGTTLVDMFSRCGDPESAMSIFNSLTNRDVSAWTAAI 543



Score = 85.1 bits (209), Expect = 3e-16
Identities = 61/202 (30%), Positives = 100/202 (49%), Gaps = 3/202 (1%)
Frame = +2

Query: 2 AWNTLLAGYINYGFPEEAINCFERMQ-QEGVSPVEVTFVHTLKACGEGRALTTGHAVHGE 178
+WNT+++G + EEAI F MQ QEGV+ VT + ACG AL ++
Sbjct: 436 SWNTIISGLVQGSLFEEAIEVFCSMQSQEGVNADGVTMMSIASACGHLGALDLAKWIYYY 495

Query: 179 MIKRGWEGNLDLNNSLVDFYGKCGSVLEARMLFDLLPVRSAVSWTALISGYAEIGLGYEV 358
+ K G + ++ L +LVD + +CG A +F+ L R +WTA I A G
Sbjct: 496 IEKNGIQLDVRLGTTLVDMFSRCGDPESAMSIFNSLTNRDVSAWTAAIGAMAMAGNAERA 555

Query: 359 LDCFRQMQTEAIFLDRVVFICSLKACNMFEAFEIGR-ILHSHVVKRGWE-RDVTIGNMLL 532
++ F M + + D V F+ +L AC+ + G+ I +S + G DV G M+
Sbjct: 556 IELFDDMIEQGLKPDGVAFVGALTACSHGGLVQQGKEIFYSMLKLHGVSPEDVHYGCMVD 615

Query: 533 IMYAKCGFLAEAQVLFDELQVQ 598
++ + G L EA L +++ ++
Sbjct: 616 LL-GRAGLLEEAVQLIEDMPME 636



Score = 67.4 bits (163), Expect = 6e-11
Identities = 37/106 (34%), Positives = 56/106 (52%)
Frame = +2

Query: 308 WTALISGYAEIGLGYEVLDCFRQMQTEAIFLDRVVFICSLKACNMFEAFEIGRILHSHVV 487
+ +LI GYA GL E + F +M I D+ F L AC A G +H +V
Sbjct: 102 YNSLIRGYASSGLCNEAILLFLRMMNSGISPDKYTFPFGLSACAKSRAKGNGIQIHGLIV 161

Query: 488 KRGWERDVTIGNMLLIMYAKCGFLAEAQVLFDELQVQSAESWALLI 625
K G+ +D+ + N L+ YA+CG L A+ +FDE+ ++ SW +I
Sbjct: 162 KMGYAKDLFVQNSLVHFYAECGELDSARKVFDEMSERNVVSWTSMI 207


tr_hit_id Q5W964
Definition tr|Q5W964|Q5W964_PHYPA PPR986-12 OS=Physcomitrella patens
Align length 208
Score (bit) 161.0
E-value 3.0e-38
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= DK950369|Adiantum capillus-veneris mRNA, clone:
TST38A01NGRL0008_H15, 5'
(627 letters)

Database: uniprot_trembl.fasta
7,341,751 sequences; 2,391,615,440 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

tr|Q5W964|Q5W964_PHYPA PPR986-12 OS=Physcomitrella patens PE=2 SV=1 161 3e-38
tr|A9TNX6|A9TNX6_PHYPA Predicted protein OS=Physcomitrella paten... 161 3e-38
tr|B8LQA8|B8LQA8_PICSI Putative uncharacterized protein OS=Picea... 156 8e-37
tr|Q5W963|Q5W963_PHYPA PPR1106-17 OS=Physcomitrella patens PE=2 ... 155 2e-36
tr|A9T8E9|A9T8E9_PHYPA Predicted protein OS=Physcomitrella paten... 155 2e-36
tr|A9T5P5|A9T5P5_PHYPA Predicted protein OS=Physcomitrella paten... 155 2e-36
tr|A9T938|A9T938_PHYPA Predicted protein OS=Physcomitrella paten... 152 2e-35
tr|A2XK21|A2XK21_ORYSI Putative uncharacterized protein OS=Oryza... 150 5e-35
tr|B8LKN6|B8LKN6_PICSI Putative uncharacterized protein OS=Picea... 150 8e-35
tr|Q60DN6|Q60DN6_ORYSJ Os03g0644200 protein OS=Oryza sativa subs... 149 1e-34
tr|A9RJW2|A9RJW2_PHYPA Predicted protein OS=Physcomitrella paten... 149 1e-34
tr|A3AKS8|A3AKS8_ORYSJ Putative uncharacterized protein OS=Oryza... 149 1e-34
tr|A7PWA0|A7PWA0_VITVI Chromosome chr8 scaffold_34, whole genome... 149 2e-34
tr|A9U2Q7|A9U2Q7_PHYPA Predicted protein OS=Physcomitrella paten... 148 2e-34
tr|Q2HS18|Q2HS18_MEDTR Tetratricopeptide-like helical OS=Medicag... 148 3e-34
tr|A7P8G3|A7P8G3_VITVI Chromosome chr3 scaffold_8, whole genome ... 148 3e-34
tr|A7PDX6|A7PDX6_VITVI Chromosome chr11 scaffold_13, whole genom... 147 5e-34
tr|A9TDA2|A9TDA2_PHYPA Predicted protein OS=Physcomitrella paten... 146 9e-34
tr|A9SQ58|A9SQ58_PHYPA Predicted protein OS=Physcomitrella paten... 146 9e-34
tr|Q69UA3|Q69UA3_ORYSJ Os08g0538800 protein OS=Oryza sativa subs... 146 1e-33
tr|A2ZWA6|A2ZWA6_ORYSJ Putative uncharacterized protein OS=Oryza... 146 1e-33
tr|A9U4W7|A9U4W7_PHYPA Predicted protein OS=Physcomitrella paten... 145 1e-33
tr|A2YXJ8|A2YXJ8_ORYSI Putative uncharacterized protein OS=Oryza... 145 1e-33
tr|A7PXY9|A7PXY9_VITVI Chromosome chr15 scaffold_37, whole genom... 144 3e-33
tr|A7PXP2|A7PXP2_VITVI Chromosome chr12 scaffold_36, whole genom... 144 3e-33
tr|A7PL13|A7PL13_VITVI Chromosome chr7 scaffold_20, whole genome... 144 3e-33
tr|B6SWY6|B6SWY6_MAIZE Pentatricopeptide repeat protein PPR1106-... 144 4e-33
tr|A7QK10|A7QK10_VITVI Chromosome undetermined scaffold_109, who... 144 6e-33
tr|A7R1R7|A7R1R7_VITVI Chromosome chr4 scaffold_373, whole genom... 143 7e-33
tr|A7NXD6|A7NXD6_VITVI Chromosome chr5 scaffold_2, whole genome ... 142 1e-32

>tr|Q5W964|Q5W964_PHYPA PPR986-12 OS=Physcomitrella patens PE=2 SV=1
Length = 986

Score = 161 bits (407), Expect = 3e-38
Identities = 74/208 (35%), Positives = 127/208 (61%)
Frame = +2

Query: 2 AWNTLLAGYINYGFPEEAINCFERMQQEGVSPVEVTFVHTLKACGEGRALTTGHAVHGEM 181
+WN LL GY+ +G EEA E+M Q+ V P + TFV L AC + R + G ++ +
Sbjct: 178 SWNLLLGGYVQHGLYEEAFKLHEQMVQDSVKPDKRTFVSMLNACADARNVDKGRELYNLI 237

Query: 182 IKRGWEGNLDLNNSLVDFYGKCGSVLEARMLFDLLPVRSAVSWTALISGYAEIGLGYEVL 361
+K GW+ +L + +L++ + KCG + +A +FD LP R V+WT++I+G A G +
Sbjct: 238 LKAGWDTDLFVGTALINMHIKCGDIGDATKVFDNLPTRDLVTWTSMITGLARHGRFKQAC 297

Query: 362 DCFRQMQTEAIFLDRVVFICSLKACNMFEAFEIGRILHSHVVKRGWERDVTIGNMLLIMY 541
+ F++M+ E + D+V F+ L+ACN EA E G+ +H+ + + GW+ ++ +G +L MY
Sbjct: 298 NLFQRMEEEGVQPDKVAFVSLLRACNHPEALEQGKKVHARMKEVGWDTEIYVGTAILSMY 357

Query: 542 AKCGFLAEAQVLFDELQVQSAESWALLI 625
KCG + +A +FD ++ ++ SW +I
Sbjct: 358 TKCGSMEDALEVFDLVKGRNVVSWTAMI 385



Score = 148 bits (373), Expect = 3e-34
Identities = 74/207 (35%), Positives = 121/207 (58%)
Frame = +2

Query: 5 WNTLLAGYINYGFPEEAINCFERMQQEGVSPVEVTFVHTLKACGEGRALTTGHAVHGEMI 184
W +++ G +G ++A N F+RM++EGV P +V FV L+AC AL G VH M
Sbjct: 280 WTSMITGLARHGRFKQACNLFQRMEEEGVQPDKVAFVSLLRACNHPEALEQGKKVHARMK 339

Query: 185 KRGWEGNLDLNNSLVDFYGKCGSVLEARMLFDLLPVRSAVSWTALISGYAEIGLGYEVLD 364
+ GW+ + + +++ Y KCGS+ +A +FDL+ R+ VSWTA+I+G+A+ G E
Sbjct: 340 EVGWDTEIYVGTAILSMYTKCGSMEDALEVFDLVKGRNVVSWTAMIAGFAQHGRIDEAFL 399

Query: 365 CFRQMQTEAIFLDRVVFICSLKACNMFEAFEIGRILHSHVVKRGWERDVTIGNMLLIMYA 544
F +M I +RV F+ L AC+ A + G+ + H+++ G+ D + LL MYA
Sbjct: 400 FFNKMIESGIEPNRVTFMSILGACSSPSALKRGQQIQDHIIEAGYGSDDRVRTALLSMYA 459

Query: 545 KCGFLAEAQVLFDELQVQSAESWALLI 625
KCG L +A +F+++ Q+ +W +I
Sbjct: 460 KCGSLKDAHRVFEKISKQNVVAWNAMI 486



Score = 137 bits (345), Expect = 5e-31
Identities = 68/208 (32%), Positives = 112/208 (53%)
Frame = +2

Query: 2 AWNTLLAGYINYGFPEEAINCFERMQQEGVSPVEVTFVHTLKACGEGRALTTGHAVHGEM 181
AWN ++ Y+ + + A+ F+ + +EG+ P TF L C +L G VH +
Sbjct: 481 AWNAMITAYVQHEQYDNALATFQALLKEGIKPNSSTFTSILNVCKSSDSLELGKWVHFLI 540

Query: 182 IKRGWEGNLDLNNSLVDFYGKCGSVLEARMLFDLLPVRSAVSWTALISGYAEIGLGYEVL 361
+K G E +L ++N+LV + CG ++ A+ LF+ +P R VSW +I+G+ + G
Sbjct: 541 MKAGLESDLHVSNALVSMFVNCGDLMSAKNLFNDMPKRDLVSWNTIIAGFVQHGKNQVAF 600

Query: 362 DCFRQMQTEAIFLDRVVFICSLKACNMFEAFEIGRILHSHVVKRGWERDVTIGNMLLIMY 541
D F+ MQ I D++ F L AC EA GR LH+ + + ++ DV +G L+ MY
Sbjct: 601 DYFKMMQESGIKPDKITFTGLLNACASPEALTEGRRLHALITEAAFDCDVLVGTGLISMY 660

Query: 542 AKCGFLAEAQVLFDELQVQSAESWALLI 625
KCG + +A +F +L ++ SW +I
Sbjct: 661 TKCGSIEDAHQVFHKLPKKNVYSWTSMI 688



Score = 123 bits (309), Expect = 8e-27
Identities = 64/209 (30%), Positives = 113/209 (54%), Gaps = 1/209 (0%)
Frame = +2

Query: 2 AWNTLLAGYINYGFPEEAINCFERMQQEGVSPVEVTFVHTLKACGEGRALTTGHAVHGEM 181
+WNT++AG++ +G + A + F+ MQ+ G+ P ++TF L AC ALT G +H +
Sbjct: 582 SWNTIIAGFVQHGKNQVAFDYFKMMQESGIKPDKITFTGLLNACASPEALTEGRRLHALI 641

Query: 182 IKRGWEGNLDLNNSLVDFYGKCGSVLEARMLFDLLPVRSAVSWTALISGYAEIGLGYEVL 361
+ ++ ++ + L+ Y KCGS+ +A +F LP ++ SWT++I+GYA+ G G E L
Sbjct: 642 TEAAFDCDVLVGTGLISMYTKCGSIEDAHQVFHKLPKKNVYSWTSMIAGYAQHGRGKEAL 701

Query: 362 DCFRQMQTEAIFLDRVVFICSLKACNMFEAFEIGRILHSHVVKRGWERDVTIGNMLLIMY 541
+ F QMQ E + D + F+ +L AC E G + + E + ++ ++
Sbjct: 702 ELFYQMQQEGVKPDWITFVGALSACAHAGLIEEGLHHFQSMKEFNIEPRMEHYGCMVDLF 761

Query: 542 AKCGFLAEAQVLFDELQVQ-SAESWALLI 625
+ G L EA ++QV+ + W L+
Sbjct: 762 GRAGLLNEAVEFIIKMQVEPDSRVWGALL 790



Score = 120 bits (302), Expect = 5e-26
Identities = 60/208 (28%), Positives = 109/208 (52%)
Frame = +2

Query: 2 AWNTLLAGYINYGFPEEAINCFERMQQEGVSPVEVTFVHTLKACGEGRALTTGHAVHGEM 181
+W ++AG+ +G +EA F +M + G+ P VTF+ L AC AL G + +
Sbjct: 380 SWTAMIAGFAQHGRIDEAFLFFNKMIESGIEPNRVTFMSILGACSSPSALKRGQQIQDHI 439

Query: 182 IKRGWEGNLDLNNSLVDFYGKCGSVLEARMLFDLLPVRSAVSWTALISGYAEIGLGYEVL 361
I+ G+ + + +L+ Y KCGS+ +A +F+ + ++ V+W A+I+ Y + L
Sbjct: 440 IEAGYGSDDRVRTALLSMYAKCGSLKDAHRVFEKISKQNVVAWNAMITAYVQHEQYDNAL 499

Query: 362 DCFRQMQTEAIFLDRVVFICSLKACNMFEAFEIGRILHSHVVKRGWERDVTIGNMLLIMY 541
F+ + E I + F L C ++ E+G+ +H ++K G E D+ + N L+ M+
Sbjct: 500 ATFQALLKEGIKPNSSTFTSILNVCKSSDSLELGKWVHFLIMKAGLESDLHVSNALVSMF 559

Query: 542 AKCGFLAEAQVLFDELQVQSAESWALLI 625
CG L A+ LF+++ + SW +I
Sbjct: 560 VNCGDLMSAKNLFNDMPKRDLVSWNTII 587



Score = 112 bits (280), Expect = 2e-23
Identities = 57/206 (27%), Positives = 104/206 (50%)
Frame = +2

Query: 8 NTLLAGYINYGFPEEAINCFERMQQEGVSPVEVTFVHTLKACGEGRALTTGHAVHGEMIK 187
N +L G EA+ ER+ + T+ L+ C + + L G ++ + K
Sbjct: 79 NAVLNRLSKAGQFNEAMQVLERVDSSHIQIYRQTYSALLQLCIKFKNLGDGERIYNHIKK 138

Query: 188 RGWEGNLDLNNSLVDFYGKCGSVLEARMLFDLLPVRSAVSWTALISGYAEIGLGYEVLDC 367
G + ++ + N+L++ Y KCG+ + A+ +FD + + SW L+ GY + GL E
Sbjct: 139 SGVQPDIFMRNTLINMYAKCGNTISAKQIFDDMREKDVYSWNLLLGGYVQHGLYEEAFKL 198

Query: 368 FRQMQTEAIFLDRVVFICSLKACNMFEAFEIGRILHSHVVKRGWERDVTIGNMLLIMYAK 547
QM +++ D+ F+ L AC + GR L++ ++K GW+ D+ +G L+ M+ K
Sbjct: 199 HEQMVQDSVKPDKRTFVSMLNACADARNVDKGRELYNLILKAGWDTDLFVGTALINMHIK 258

Query: 548 CGFLAEAQVLFDELQVQSAESWALLI 625
CG + +A +FD L + +W +I
Sbjct: 259 CGDIGDATKVFDNLPTRDLVTWTSMI 284


>tr|A9TNX6|A9TNX6_PHYPA Predicted protein OS=Physcomitrella patens
subsp. patens GN=PHYPADRAFT_224041 PE=4 SV=1
Length = 986

Score = 161 bits (407), Expect = 3e-38
Identities = 74/208 (35%), Positives = 127/208 (61%)
Frame = +2

Query: 2 AWNTLLAGYINYGFPEEAINCFERMQQEGVSPVEVTFVHTLKACGEGRALTTGHAVHGEM 181
+WN LL GY+ +G EEA E+M Q+ V P + TFV L AC + R + G ++ +
Sbjct: 178 SWNLLLGGYVQHGLYEEAFKLHEQMVQDSVKPDKRTFVSMLNACADARNVDKGRELYNLI 237

Query: 182 IKRGWEGNLDLNNSLVDFYGKCGSVLEARMLFDLLPVRSAVSWTALISGYAEIGLGYEVL 361
+K GW+ +L + +L++ + KCG + +A +FD LP R V+WT++I+G A G +
Sbjct: 238 LKAGWDTDLFVGTALINMHIKCGDIGDATKVFDNLPTRDLVTWTSMITGLARHGRFKQAC 297

Query: 362 DCFRQMQTEAIFLDRVVFICSLKACNMFEAFEIGRILHSHVVKRGWERDVTIGNMLLIMY 541
+ F++M+ E + D+V F+ L+ACN EA E G+ +H+ + + GW+ ++ +G +L MY
Sbjct: 298 NLFQRMEEEGVQPDKVAFVSLLRACNHPEALEQGKKVHARMKEVGWDTEIYVGTAILSMY 357

Query: 542 AKCGFLAEAQVLFDELQVQSAESWALLI 625
KCG + +A +FD ++ ++ SW +I
Sbjct: 358 TKCGSMEDALEVFDLVKGRNVVSWTAMI 385



Score = 148 bits (373), Expect = 3e-34
Identities = 74/207 (35%), Positives = 121/207 (58%)
Frame = +2

Query: 5 WNTLLAGYINYGFPEEAINCFERMQQEGVSPVEVTFVHTLKACGEGRALTTGHAVHGEMI 184
W +++ G +G ++A N F+RM++EGV P +V FV L+AC AL G VH M
Sbjct: 280 WTSMITGLARHGRFKQACNLFQRMEEEGVQPDKVAFVSLLRACNHPEALEQGKKVHARMK 339

Query: 185 KRGWEGNLDLNNSLVDFYGKCGSVLEARMLFDLLPVRSAVSWTALISGYAEIGLGYEVLD 364
+ GW+ + + +++ Y KCGS+ +A +FDL+ R+ VSWTA+I+G+A+ G E
Sbjct: 340 EVGWDTEIYVGTAILSMYTKCGSMEDALEVFDLVKGRNVVSWTAMIAGFAQHGRIDEAFL 399

Query: 365 CFRQMQTEAIFLDRVVFICSLKACNMFEAFEIGRILHSHVVKRGWERDVTIGNMLLIMYA 544
F +M I +RV F+ L AC+ A + G+ + H+++ G+ D + LL MYA
Sbjct: 400 FFNKMIESGIEPNRVTFMSILGACSSPSALKRGQQIQDHIIEAGYGSDDRVRTALLSMYA 459

Query: 545 KCGFLAEAQVLFDELQVQSAESWALLI 625
KCG L +A +F+++ Q+ +W +I
Sbjct: 460 KCGSLKDAHRVFEKISKQNVVAWNAMI 486



Score = 137 bits (345), Expect = 5e-31
Identities = 68/208 (32%), Positives = 112/208 (53%)
Frame = +2

Query: 2 AWNTLLAGYINYGFPEEAINCFERMQQEGVSPVEVTFVHTLKACGEGRALTTGHAVHGEM 181
AWN ++ Y+ + + A+ F+ + +EG+ P TF L C +L G VH +
Sbjct: 481 AWNAMITAYVQHEQYDNALATFQALLKEGIKPNSSTFTSILNVCKSSDSLELGKWVHFLI 540

Query: 182 IKRGWEGNLDLNNSLVDFYGKCGSVLEARMLFDLLPVRSAVSWTALISGYAEIGLGYEVL 361
+K G E +L ++N+LV + CG ++ A+ LF+ +P R VSW +I+G+ + G
Sbjct: 541 MKAGLESDLHVSNALVSMFVNCGDLMSAKNLFNDMPKRDLVSWNTIIAGFVQHGKNQVAF 600

Query: 362 DCFRQMQTEAIFLDRVVFICSLKACNMFEAFEIGRILHSHVVKRGWERDVTIGNMLLIMY 541
D F+ MQ I D++ F L AC EA GR LH+ + + ++ DV +G L+ MY
Sbjct: 601 DYFKMMQESGIKPDKITFTGLLNACASPEALTEGRRLHALITEAAFDCDVLVGTGLISMY 660

Query: 542 AKCGFLAEAQVLFDELQVQSAESWALLI 625
KCG + +A +F +L ++ SW +I
Sbjct: 661 TKCGSIEDAHQVFHKLPKKNVYSWTSMI 688



Score = 123 bits (309), Expect = 8e-27
Identities = 64/209 (30%), Positives = 113/209 (54%), Gaps = 1/209 (0%)
Frame = +2

Query: 2 AWNTLLAGYINYGFPEEAINCFERMQQEGVSPVEVTFVHTLKACGEGRALTTGHAVHGEM 181
+WNT++AG++ +G + A + F+ MQ+ G+ P ++TF L AC ALT G +H +
Sbjct: 582 SWNTIIAGFVQHGKNQVAFDYFKMMQESGIKPDKITFTGLLNACASPEALTEGRRLHALI 641

Query: 182 IKRGWEGNLDLNNSLVDFYGKCGSVLEARMLFDLLPVRSAVSWTALISGYAEIGLGYEVL 361
+ ++ ++ + L+ Y KCGS+ +A +F LP ++ SWT++I+GYA+ G G E L
Sbjct: 642 TEAAFDCDVLVGTGLISMYTKCGSIEDAHQVFHKLPKKNVYSWTSMITGYAQHGRGKEAL 701

Query: 362 DCFRQMQTEAIFLDRVVFICSLKACNMFEAFEIGRILHSHVVKRGWERDVTIGNMLLIMY 541
+ F QMQ E + D + F+ +L AC E G + + E + ++ ++
Sbjct: 702 ELFYQMQQEGVKPDWITFVGALSACAHAGLIEEGLHHFQSMKEFNIEPRMEHYGCMVDLF 761

Query: 542 AKCGFLAEAQVLFDELQVQ-SAESWALLI 625
+ G L EA ++QV+ + W L+
Sbjct: 762 GRAGLLNEAVEFIIKMQVEPDSRVWGALL 790



Score = 120 bits (302), Expect = 5e-26
Identities = 60/208 (28%), Positives = 109/208 (52%)
Frame = +2

Query: 2 AWNTLLAGYINYGFPEEAINCFERMQQEGVSPVEVTFVHTLKACGEGRALTTGHAVHGEM 181
+W ++AG+ +G +EA F +M + G+ P VTF+ L AC AL G + +
Sbjct: 380 SWTAMIAGFAQHGRIDEAFLFFNKMIESGIEPNRVTFMSILGACSSPSALKRGQQIQDHI 439

Query: 182 IKRGWEGNLDLNNSLVDFYGKCGSVLEARMLFDLLPVRSAVSWTALISGYAEIGLGYEVL 361
I+ G+ + + +L+ Y KCGS+ +A +F+ + ++ V+W A+I+ Y + L
Sbjct: 440 IEAGYGSDDRVRTALLSMYAKCGSLKDAHRVFEKISKQNVVAWNAMITAYVQHEQYDNAL 499

Query: 362 DCFRQMQTEAIFLDRVVFICSLKACNMFEAFEIGRILHSHVVKRGWERDVTIGNMLLIMY 541
F+ + E I + F L C ++ E+G+ +H ++K G E D+ + N L+ M+
Sbjct: 500 ATFQALLKEGIKPNSSTFTSILNVCKSSDSLELGKWVHFLIMKAGLESDLHVSNALVSMF 559

Query: 542 AKCGFLAEAQVLFDELQVQSAESWALLI 625
CG L A+ LF+++ + SW +I
Sbjct: 560 VNCGDLMSAKNLFNDMPKRDLVSWNTII 587



Score = 110 bits (276), Expect = 5e-23
Identities = 57/206 (27%), Positives = 104/206 (50%)
Frame = +2

Query: 8 NTLLAGYINYGFPEEAINCFERMQQEGVSPVEVTFVHTLKACGEGRALTTGHAVHGEMIK 187
N +L G EA+ ER+ + T+ L+ C + + L G ++ + K
Sbjct: 79 NAVLNRLSKAGQFNEAMQVLERVDSSHIQIYRQTYSALLQLCIKFKNLGDGERIYNHIKK 138

Query: 188 RGWEGNLDLNNSLVDFYGKCGSVLEARMLFDLLPVRSAVSWTALISGYAEIGLGYEVLDC 367
G + ++ + N+L++ Y KCG+ + A+ +FD + + SW L+ GY + GL E
Sbjct: 139 SGVQPDIFMWNTLINMYAKCGNTISAKQIFDDMREKDVYSWNLLLGGYVQHGLYEEAFKL 198

Query: 368 FRQMQTEAIFLDRVVFICSLKACNMFEAFEIGRILHSHVVKRGWERDVTIGNMLLIMYAK 547
QM +++ D+ F+ L AC + GR L++ ++K GW+ D+ +G L+ M+ K
Sbjct: 199 HEQMVQDSVKPDKRTFVSMLNACADARNVDKGRELYNLILKAGWDTDLFVGTALINMHIK 258

Query: 548 CGFLAEAQVLFDELQVQSAESWALLI 625
CG + +A +FD L + +W +I
Sbjct: 259 CGDIGDATKVFDNLPTRDLVTWTSMI 284


>tr|B8LQA8|B8LQA8_PICSI Putative uncharacterized protein OS=Picea
sitchensis PE=2 SV=1
Length = 795

Score = 156 bits (395), Expect = 8e-37
Identities = 79/208 (37%), Positives = 118/208 (56%)
Frame = +2

Query: 2 AWNTLLAGYINYGFPEEAINCFERMQQEGVSPVEVTFVHTLKACGEGRALTTGHAVHGEM 181
+WN ++ GY EA+ F RMQ G+ P +T V L AC AL G +HG
Sbjct: 289 SWNAIIGGYSLNSQHHEALAFFNRMQVRGIKPNSITMVSVLPACAHLFALEQGQQIHGYA 348

Query: 182 IKRGWEGNLDLNNSLVDFYGKCGSVLEARMLFDLLPVRSAVSWTALISGYAEIGLGYEVL 361
I+ G+E N + N+LV+ Y KCG+V A LF+ +P ++ V+W A+ISGY++ G +E L
Sbjct: 349 IRSGFESNDVVGNALVNMYAKCGNVNSAYKLFERMPKKNVVAWNAIISGYSQHGHPHEAL 408

Query: 362 DCFRQMQTEAIFLDRVVFICSLKACNMFEAFEIGRILHSHVVKRGWERDVTIGNMLLIMY 541
F +MQ + I D + L AC F A E G+ +H + ++ G+E +V +G L+ +Y
Sbjct: 409 ALFIEMQAQGIKPDSFAIVSVLPACAHFLALEQGKQIHGYTIRSGFESNVVVGTGLVDIY 468

Query: 542 AKCGFLAEAQVLFDELQVQSAESWALLI 625
AKCG + AQ LF+ + Q SW +I
Sbjct: 469 AKCGNVNTAQKLFERMPEQDVVSWTTMI 496



Score = 153 bits (386), Expect = 9e-36
Identities = 73/207 (35%), Positives = 117/207 (56%)
Frame = +2

Query: 5 WNTLLAGYINYGFPEEAINCFERMQQEGVSPVEVTFVHTLKACGEGRALTTGHAVHGEMI 184
W + GY+ GF +A+ + +MQ+ G++P ++ F+ +KACG L G VH ++I
Sbjct: 88 WKETIIGYVKNGFWNKALRLYYQMQRTGINPDKLVFLSVIKACGSQSDLQAGRKVHEDII 147

Query: 185 KRGWEGNLDLNNSLVDFYGKCGSVLEARMLFDLLPVRSAVSWTALISGYAEIGLGYEVLD 364
RG+E ++ + +L Y KCGS+ AR +FD +P R VSW A+I+GY++ G YE L
Sbjct: 148 ARGFESDVIVGTALASMYTKCGSLENARQVFDRMPKRDVVSWNAIIAGYSQNGQPYEALA 207

Query: 365 CFRQMQTEAIFLDRVVFICSLKACNMFEAFEIGRILHSHVVKRGWERDVTIGNMLLIMYA 544
F +MQ I + + + C A E G+ +H + ++ G E DV + N L+ MYA
Sbjct: 208 LFSEMQVNGIKPNSSTLVSVMPVCAHLLALEQGKQIHCYAIRSGIESDVLVVNGLVNMYA 267

Query: 545 KCGFLAEAQVLFDELQVQSAESWALLI 625
KCG + A LF+ + ++ SW +I
Sbjct: 268 KCGNVNTAHKLFERMPIRDVASWNAII 294



Score = 142 bits (358), Expect = 2e-32
Identities = 72/208 (34%), Positives = 111/208 (53%)
Frame = +2

Query: 2 AWNTLLAGYINYGFPEEAINCFERMQQEGVSPVEVTFVHTLKACGEGRALTTGHAVHGEM 181
+WN ++AGY G P EA+ F MQ G+ P T V + C AL G +H
Sbjct: 188 SWNAIIAGYSQNGQPYEALALFSEMQVNGIKPNSSTLVSVMPVCAHLLALEQGKQIHCYA 247

Query: 182 IKRGWEGNLDLNNSLVDFYGKCGSVLEARMLFDLLPVRSAVSWTALISGYAEIGLGYEVL 361
I+ G E ++ + N LV+ Y KCG+V A LF+ +P+R SW A+I GY+ +E L
Sbjct: 248 IRSGIESDVLVVNGLVNMYAKCGNVNTAHKLFERMPIRDVASWNAIIGGYSLNSQHHEAL 307

Query: 362 DCFRQMQTEAIFLDRVVFICSLKACNMFEAFEIGRILHSHVVKRGWERDVTIGNMLLIMY 541
F +MQ I + + + L AC A E G+ +H + ++ G+E + +GN L+ MY
Sbjct: 308 AFFNRMQVRGIKPNSITMVSVLPACAHLFALEQGQQIHGYAIRSGFESNDVVGNALVNMY 367

Query: 542 AKCGFLAEAQVLFDELQVQSAESWALLI 625
AKCG + A LF+ + ++ +W +I
Sbjct: 368 AKCGNVNSAYKLFERMPKKNVVAWNAII 395



Score = 116 bits (291), Expect = 1e-24
Identities = 57/146 (39%), Positives = 79/146 (54%)
Frame = +2

Query: 2 AWNTLLAGYINYGFPEEAINCFERMQQEGVSPVEVTFVHTLKACGEGRALTTGHAVHGEM 181
AWN +++GY +G P EA+ F MQ +G+ P V L AC AL G +HG
Sbjct: 390 AWNAIISGYSQHGHPHEALALFIEMQAQGIKPDSFAIVSVLPACAHFLALEQGKQIHGYT 449

Query: 182 IKRGWEGNLDLNNSLVDFYGKCGSVLEARMLFDLLPVRSAVSWTALISGYAEIGLGYEVL 361
I+ G+E N+ + LVD Y KCG+V A+ LF+ +P + VSWT +I Y G G + L
Sbjct: 450 IRSGFESNVVVGTGLVDIYAKCGNVNTAQKLFERMPEQDVVSWTTMILAYGIHGHGEDAL 509

Query: 362 DCFRQMQTEAIFLDRVVFICSLKACN 439
F +MQ LD + F L AC+
Sbjct: 510 ALFSKMQETGTKLDHIAFTAILTACS 535



Score = 80.5 bits (197), Expect = 8e-14
Identities = 40/110 (36%), Positives = 59/110 (53%)
Frame = +2

Query: 296 SAVSWTALISGYAEIGLGYEVLDCFRQMQTEAIFLDRVVFICSLKACNMFEAFEIGRILH 475
+AV W I GY + G + L + QMQ I D++VF+ +KAC + GR +H
Sbjct: 84 NAVVWKETIIGYVKNGFWNKALRLYYQMQRTGINPDKLVFLSVIKACGSQSDLQAGRKVH 143

Query: 476 SHVVKRGWERDVTIGNMLLIMYAKCGFLAEAQVLFDELQVQSAESWALLI 625
++ RG+E DV +G L MY KCG L A+ +FD + + SW +I
Sbjct: 144 EDIIARGFESDVIVGTALASMYTKCGSLENARQVFDRMPKRDVVSWNAII 193



Score = 38.9 bits (89), Expect = 0.25
Identities = 29/110 (26%), Positives = 49/110 (44%), Gaps = 3/110 (2%)
Frame = +2

Query: 2 AWNTLLAGYINYGFPEEAINCFERMQQEGVSPVEVTFVHTLKACGEGRALTTGHAVHGEM 181
+W T++ Y +G E+A+ F +MQ+ G + F L AC + G + +
Sbjct: 491 SWTTMILAYGIHGHGEDALALFSKMQETGTKLDHIAFTAILTACSHAGLVDQG-LQYFQC 549

Query: 182 IKR--GWEGNLDLNNSLVDFYGKCGSVLEARMLFDLLPVR-SAVSWTALI 322
+K G L+ LVD G+ G + EA + + + A W AL+
Sbjct: 550 MKSDYGLAPKLEHYACLVDLLGRAGHLDEANGIIKNMSLEPDANVWGALL 599


>tr|Q5W963|Q5W963_PHYPA PPR1106-17 OS=Physcomitrella patens PE=2 SV=2
Length = 1106

Score = 155 bits (392), Expect = 2e-36
Identities = 73/208 (35%), Positives = 120/208 (57%)
Frame = +2

Query: 2 AWNTLLAGYINYGFPEEAINCFERMQQEGVSPVEVTFVHTLKACGEGRALTTGHAVHGEM 181
+WN ++AGY EA+ +++MQ EGV P VTF+H L AC A G +H ++
Sbjct: 398 SWNAIIAGYARREDRGEAMRLYKQMQSEGVKPGRVTFLHLLSACANSSAYADGKMIHEDI 457

Query: 182 IKRGWEGNLDLNNSLVDFYGKCGSVLEARMLFDLLPVRSAVSWTALISGYAEIGLGYEVL 361
++ G + N L N+L++ Y +CGS++EA+ +F+ R +SW ++I+G+A+ G
Sbjct: 458 LRSGIKSNGHLANALMNMYRRCGSLMEAQNVFEGTQARDVISWNSMIAGHAQHGSYETAY 517

Query: 362 DCFRQMQTEAIFLDRVVFICSLKACNMFEAFEIGRILHSHVVKRGWERDVTIGNMLLIMY 541
F++MQ E + D + F L C EA E+G+ +H + + G + DV +GN L+ MY
Sbjct: 518 KLFQEMQNEELEPDNITFASVLSGCKNPEALELGKQIHGRITESGLQLDVNLGNALINMY 577

Query: 542 AKCGFLAEAQVLFDELQVQSAESWALLI 625
+CG L +A+ +F LQ + SW +I
Sbjct: 578 IRCGSLQDARNVFHSLQHRDVMSWTAMI 605



Score = 150 bits (378), Expect = 8e-35
Identities = 76/208 (36%), Positives = 118/208 (56%)
Frame = +2

Query: 2 AWNTLLAGYINYGFPEEAINCFERMQQEGVSPVEVTFVHTLKACGEGRALTTGHAVHGEM 181
+W ++ G + G +AI F +MQ EG PV+ TF LK C L G V +
Sbjct: 600 SWTAMIGGCADQGEDMKAIELFWQMQNEGFRPVKSTFSSILKVCTSSACLDEGKKVIAYI 659

Query: 182 IKRGWEGNLDLNNSLVDFYGKCGSVLEARMLFDLLPVRSAVSWTALISGYAEIGLGYEVL 361
+ G+E + + N+L+ Y K GS+ +AR +FD +P R VSW +I+GYA+ GLG +
Sbjct: 660 LNSGYELDTGVGNALISAYSKSGSMTDAREVFDKMPSRDIVSWNKIIAGYAQNGLGQTAV 719

Query: 362 DCFRQMQTEAIFLDRVVFICSLKACNMFEAFEIGRILHSHVVKRGWERDVTIGNMLLIMY 541
+ QMQ + + ++ F+ L AC+ F A E G+ +H+ +VKR + DV +G L+ MY
Sbjct: 720 EFAYQMQEQDVVPNKFSFVSLLNACSSFSALEEGKRVHAEIVKRKLQGDVRVGAALISMY 779

Query: 542 AKCGFLAEAQVLFDELQVQSAESWALLI 625
AKCG EAQ +FD + ++ +W +I
Sbjct: 780 AKCGSQGEAQEVFDNIIEKNVVTWNAMI 807



Score = 137 bits (346), Expect = 4e-31
Identities = 67/208 (32%), Positives = 116/208 (55%)
Frame = +2

Query: 2 AWNTLLAGYINYGFPEEAINCFERMQQEGVSPVEVTFVHTLKACGEGRALTTGHAVHGEM 181
+WN+++AG+ +G E A F+ MQ E + P +TF L C AL G +HG +
Sbjct: 499 SWNSMIAGHAQHGSYETAYKLFQEMQNEELEPDNITFASVLSGCKNPEALELGKQIHGRI 558

Query: 182 IKRGWEGNLDLNNSLVDFYGKCGSVLEARMLFDLLPVRSAVSWTALISGYAEIGLGYEVL 361
+ G + +++L N+L++ Y +CGS+ +AR +F L R +SWTA+I G A+ G + +
Sbjct: 559 TESGLQLDVNLGNALINMYIRCGSLQDARNVFHSLQHRDVMSWTAMIGGCADQGEDMKAI 618

Query: 362 DCFRQMQTEAIFLDRVVFICSLKACNMFEAFEIGRILHSHVVKRGWERDVTIGNMLLIMY 541
+ F QMQ E + F LK C + G+ + ++++ G+E D +GN L+ Y
Sbjct: 619 ELFWQMQNEGFRPVKSTFSSILKVCTSSACLDEGKKVIAYILNSGYELDTGVGNALISAY 678

Query: 542 AKCGFLAEAQVLFDELQVQSAESWALLI 625
+K G + +A+ +FD++ + SW +I
Sbjct: 679 SKSGSMTDAREVFDKMPSRDIVSWNKII 706



Score = 135 bits (340), Expect = 2e-30
Identities = 67/207 (32%), Positives = 114/207 (55%)
Frame = +2

Query: 5 WNTLLAGYINYGFPEEAINCFERMQQEGVSPVEVTFVHTLKACGEGRALTTGHAVHGEMI 184
+N L+A +G EA + RM+ +GV+ T++ L AC +AL G +H +
Sbjct: 298 YNALIAALAQHGHNVEAFEQYYRMRSDGVALNRTTYLSILNACSTSKALEAGKLIHSHIS 357

Query: 185 KRGWEGNLDLNNSLVDFYGKCGSVLEARMLFDLLPVRSAVSWTALISGYAEIGLGYEVLD 364
+ G ++ + N+L+ Y +CG + +AR LF +P R +SW A+I+GYA E +
Sbjct: 358 EDGHSSDVQIGNALISMYARCGDLPKARELFYTMPKRDLISWNAIIAGYARREDRGEAMR 417

Query: 365 CFRQMQTEAIFLDRVVFICSLKACNMFEAFEIGRILHSHVVKRGWERDVTIGNMLLIMYA 544
++QMQ+E + RV F+ L AC A+ G+++H +++ G + + + N L+ MY
Sbjct: 418 LYKQMQSEGVKPGRVTFLHLLSACANSSAYADGKMIHEDILRSGIKSNGHLANALMNMYR 477

Query: 545 KCGFLAEAQVLFDELQVQSAESWALLI 625
+CG L EAQ +F+ Q + SW +I
Sbjct: 478 RCGSLMEAQNVFEGTQARDVISWNSMI 504



Score = 125 bits (314), Expect = 2e-27
Identities = 65/208 (31%), Positives = 113/208 (54%)
Frame = +2

Query: 2 AWNTLLAGYINYGFPEEAINCFERMQQEGVSPVEVTFVHTLKACGEGRALTTGHAVHGEM 181
++NT+L Y + +E + F +M EG+SP +VT+++ L A L G +H
Sbjct: 196 SYNTMLGLYAQKAYVKECLGLFGQMSSEGISPDKVTYINLLDAFTTPSMLDEGKRIHKLT 255

Query: 182 IKRGWEGNLDLNNSLVDFYGKCGSVLEARMLFDLLPVRSAVSWTALISGYAEIGLGYEVL 361
++ G ++ + +LV +CG V A+ F R V + ALI+ A+ G E
Sbjct: 256 VEEGLNSDIRVGTALVTMCVRCGDVDSAKQAFKGTADRDVVVYNALIAALAQHGHNVEAF 315

Query: 362 DCFRQMQTEAIFLDRVVFICSLKACNMFEAFEIGRILHSHVVKRGWERDVTIGNMLLIMY 541
+ + +M+++ + L+R ++ L AC+ +A E G+++HSH+ + G DV IGN L+ MY
Sbjct: 316 EQYYRMRSDGVALNRTTYLSILNACSTSKALEAGKLIHSHISEDGHSSDVQIGNALISMY 375

Query: 542 AKCGFLAEAQVLFDELQVQSAESWALLI 625
A+CG L +A+ LF + + SW +I
Sbjct: 376 ARCGDLPKARELFYTMPKRDLISWNAII 403



Score = 120 bits (302), Expect = 5e-26
Identities = 63/193 (32%), Positives = 101/193 (52%)
Frame = +2

Query: 2 AWNTLLAGYINYGFPEEAINCFERMQQEGVSPVEVTFVHTLKACGEGRALTTGHAVHGEM 181
+WN+L++ Y GF ++A FE MQ G P ++T++ L AC L G +H ++
Sbjct: 95 SWNSLISCYAQQGFKKKAFQLFEEMQNAGFIPNKITYISILTACYSPAELENGKKIHSQI 154

Query: 182 IKRGWEGNLDLNNSLVDFYGKCGSVLEARMLFDLLPVRSAVSWTALISGYAEIGLGYEVL 361
IK G++ + + NSL+ YGKCG + AR +F + R VS+ ++ YA+ E L
Sbjct: 155 IKAGYQRDPRVQNSLLSMYGKCGDLPRARQVFAGISPRDVVSYNTMLGLYAQKAYVKECL 214

Query: 362 DCFRQMQTEAIFLDRVVFICSLKACNMFEAFEIGRILHSHVVKRGWERDVTIGNMLLIMY 541
F QM +E I D+V +I L A + G+ +H V+ G D+ +G L+ M
Sbjct: 215 GLFGQMSSEGISPDKVTYINLLDAFTTPSMLDEGKRIHKLTVEEGLNSDIRVGTALVTMC 274

Query: 542 AKCGFLAEAQVLF 580
+CG + A+ F
Sbjct: 275 VRCGDVDSAKQAF 287



Score = 110 bits (275), Expect = 7e-23
Identities = 58/174 (33%), Positives = 95/174 (54%), Gaps = 1/174 (0%)
Frame = +2

Query: 107 TFVHTLKACGEGRALTTGHAVHGEMIKRGWEG-NLDLNNSLVDFYGKCGSVLEARMLFDL 283
T+V L+ C R L +H +M++ W G ++ L+N L++ Y KC SVL+A +F
Sbjct: 29 TYVALLQNCTRKRLLPEAKRIHAQMVE-AWVGPDIFLSNLLINMYVKCRSVLDAHQVFKE 87

Query: 284 LPVRSAVSWTALISGYAEIGLGYEVLDCFRQMQTEAIFLDRVVFICSLKACNMFEAFEIG 463
+P R +SW +LIS YA+ G + F +MQ +++ +I L AC E G
Sbjct: 88 MPRRDVISWNSLISCYAQQGFKKKAFQLFEEMQNAGFIPNKITYISILTACYSPAELENG 147

Query: 464 RILHSHVVKRGWERDVTIGNMLLIMYAKCGFLAEAQVLFDELQVQSAESWALLI 625
+ +HS ++K G++RD + N LL MY KCG L A+ +F + + S+ ++
Sbjct: 148 KKIHSQIIKAGYQRDPRVQNSLLSMYGKCGDLPRARQVFAGISPRDVVSYNTML 201



Score = 106 bits (264), Expect = 1e-21
Identities = 54/146 (36%), Positives = 83/146 (56%)
Frame = +2

Query: 2 AWNTLLAGYINYGFPEEAINCFERMQQEGVSPVEVTFVHTLKACGEGRALTTGHAVHGEM 181
+WN ++AGY G + A+ +MQ++ V P + +FV L AC AL G VH E+
Sbjct: 701 SWNKIIAGYAQNGLGQTAVEFAYQMQEQDVVPNKFSFVSLLNACSSFSALEEGKRVHAEI 760

Query: 182 IKRGWEGNLDLNNSLVDFYGKCGSVLEARMLFDLLPVRSAVSWTALISGYAEIGLGYEVL 361
+KR +G++ + +L+ Y KCGS EA+ +FD + ++ V+W A+I+ YA+ GL + L
Sbjct: 761 VKRKLQGDVRVGAALISMYAKCGSQGEAQEVFDNIIEKNVVTWNAMINAYAQHGLASKAL 820

Query: 362 DCFRQMQTEAIFLDRVVFICSLKACN 439
F M+ E I D F L ACN
Sbjct: 821 GFFNCMEKEGIKPDGSTFTSILSACN 846



Score = 47.0 bits (110), Expect = 0.001
Identities = 28/108 (25%), Positives = 46/108 (42%), Gaps = 2/108 (1%)
Frame = +2

Query: 5 WNTLLAGYINYGFPEEAINCFERMQQEGVSPVEVTFVHTLKACGEGRALTTGHAVHGEM- 181
WN ++ Y +G +A+ F M++EG+ P TF L AC + G+ + M
Sbjct: 803 WNAMINAYAQHGLASKALGFFNCMEKEGIKPDGSTFTSILSACNHAGLVLEGYQIFSSME 862

Query: 182 IKRGWEGNLDLNNSLVDFYGKCGSVLEARMLFDLLPV-RSAVSWTALI 322
+ G ++ LV G+ EA L + +P A W L+
Sbjct: 863 SEYGVLPTIEHYGCLVGLLGRARRFQEAETLINQMPFPPDAAVWETLL 910



Score = 40.0 bits (92), Expect = 0.11
Identities = 19/75 (25%), Positives = 37/75 (49%)
Frame = +2

Query: 401 DRVVFICSLKACNMFEAFEIGRILHSHVVKRGWERDVTIGNMLLIMYAKCGFLAEAQVLF 580
+R ++ L+ C + +H+ +V+ D+ + N+L+ MY KC + +A +F
Sbjct: 26 ERATYVALLQNCTRKRLLPEAKRIHAQMVEAWVGPDIFLSNLLINMYVKCRSVLDAHQVF 85

Query: 581 DELQVQSAESWALLI 625
E+ + SW LI
Sbjct: 86 KEMPRRDVISWNSLI 100


>tr|A9T8E9|A9T8E9_PHYPA Predicted protein OS=Physcomitrella patens
subsp. patens GN=PHYPADRAFT_192620 PE=4 SV=1
Length = 902

Score = 155 bits (392), Expect = 2e-36
Identities = 73/196 (37%), Positives = 117/196 (59%)
Frame = +2

Query: 2 AWNTLLAGYINYGFPEEAINCFERMQQEGVSPVEVTFVHTLKACGEGRALTTGHAVHGEM 181
AWNT++ G G+ EEA + +MQ+EGV P ++T+V L AC AL G +H +
Sbjct: 295 AWNTMIGGLAEGGYWEEASEVYNQMQREGVMPNKITYVILLNACVNSAALHWGKEIHSRV 354

Query: 182 IKRGWEGNLDLNNSLVDFYGKCGSVLEARMLFDLLPVRSAVSWTALISGYAEIGLGYEVL 361
K G+ ++ + N+L+ Y +CGS+ +AR++FD + + +SWTA+I G A+ G G E L
Sbjct: 355 AKAGFTSDIGVQNALISMYSRCGSIKDARLVFDKMVRKDVISWTAMIGGLAKSGFGAEAL 414

Query: 362 DCFRQMQTEAIFLDRVVFICSLKACNMFEAFEIGRILHSHVVKRGWERDVTIGNMLLIMY 541
+++MQ + +RV + L AC+ A E GR +H VV+ G D +GN L+ MY
Sbjct: 415 TVYQEMQQAGVEPNRVTYTSILNACSSPAALEWGRRIHQQVVEAGLATDAHVGNTLVNMY 474

Query: 542 AKCGFLAEAQVLFDEL 589
+ CG + +A+ +FD +
Sbjct: 475 SMCGSVKDARQVFDRM 490



Score = 149 bits (375), Expect = 2e-34
Identities = 74/208 (35%), Positives = 118/208 (56%)
Frame = +2

Query: 2 AWNTLLAGYINYGFPEEAINCFERMQQEGVSPVEVTFVHTLKACGEGRALTTGHAVHGEM 181
+W ++ G GF EA+ ++ MQQ GV P VT+ L AC AL G +H ++
Sbjct: 396 SWTAMIGGLAKSGFGAEALTVYQEMQQAGVEPNRVTYTSILNACSSPAALEWGRRIHQQV 455

Query: 182 IKRGWEGNLDLNNSLVDFYGKCGSVLEARMLFDLLPVRSAVSWTALISGYAEIGLGYEVL 361
++ G + + N+LV+ Y CGSV +AR +FD + R V++ A+I GYA LG E L
Sbjct: 456 VEAGLATDAHVGNTLVNMYSMCGSVKDARQVFDRMIQRDIVAYNAMIGGYAAHNLGKEAL 515

Query: 362 DCFRQMQTEAIFLDRVVFICSLKACNMFEAFEIGRILHSHVVKRGWERDVTIGNMLLIMY 541
F ++Q E + D+V +I L AC + E R +H+ V K G+ D ++GN L+ Y
Sbjct: 516 KLFDRLQEEGLKPDKVTYINMLNACANSGSLEWAREIHTLVRKGGFFSDTSVGNALVSTY 575

Query: 542 AKCGFLAEAQVLFDELQVQSAESWALLI 625
AKCG ++A ++F+++ ++ SW +I
Sbjct: 576 AKCGSFSDASIVFEKMTKRNVISWNAII 603



Score = 146 bits (368), Expect = 1e-33
Identities = 69/208 (33%), Positives = 119/208 (57%)
Frame = +2

Query: 2 AWNTLLAGYINYGFPEEAINCFERMQQEGVSPVEVTFVHTLKACGEGRALTTGHAVHGEM 181
+WN ++ GYI YG+ E+A+ +MQQ G++P T + L +C AL G +H +
Sbjct: 93 SWNAMVVGYIQYGYIEKALKLLRQMQQHGLAPDRTTIMSFLSSCKSPGALEWGREIHFQA 152

Query: 182 IKRGWEGNLDLNNSLVDFYGKCGSVLEARMLFDLLPVRSAVSWTALISGYAEIGLGYEVL 361
++ G ++ + N +++ Y KCGS+ EAR +FD + +S VSWT I GYA+ G
Sbjct: 153 MQAGLLFDVKVANCILNMYAKCGSIEEAREVFDKMEKKSVVSWTITIGGYADCGRSETAF 212

Query: 362 DCFRQMQTEAIFLDRVVFICSLKACNMFEAFEIGRILHSHVVKRGWERDVTIGNMLLIMY 541
+ F++M+ E + +R+ +I L A + A + G+ +HS ++ G E D +G L+ MY
Sbjct: 213 EIFQKMEQEGVVPNRITYISVLNAFSSPAALKWGKAVHSRILNAGHESDTAVGTALVKMY 272

Query: 542 AKCGFLAEAQVLFDELQVQSAESWALLI 625
AKCG + + +F++L + +W +I
Sbjct: 273 AKCGSYKDCRQVFEKLVNRDLIAWNTMI 300



Score = 146 bits (368), Expect = 1e-33
Identities = 69/208 (33%), Positives = 114/208 (54%)
Frame = +2

Query: 2 AWNTLLAGYINYGFPEEAINCFERMQQEGVSPVEVTFVHTLKACGEGRALTTGHAVHGEM 181
+W + GY + G E A F++M+QEGV P +T++ L A AL G AVH +
Sbjct: 194 SWTITIGGYADCGRSETAFEIFQKMEQEGVVPNRITYISVLNAFSSPAALKWGKAVHSRI 253

Query: 182 IKRGWEGNLDLNNSLVDFYGKCGSVLEARMLFDLLPVRSAVSWTALISGYAEIGLGYEVL 361
+ G E + + +LV Y KCGS + R +F+ L R ++W +I G AE G E
Sbjct: 254 LNAGHESDTAVGTALVKMYAKCGSYKDCRQVFEKLVNRDLIAWNTMIGGLAEGGYWEEAS 313

Query: 362 DCFRQMQTEAIFLDRVVFICSLKACNMFEAFEIGRILHSHVVKRGWERDVTIGNMLLIMY 541
+ + QMQ E + +++ ++ L AC A G+ +HS V K G+ D+ + N L+ MY
Sbjct: 314 EVYNQMQREGVMPNKITYVILLNACVNSAALHWGKEIHSRVAKAGFTSDIGVQNALISMY 373

Query: 542 AKCGFLAEAQVLFDELQVQSAESWALLI 625
++CG + +A+++FD++ + SW +I
Sbjct: 374 SRCGSIKDARLVFDKMVRKDVISWTAMI 401



Score = 112 bits (279), Expect = 2e-23
Identities = 63/193 (32%), Positives = 102/193 (52%), Gaps = 2/193 (1%)
Frame = +2

Query: 53 AINCFERMQQEGVSPVEVTFVHTLKACGEGRALTTGHAVHGEMIKRGWEGNLDLNNSLVD 232
A++ + +QQ+G ++ LK C E + L G VH +I+ + N+L++
Sbjct: 7 AVDVVQYLQQQGAQVNSSDYMKMLKRCIEVKDLVAGRQVHQHIIQHRTVPDQYTVNALIN 66

Query: 233 FYGKCGSVLEARMLFDLLPV--RSAVSWTALISGYAEIGLGYEVLDCFRQMQTEAIFLDR 406
Y +CGS+ EAR ++ L R+ SW A++ GY + G + L RQMQ + DR
Sbjct: 67 MYIQCGSIEEARQVWKKLSYMERTVHSWNAMVVGYIQYGYIEKALKLLRQMQQHGLAPDR 126

Query: 407 VVFICSLKACNMFEAFEIGRILHSHVVKRGWERDVTIGNMLLIMYAKCGFLAEAQVLFDE 586
+ L +C A E GR +H ++ G DV + N +L MYAKCG + EA+ +FD+
Sbjct: 127 TTIMSFLSSCKSPGALEWGREIHFQAMQAGLLFDVKVANCILNMYAKCGSIEEAREVFDK 186

Query: 587 LQVQSAESWALLI 625
++ +S SW + I
Sbjct: 187 MEKKSVVSWTITI 199



Score = 111 bits (278), Expect = 3e-23
Identities = 53/155 (34%), Positives = 89/155 (57%)
Frame = +2

Query: 2 AWNTLLAGYINYGFPEEAINCFERMQQEGVSPVEVTFVHTLKACGEGRALTTGHAVHGEM 181
A+N ++ GY + +EA+ F+R+Q+EG+ P +VT+++ L AC +L +H +
Sbjct: 497 AYNAMIGGYAAHNLGKEALKLFDRLQEEGLKPDKVTYINMLNACANSGSLEWAREIHTLV 556

Query: 182 IKRGWEGNLDLNNSLVDFYGKCGSVLEARMLFDLLPVRSAVSWTALISGYAEIGLGYEVL 361
K G+ + + N+LV Y KCGS +A ++F+ + R+ +SW A+I G A+ G G + L
Sbjct: 557 RKGGFFSDTSVGNALVSTYAKCGSFSDASIVFEKMTKRNVISWNAIIGGSAQHGRGQDAL 616

Query: 362 DCFRQMQTEAIFLDRVVFICSLKACNMFEAFEIGR 466
F +M+ E + D V F+ L AC+ E GR
Sbjct: 617 QLFERMKMEGVKPDIVTFVSLLSACSHAGLLEEGR 651


>tr|A9T5P5|A9T5P5_PHYPA Predicted protein OS=Physcomitrella patens
subsp. patens GN=PHYPADRAFT_191892 PE=4 SV=1
Length = 905

Score = 155 bits (392), Expect = 2e-36
Identities = 73/208 (35%), Positives = 120/208 (57%)
Frame = +2

Query: 2 AWNTLLAGYINYGFPEEAINCFERMQQEGVSPVEVTFVHTLKACGEGRALTTGHAVHGEM 181
+WN ++AGY EA+ +++MQ EGV P VTF+H L AC A G +H ++
Sbjct: 398 SWNAIIAGYARREDRGEAMRLYKQMQSEGVKPGRVTFLHLLSACANSSAYADGKMIHEDI 457

Query: 182 IKRGWEGNLDLNNSLVDFYGKCGSVLEARMLFDLLPVRSAVSWTALISGYAEIGLGYEVL 361
++ G + N L N+L++ Y +CGS++EA+ +F+ R +SW ++I+G+A+ G
Sbjct: 458 LRSGIKSNGHLANALMNMYRRCGSLMEAQNVFEGTQARDVISWNSMIAGHAQHGSYETAY 517

Query: 362 DCFRQMQTEAIFLDRVVFICSLKACNMFEAFEIGRILHSHVVKRGWERDVTIGNMLLIMY 541
F++MQ E + D + F L C EA E+G+ +H + + G + DV +GN L+ MY
Sbjct: 518 KLFQEMQNEELEPDNITFASVLSGCKNPEALELGKQIHGRITESGLQLDVNLGNALINMY 577

Query: 542 AKCGFLAEAQVLFDELQVQSAESWALLI 625
+CG L +A+ +F LQ + SW +I
Sbjct: 578 IRCGSLQDARNVFHSLQHRDVMSWTAMI 605



Score = 135 bits (340), Expect = 2e-30
Identities = 67/207 (32%), Positives = 114/207 (55%)
Frame = +2

Query: 5 WNTLLAGYINYGFPEEAINCFERMQQEGVSPVEVTFVHTLKACGEGRALTTGHAVHGEMI 184
+N L+A +G EA + RM+ +GV+ T++ L AC +AL G +H +
Sbjct: 298 YNALIAALAQHGHNVEAFEQYYRMRSDGVALNRTTYLSILNACSTSKALEAGKLIHSHIS 357

Query: 185 KRGWEGNLDLNNSLVDFYGKCGSVLEARMLFDLLPVRSAVSWTALISGYAEIGLGYEVLD 364
+ G ++ + N+L+ Y +CG + +AR LF +P R +SW A+I+GYA E +
Sbjct: 358 EDGHSSDVQIGNALISMYARCGDLPKARELFYTMPKRDLISWNAIIAGYARREDRGEAMR 417

Query: 365 CFRQMQTEAIFLDRVVFICSLKACNMFEAFEIGRILHSHVVKRGWERDVTIGNMLLIMYA 544
++QMQ+E + RV F+ L AC A+ G+++H +++ G + + + N L+ MY
Sbjct: 418 LYKQMQSEGVKPGRVTFLHLLSACANSSAYADGKMIHEDILRSGIKSNGHLANALMNMYR 477

Query: 545 KCGFLAEAQVLFDELQVQSAESWALLI 625
+CG L EAQ +F+ Q + SW +I
Sbjct: 478 RCGSLMEAQNVFEGTQARDVISWNSMI 504



Score = 126 bits (317), Expect = 9e-28
Identities = 65/208 (31%), Positives = 114/208 (54%)
Frame = +2

Query: 2 AWNTLLAGYINYGFPEEAINCFERMQQEGVSPVEVTFVHTLKACGEGRALTTGHAVHGEM 181
++NT+L Y + +E + F +M EG+SP +VT+++ L A L G +H
Sbjct: 196 SYNTMLGLYAQKAYVKECLGLFGQMSSEGISPDKVTYINLLDAFTTPSMLDEGKRIHKLT 255

Query: 182 IKRGWEGNLDLNNSLVDFYGKCGSVLEARMLFDLLPVRSAVSWTALISGYAEIGLGYEVL 361
++ G ++ + +LV +CG V A+ F + R V + ALI+ A+ G E
Sbjct: 256 VEEGLNSDIRVGTALVTMCVRCGDVDSAKQAFKGIADRDVVVYNALIAALAQHGHNVEAF 315

Query: 362 DCFRQMQTEAIFLDRVVFICSLKACNMFEAFEIGRILHSHVVKRGWERDVTIGNMLLIMY 541
+ + +M+++ + L+R ++ L AC+ +A E G+++HSH+ + G DV IGN L+ MY
Sbjct: 316 EQYYRMRSDGVALNRTTYLSILNACSTSKALEAGKLIHSHISEDGHSSDVQIGNALISMY 375

Query: 542 AKCGFLAEAQVLFDELQVQSAESWALLI 625
A+CG L +A+ LF + + SW +I
Sbjct: 376 ARCGDLPKARELFYTMPKRDLISWNAII 403



Score = 120 bits (302), Expect = 5e-26
Identities = 63/193 (32%), Positives = 101/193 (52%)
Frame = +2

Query: 2 AWNTLLAGYINYGFPEEAINCFERMQQEGVSPVEVTFVHTLKACGEGRALTTGHAVHGEM 181
+WN+L++ Y GF ++A FE MQ G P ++T++ L AC L G +H ++
Sbjct: 95 SWNSLISCYAQQGFKKKAFQLFEEMQNAGFIPNKITYISILTACYSPAELENGKKIHSQI 154

Query: 182 IKRGWEGNLDLNNSLVDFYGKCGSVLEARMLFDLLPVRSAVSWTALISGYAEIGLGYEVL 361
IK G++ + + NSL+ YGKCG + AR +F + R VS+ ++ YA+ E L
Sbjct: 155 IKAGYQRDPRVQNSLLSMYGKCGDLPRARQVFAGISPRDVVSYNTMLGLYAQKAYVKECL 214

Query: 362 DCFRQMQTEAIFLDRVVFICSLKACNMFEAFEIGRILHSHVVKRGWERDVTIGNMLLIMY 541
F QM +E I D+V +I L A + G+ +H V+ G D+ +G L+ M
Sbjct: 215 GLFGQMSSEGISPDKVTYINLLDAFTTPSMLDEGKRIHKLTVEEGLNSDIRVGTALVTMC 274

Query: 542 AKCGFLAEAQVLF 580
+CG + A+ F
Sbjct: 275 VRCGDVDSAKQAF 287



Score = 113 bits (282), Expect = 1e-23
Identities = 57/173 (32%), Positives = 94/173 (54%)
Frame = +2

Query: 107 TFVHTLKACGEGRALTTGHAVHGEMIKRGWEGNLDLNNSLVDFYGKCGSVLEARMLFDLL 286
T+V L+ C R L +H +M++ G ++ L+N L++ Y KC SVL+A +F +
Sbjct: 29 TYVALLQNCTRKRLLPEAKRIHAQMVEAGVGPDIFLSNLLINMYVKCRSVLDAHQVFKEM 88

Query: 287 PVRSAVSWTALISGYAEIGLGYEVLDCFRQMQTEAIFLDRVVFICSLKACNMFEAFEIGR 466
P R +SW +LIS YA+ G + F +MQ +++ +I L AC E G+
Sbjct: 89 PRRDVISWNSLISCYAQQGFKKKAFQLFEEMQNAGFIPNKITYISILTACYSPAELENGK 148

Query: 467 ILHSHVVKRGWERDVTIGNMLLIMYAKCGFLAEAQVLFDELQVQSAESWALLI 625
+HS ++K G++RD + N LL MY KCG L A+ +F + + S+ ++
Sbjct: 149 KIHSQIIKAGYQRDPRVQNSLLSMYGKCGDLPRARQVFAGISPRDVVSYNTML 201



Score = 103 bits (258), Expect = 6e-21
Identities = 53/147 (36%), Positives = 82/147 (55%), Gaps = 1/147 (0%)
Frame = +2

Query: 2 AWNTLLAGYINYGFPEEAINCFERMQQEGVSPVEVTFVHTLKACGEGRALTTGHAVHGEM 181
+WN+++AG+ +G E A F+ MQ E + P +TF L C AL G +HG +
Sbjct: 499 SWNSMIAGHAQHGSYETAYKLFQEMQNEELEPDNITFASVLSGCKNPEALELGKQIHGRI 558

Query: 182 IKRGWEGNLDLNNSLVDFYGKCGSVLEARMLFDLLPVRSAVSWTALISGYAEIGLGYEVL 361
+ G + +++L N+L++ Y +CGS+ +AR +F L R +SWTA+I G A+ G + +
Sbjct: 559 TESGLQLDVNLGNALINMYIRCGSLQDARNVFHSLQHRDVMSWTAMIGGCADQGEDMKAI 618

Query: 362 DCFRQMQTEAIF-LDRVVFICSLKACN 439
+ F QMQ E D F L ACN
Sbjct: 619 ELFWQMQNEGFRPPDGSTFTSILSACN 645



Score = 44.7 bits (104), Expect = 0.005
Identities = 21/75 (28%), Positives = 38/75 (50%)
Frame = +2

Query: 401 DRVVFICSLKACNMFEAFEIGRILHSHVVKRGWERDVTIGNMLLIMYAKCGFLAEAQVLF 580
DR ++ L+ C + +H+ +V+ G D+ + N+L+ MY KC + +A +F
Sbjct: 26 DRATYVALLQNCTRKRLLPEAKRIHAQMVEAGVGPDIFLSNLLINMYVKCRSVLDAHQVF 85

Query: 581 DELQVQSAESWALLI 625
E+ + SW LI
Sbjct: 86 KEMPRRDVISWNSLI 100


>tr|A9T938|A9T938_PHYPA Predicted protein OS=Physcomitrella patens
subsp. patens GN=PHYPADRAFT_192787 PE=4 SV=1
Length = 804

Score = 152 bits (383), Expect = 2e-35
Identities = 74/208 (35%), Positives = 112/208 (53%)
Frame = +2

Query: 2 AWNTLLAGYINYGFPEEAINCFERMQQEGVSPVEVTFVHTLKACGEGRALTTGHAVHGEM 181
+WN +++GY + G +EA N F MQQE + P + TFV L AC L G +H +
Sbjct: 96 SWNVMISGYAHRGLAQEAFNLFTLMQQERLEPDKFTFVSILSACSSPAVLNWGREIHVRV 155

Query: 182 IKRGWEGNLDLNNSLVDFYGKCGSVLEARMLFDLLPVRSAVSWTALISGYAEIGLGYEVL 361
++ G + + N+L+ Y KCGSV +AR +FD + R VSWT L YAE G G E L
Sbjct: 156 MEAGLANDTTVGNALISMYAKCGSVRDARRVFDAMASRDEVSWTTLTGAYAESGYGEESL 215

Query: 362 DCFRQMQTEAIFLDRVVFICSLKACNMFEAFEIGRILHSHVVKRGWERDVTIGNMLLIMY 541
+ M E + R+ ++ L AC A E G+ +H+H+V+ + DV + L MY
Sbjct: 216 KTYHAMLQERVRPSRITYMNVLSACGSLAALEKGKQIHAHIVESEYHSDVRVSTALTKMY 275

Query: 542 AKCGFLAEAQVLFDELQVQSAESWALLI 625
KCG +A+ +F+ L + +W +I
Sbjct: 276 MKCGAFKDAREVFECLSYRDVIAWNTMI 303



Score = 150 bits (379), Expect = 6e-35
Identities = 73/208 (35%), Positives = 117/208 (56%)
Frame = +2

Query: 2 AWNTLLAGYINYGFPEEAINCFERMQQEGVSPVEVTFVHTLKACGEGRALTTGHAVHGEM 181
AWNT++ G+++ G EEA F RM +EGV+P T+ L AC L G +H
Sbjct: 298 AWNTMIRGFVDSGQLEEAHGTFHRMLEEGVAPDRATYTTVLSACARPGGLARGKEIHARA 357

Query: 182 IKRGWEGNLDLNNSLVDFYGKCGSVLEARMLFDLLPVRSAVSWTALISGYAEIGLGYEVL 361
K G ++ N+L++ Y K GS+ +AR +FD +P R VSWT L+ YA+ E
Sbjct: 358 AKDGLVSDVRFGNALINMYSKAGSMKDARQVFDRMPKRDVVSWTTLLGRYADCDQVVESF 417

Query: 362 DCFRQMQTEAIFLDRVVFICSLKACNMFEAFEIGRILHSHVVKRGWERDVTIGNMLLIMY 541
F+QM + + +++ ++C LKAC+ A + G+ +H+ VVK G D+ + N L+ MY
Sbjct: 418 TTFKQMLQQGVKANKITYMCVLKACSNPVALKWGKEIHAEVVKAGLLADLAVTNALMSMY 477

Query: 542 AKCGFLAEAQVLFDELQVQSAESWALLI 625
KCG + +A +F+ + ++ +W LI
Sbjct: 478 FKCGSVEDAIRVFEGMSMRDVVTWNTLI 505



Score = 130 bits (327), Expect = 6e-29
Identities = 63/208 (30%), Positives = 106/208 (50%)
Frame = +2

Query: 2 AWNTLLAGYINYGFPEEAINCFERMQQEGVSPVEVTFVHTLKACGEGRALTTGHAVHGEM 181
+W TL Y G+ EE++ + M QE V P +T+++ L ACG AL G +H +
Sbjct: 197 SWTTLTGAYAESGYGEESLKTYHAMLQERVRPSRITYMNVLSACGSLAALEKGKQIHAHI 256

Query: 182 IKRGWEGNLDLNNSLVDFYGKCGSVLEARMLFDLLPVRSAVSWTALISGYAEIGLGYEVL 361
++ + ++ ++ +L Y KCG+ +AR +F+ L R ++W +I G+ + G E
Sbjct: 257 VESEYHSDVRVSTALTKMYMKCGAFKDAREVFECLSYRDVIAWNTMIRGFVDSGQLEEAH 316

Query: 362 DCFRQMQTEAIFLDRVVFICSLKACNMFEAFEIGRILHSHVVKRGWERDVTIGNMLLIMY 541
F +M E + DR + L AC G+ +H+ K G DV GN L+ MY
Sbjct: 317 GTFHRMLEEGVAPDRATYTTVLSACARPGGLARGKEIHARAAKDGLVSDVRFGNALINMY 376

Query: 542 AKCGFLAEAQVLFDELQVQSAESWALLI 625
+K G + +A+ +FD + + SW L+
Sbjct: 377 SKAGSMKDARQVFDRMPKRDVVSWTTLL 404



Score = 129 bits (323), Expect = 2e-28
Identities = 66/183 (36%), Positives = 100/183 (54%)
Frame = +2

Query: 74 MQQEGVSPVEVTFVHTLKACGEGRALTTGHAVHGEMIKRGWEGNLDLNNSLVDFYGKCGS 253
+ ++G +V L++C + + L G VH +++ G + N+ + N+L+ Y CGS
Sbjct: 19 LHRKGPQVDSYDYVKLLQSCVKAKDLAVGKQVHEHILRCGVKPNVYITNTLLKLYAHCGS 78

Query: 254 VLEARMLFDLLPVRSAVSWTALISGYAEIGLGYEVLDCFRQMQTEAIFLDRVVFICSLKA 433
V EAR LFD +S VSW +ISGYA GL E + F MQ E + D+ F+ L A
Sbjct: 79 VNEARQLFDKFSNKSVVSWNVMISGYAHRGLAQEAFNLFTLMQQERLEPDKFTFVSILSA 138

Query: 434 CNMFEAFEIGRILHSHVVKRGWERDVTIGNMLLIMYAKCGFLAEAQVLFDELQVQSAESW 613
C+ GR +H V++ G D T+GN L+ MYAKCG + +A+ +FD + + SW
Sbjct: 139 CSSPAVLNWGREIHVRVMEAGLANDTTVGNALISMYAKCGSVRDARRVFDAMASRDEVSW 198

Query: 614 ALL 622
L
Sbjct: 199 TTL 201



Score = 101 bits (252), Expect = 3e-20
Identities = 64/210 (30%), Positives = 107/210 (50%), Gaps = 2/210 (0%)
Frame = +2

Query: 2 AWNTLLAGYINYGFPEEAINCFERMQQEGVSPVEVTFVHTLKACGEGRALTTGHAVHGEM 181
+W TLL Y + E+ F++M Q+GV ++T++ LKAC AL G +H E+
Sbjct: 399 SWTTLLGRYADCDQVVESFTTFKQMLQQGVKANKITYMCVLKACSNPVALKWGKEIHAEV 458

Query: 182 IKRGWEGNLDLNNSLVDFYGKCGSVLEARMLFDLLPVRSAVSWTALISGYAEIGLGYEVL 361
+K G +L + N+L+ Y KCGSV +A +F+ + +R V+W LI G + G G E L
Sbjct: 459 VKAGLLADLAVTNALMSMYFKCGSVEDAIRVFEGMSMRDVVTWNTLIGGLGQNGRGLEAL 518

Query: 362 DCFRQMQTEAIFLDRVVFICSLKACNMFEAFEIGRILHSHVVK-RGWERDVTIGNMLLIM 538
+ M++E + + F+ L AC + E GR + + K G ++ +
Sbjct: 519 QRYEVMKSEGMRPNAATFVNVLSACRVCNLVEEGRRQFAFMSKDYGIVPTEKHYACMVDI 578

Query: 539 YAKCGFLAEAQVLFDELQVQ-SAESWALLI 625
A+ G L EA+ + + ++ SA W L+
Sbjct: 579 LARAGHLREAEDVILTIPLKPSAAMWGALL 608



Score = 53.9 bits (128), Expect = 8e-06
Identities = 27/92 (29%), Positives = 51/92 (55%)
Frame = +2

Query: 350 YEVLDCFRQMQTEAIFLDRVVFICSLKACNMFEAFEIGRILHSHVVKRGWERDVTIGNML 529
Y D + + + +D ++ L++C + +G+ +H H+++ G + +V I N L
Sbjct: 10 YAPADVLQYLHRKGPQVDSYDYVKLLQSCVKAKDLAVGKQVHEHILRCGVKPNVYITNTL 69

Query: 530 LIMYAKCGFLAEAQVLFDELQVQSAESWALLI 625
L +YA CG + EA+ LFD+ +S SW ++I
Sbjct: 70 LKLYAHCGSVNEARQLFDKFSNKSVVSWNVMI 101


>tr|A2XK21|A2XK21_ORYSI Putative uncharacterized protein OS=Oryza
sativa subsp. indica GN=OsI_12790 PE=4 SV=1
Length = 885

Score = 150 bits (380), Expect = 5e-35
Identities = 66/208 (31%), Positives = 122/208 (58%)
Frame = +2

Query: 2 AWNTLLAGYINYGFPEEAINCFERMQQEGVSPVEVTFVHTLKACGEGRALTTGHAVHGEM 181
+W T++ Y+ +G +A+ F M EG P E T LKAC E +A+ G +H +
Sbjct: 517 SWTTMITAYVQHGHGGQALRMFSEMVSEGFRPNEFTVCSVLKACAEEKAVRFGKQLHCAV 576

Query: 182 IKRGWEGNLDLNNSLVDFYGKCGSVLEARMLFDLLPVRSAVSWTALISGYAEIGLGYEVL 361
+K+ ++ ++ + ++LV Y +CG V +A+ +FD++P R+ ++WT++ISGYA+ G G + +
Sbjct: 577 LKKMYKNDIHIGSALVTMYARCGEVFDAQAVFDMMPRRNTITWTSMISGYAQSGHGEKAI 636

Query: 362 DCFRQMQTEAIFLDRVVFICSLKACNMFEAFEIGRILHSHVVKRGWERDVTIGNMLLIMY 541
FR+M+ +F++ + + L AC ++ +G+ LH+ ++K E ++ IG+ L+ Y
Sbjct: 637 FLFRKMKMRRVFVNNLTIVGLLSACGSLQSLYLGKELHAQIIKNSMEDNLQIGSTLVWFY 696

Query: 542 AKCGFLAEAQVLFDELQVQSAESWALLI 625
KCG A + + + + A SW LI
Sbjct: 697 CKCGEYTYAARILEAMPDRDAISWTALI 724



Score = 136 bits (343), Expect = 9e-31
Identities = 72/207 (34%), Positives = 113/207 (54%)
Frame = +2

Query: 5 WNTLLAGYINYGFPEEAINCFERMQQEGVSPVEVTFVHTLKACGEGRALTTGHAVHGEMI 184
W ++++GY G E+AI F +M+ V +T V L ACG ++L G +H ++I
Sbjct: 619 WTSMISGYAQSGHGEKAIFLFRKMKMRRVFVNNLTIVGLLSACGSLQSLYLGKELHAQII 678

Query: 185 KRGWEGNLDLNNSLVDFYGKCGSVLEARMLFDLLPVRSAVSWTALISGYAEIGLGYEVLD 364
K E NL + ++LV FY KCG A + + +P R A+SWTALISGY +G E L
Sbjct: 679 KNSMEDNLQIGSTLVWFYCKCGEYTYAARILEAMPDRDAISWTALISGYNNLGHNVEALK 738

Query: 365 CFRQMQTEAIFLDRVVFICSLKACNMFEAFEIGRILHSHVVKRGWERDVTIGNMLLIMYA 544
M + + + + +LKAC EA + GR +H V K +V +G+ L+ MY
Sbjct: 739 SLDDMLWDGVKPNTYTYSSALKACAKLEALQYGRKIHGFVNKTQDFSNVFVGSSLIDMYM 798

Query: 545 KCGFLAEAQVLFDELQVQSAESWALLI 625
+CG + EA+ +FD + + +W ++I
Sbjct: 799 RCGKVDEARRVFDAMPEHNLVTWKVII 825



Score = 131 bits (330), Expect = 3e-29
Identities = 71/209 (33%), Positives = 115/209 (55%), Gaps = 1/209 (0%)
Frame = +2

Query: 2 AWNTLLAGYINYGFPEEAINCFERMQQEGVSPVEVTFVHTLKACGEGRALTTGHAVHGEM 181
+W ++ Y+ G E + F M GV +TFV LK+CGE G VH +
Sbjct: 417 SWTAMMNAYLKLGHYGEVVRLFFDMVGSGVQGNSLTFVCLLKSCGERCDAKLGQQVHCCI 476

Query: 182 IKRGWEGNLDLNNSLVDFYGKCGSVLEARMLFDLLPVRSAVSWTALISGYAEIGLGYEVL 361
+K GW N+ +++++ FY +CG V A +FD + R +SWT +I+ Y + G G + L
Sbjct: 477 VKGGWS-NVIVDSAIAHFYAQCGDVASASAIFDKMASRDVISWTTMITAYVQHGHGGQAL 535

Query: 362 DCFRQMQTEAIFLDRVVFICS-LKACNMFEAFEIGRILHSHVVKRGWERDVTIGNMLLIM 538
F +M +E F +CS LKAC +A G+ LH V+K+ ++ D+ IG+ L+ M
Sbjct: 536 RMFSEMVSEG-FRPNEFTVCSVLKACAEEKAVRFGKQLHCAVLKKMYKNDIHIGSALVTM 594

Query: 539 YAKCGFLAEAQVLFDELQVQSAESWALLI 625
YA+CG + +AQ +FD + ++ +W +I
Sbjct: 595 YARCGEVFDAQAVFDMMPRRNTITWTSMI 623



Score = 97.8 bits (242), Expect = 5e-19
Identities = 53/145 (36%), Positives = 78/145 (53%)
Frame = +2

Query: 2 AWNTLLAGYINYGFPEEAINCFERMQQEGVSPVEVTFVHTLKACGEGRALTTGHAVHGEM 181
+W L++GY N G EA+ + M +GV P T+ LKAC + AL G +HG +
Sbjct: 719 SWTALISGYNNLGHNVEALKSLDDMLWDGVKPNTYTYSSALKACAKLEALQYGRKIHGFV 778

Query: 182 IKRGWEGNLDLNNSLVDFYGKCGSVLEARMLFDLLPVRSAVSWTALISGYAEIGLGYEVL 361
K N+ + +SL+D Y +CG V EAR +FD +P + V+W +I+G+A+ GL E L
Sbjct: 779 NKTQDFSNVFVGSSLIDMYMRCGKVDEARRVFDAMPEHNLVTWKVIITGFAQNGLCEEAL 838

Query: 362 DCFRQMQTEAIFLDRVVFICSLKAC 436
MQ E +D V L +C
Sbjct: 839 KYMYLMQQEGHEVDDFVLSTVLTSC 863



Score = 91.7 bits (226), Expect = 3e-17
Identities = 59/197 (29%), Positives = 97/197 (49%)
Frame = +2

Query: 35 YGFPEEAINCFERMQQEGVSPVEVTFVHTLKACGEGRALTTGHAVHGEMIKRGWEGNLDL 214
YG PE+ + E P +L+ CG + HAV + G
Sbjct: 336 YGSPEQ------EGRGESSLPDAEALASSLRDCGGADGVRRVHAVAVRSLDS--LGTFVA 387

Query: 215 NNSLVDFYGKCGSVLEARMLFDLLPVRSAVSWTALISGYAEIGLGYEVLDCFRQMQTEAI 394
NN L+ Y + V +AR +FD +P RS VSWTA+++ Y ++G EV+ F M +
Sbjct: 388 NN-LISAYARFDEVSDARKVFDEMPERSVVSWTAMMNAYLKLGHYGEVVRLFFDMVGSGV 446

Query: 395 FLDRVVFICSLKACNMFEAFEIGRILHSHVVKRGWERDVTIGNMLLIMYAKCGFLAEAQV 574
+ + F+C LK+C ++G+ +H +VK GW +V + + + YA+CG +A A
Sbjct: 447 QGNSLTFVCLLKSCGERCDAKLGQQVHCCIVKGGWS-NVIVDSAIAHFYAQCGDVASASA 505

Query: 575 LFDELQVQSAESWALLI 625
+FD++ + SW +I
Sbjct: 506 IFDKMASRDVISWTTMI 522


>tr|B8LKN6|B8LKN6_PICSI Putative uncharacterized protein OS=Picea
sitchensis PE=2 SV=1
Length = 394

Score = 150 bits (378), Expect = 8e-35
Identities = 71/208 (34%), Positives = 122/208 (58%), Gaps = 1/208 (0%)
Frame = +2

Query: 5 WNTLLAGYINYGFPEEAINCFERMQQ-EGVSPVEVTFVHTLKACGEGRALTTGHAVHGEM 181
WN ++ GY+ +G EA+ + +MQ+ +P T+ L AC +L+ G ++ E+
Sbjct: 80 WNVMIGGYVKHGETREALELYHQMQKVSSTNPDNYTYSSVLNACARLASLSEGKLIYDEI 139

Query: 182 IKRGWEGNLDLNNSLVDFYGKCGSVLEARMLFDLLPVRSAVSWTALISGYAEIGLGYEVL 361
I +G E ++ + N+L++ + KCGS+ +AR +FD + R+ VSWTA++SGYA+ G E L
Sbjct: 140 ISKGCEMDVIVENALINMFMKCGSIEDARRVFDKMCERNLVSWTAMVSGYAQGGFADEAL 199

Query: 362 DCFRQMQTEAIFLDRVVFICSLKACNMFEAFEIGRILHSHVVKRGWERDVTIGNMLLIMY 541
F +MQ E + + V L AC + G+ +H ++++RG + + +GN L+ MY
Sbjct: 200 RMFYEMQGEDVKANYVTVASVLPACAQLSDLQQGKEIHGYIIRRGLDLGIVVGNALIDMY 259

Query: 542 AKCGFLAEAQVLFDELQVQSAESWALLI 625
AKCG + AQ +FD++ + SW + I
Sbjct: 260 AKCGSIGSAQKVFDKMLQRDVVSWNVAI 287



Score = 105 bits (263), Expect = 2e-21
Identities = 62/214 (28%), Positives = 97/214 (45%), Gaps = 35/214 (16%)
Frame = +2

Query: 2 AWNTLLAGYINYGFPEEAINCFERMQQEGVSPVEVTFVHTLKACGEGRALTTGHAVHGEM 181
+W +++GY GF +EA+ F MQ E V VT L AC + L G +HG +
Sbjct: 181 SWTAMVSGYAQGGFADEALRMFYEMQGEDVKANYVTVASVLPACAQLSDLQQGKEIHGYI 240

Query: 182 IKRGWEGNLDLNNSLVDFYGKCGSVLEARMLFDLLPVRSAVSWTALISG----------- 328
I+RG + + + N+L+D Y KCGS+ A+ +FD + R VSW I+G
Sbjct: 241 IRRGLDLGIVVGNALIDMYAKCGSIGSAQKVFDKMLQRDVVSWNVAIAGYAQNGRFDECM 300

Query: 329 ------------------------YAEIGLGYEVLDCFRQMQTEAIFLDRVVFICSLKAC 436
YA+ G G + L+ F+QMQ + + + L AC
Sbjct: 301 ELFRKMQCAGLKIDVITWNTLITAYAQNGYGDQTLELFQQMQLRGVKPNSITIASVLSAC 360

Query: 437 NMFEAFEIGRILHSHVVKRGWERDVTIGNMLLIM 538
A + G+ +H V + + D+ +GN L+ M
Sbjct: 361 AAVSALQEGKRIHDLVNRSECKSDICVGNALIDM 394



Score = 92.4 bits (228), Expect = 2e-17
Identities = 47/169 (27%), Positives = 84/169 (49%), Gaps = 1/169 (0%)
Frame = +2

Query: 122 LKACGEGRALTTGHAVHGEMIKRGWEGNLDLNNSLVDFYGKCGSVLEARMLFDLLPVRSA 301
L C + + L VH M+ G + L++ Y KCGS+ +AR+ FD +
Sbjct: 18 LHLCTKAKTLAEAKQVHAHMLLTGILRIPSVETKLLNLYVKCGSLPDARLAFDNMTKGDV 77

Query: 302 VSWTALISGYAEIGLGYEVLDCFRQMQ-TEAIFLDRVVFICSLKACNMFEAFEIGRILHS 478
W +I GY + G E L+ + QMQ + D + L AC + G++++
Sbjct: 78 FPWNVMIGGYVKHGETREALELYHQMQKVSSTNPDNYTYSSVLNACARLASLSEGKLIYD 137

Query: 479 HVVKRGWERDVTIGNMLLIMYAKCGFLAEAQVLFDELQVQSAESWALLI 625
++ +G E DV + N L+ M+ KCG + +A+ +FD++ ++ SW ++
Sbjct: 138 EIISKGCEMDVIVENALINMFMKCGSIEDARRVFDKMCERNLVSWTAMV 186


>tr|Q60DN6|Q60DN6_ORYSJ Os03g0644200 protein OS=Oryza sativa subsp.
japonica GN=OSJNBa0038E17.22 PE=2 SV=1
Length = 616

Score = 149 bits (377), Expect = 1e-34
Identities = 66/208 (31%), Positives = 122/208 (58%)
Frame = +2

Query: 2 AWNTLLAGYINYGFPEEAINCFERMQQEGVSPVEVTFVHTLKACGEGRALTTGHAVHGEM 181
+W T++ Y+ +G +A+ F M EG P E T LKAC E +A+ G +H +
Sbjct: 248 SWTTMITAYVQHGHGGQALRMFSEMVSEGFRPNEFTVCSVLKACAEEKAVRFGKQLHCAV 307

Query: 182 IKRGWEGNLDLNNSLVDFYGKCGSVLEARMLFDLLPVRSAVSWTALISGYAEIGLGYEVL 361
+K+ ++ ++ + ++LV Y +CG V +A+ +FD++P R+ ++WT++ISGYA+ G G + +
Sbjct: 308 LKKMYKNDIHIGSALVTMYARCGEVFDAQAVFDMMPRRNTITWTSMISGYAQSGHGEKAI 367

Query: 362 DCFRQMQTEAIFLDRVVFICSLKACNMFEAFEIGRILHSHVVKRGWERDVTIGNMLLIMY 541
FR+M+ +F++ + + L AC ++ +G+ LH+ ++K E ++ IG+ L+ Y
Sbjct: 368 LLFRKMKMRRVFVNNLTIVGLLSACGSLQSPYLGKELHAQIIKNSMEENLQIGSTLVWFY 427

Query: 542 AKCGFLAEAQVLFDELQVQSAESWALLI 625
KCG A + + + + A SW LI
Sbjct: 428 CKCGEYTYAARILEAMPDRDAISWTALI 455



Score = 134 bits (336), Expect = 6e-30
Identities = 71/207 (34%), Positives = 112/207 (54%)
Frame = +2

Query: 5 WNTLLAGYINYGFPEEAINCFERMQQEGVSPVEVTFVHTLKACGEGRALTTGHAVHGEMI 184
W ++++GY G E+AI F +M+ V +T V L ACG ++ G +H ++I
Sbjct: 350 WTSMISGYAQSGHGEKAILLFRKMKMRRVFVNNLTIVGLLSACGSLQSPYLGKELHAQII 409

Query: 185 KRGWEGNLDLNNSLVDFYGKCGSVLEARMLFDLLPVRSAVSWTALISGYAEIGLGYEVLD 364
K E NL + ++LV FY KCG A + + +P R A+SWTALISGY +G E L
Sbjct: 410 KNSMEENLQIGSTLVWFYCKCGEYTYAARILEAMPDRDAISWTALISGYNNLGHNVEALK 469

Query: 365 CFRQMQTEAIFLDRVVFICSLKACNMFEAFEIGRILHSHVVKRGWERDVTIGNMLLIMYA 544
M + + + + +LKAC EA + GR +H V K +V +G+ L+ MY
Sbjct: 470 SLDDMLWDGVKPNTYTYSSALKACAKLEALQYGRKIHGFVNKTQDFSNVFVGSSLIDMYM 529

Query: 545 KCGFLAEAQVLFDELQVQSAESWALLI 625
+CG + EA+ +FD + + +W ++I
Sbjct: 530 RCGKVDEARSVFDAMPEHNLVTWKVII 556



Score = 130 bits (328), Expect = 5e-29
Identities = 71/209 (33%), Positives = 115/209 (55%), Gaps = 1/209 (0%)
Frame = +2

Query: 2 AWNTLLAGYINYGFPEEAINCFERMQQEGVSPVEVTFVHTLKACGEGRALTTGHAVHGEM 181
+W ++ Y+ G E + F M GV +TFV LK+CGE G VH +
Sbjct: 148 SWTAMMNVYLKLGHYGEVVRLFFDMVGSGVQGNSLTFVCLLKSCGERCDAKLGQQVHCCI 207

Query: 182 IKRGWEGNLDLNNSLVDFYGKCGSVLEARMLFDLLPVRSAVSWTALISGYAEIGLGYEVL 361
+K GW N+ +++++ FY +CG V A +FD + R +SWT +I+ Y + G G + L
Sbjct: 208 VKGGWS-NVIVDSAIAHFYAQCGDVASASAIFDKMAYRDVISWTTMITAYVQHGHGGQAL 266

Query: 362 DCFRQMQTEAIFLDRVVFICS-LKACNMFEAFEIGRILHSHVVKRGWERDVTIGNMLLIM 538
F +M +E F +CS LKAC +A G+ LH V+K+ ++ D+ IG+ L+ M
Sbjct: 267 RMFSEMVSEG-FRPNEFTVCSVLKACAEEKAVRFGKQLHCAVLKKMYKNDIHIGSALVTM 325

Query: 539 YAKCGFLAEAQVLFDELQVQSAESWALLI 625
YA+CG + +AQ +FD + ++ +W +I
Sbjct: 326 YARCGEVFDAQAVFDMMPRRNTITWTSMI 354



Score = 97.8 bits (242), Expect = 5e-19
Identities = 53/145 (36%), Positives = 78/145 (53%)
Frame = +2

Query: 2 AWNTLLAGYINYGFPEEAINCFERMQQEGVSPVEVTFVHTLKACGEGRALTTGHAVHGEM 181
+W L++GY N G EA+ + M +GV P T+ LKAC + AL G +HG +
Sbjct: 450 SWTALISGYNNLGHNVEALKSLDDMLWDGVKPNTYTYSSALKACAKLEALQYGRKIHGFV 509

Query: 182 IKRGWEGNLDLNNSLVDFYGKCGSVLEARMLFDLLPVRSAVSWTALISGYAEIGLGYEVL 361
K N+ + +SL+D Y +CG V EAR +FD +P + V+W +I+G+A+ GL E L
Sbjct: 510 NKTQDFSNVFVGSSLIDMYMRCGKVDEARSVFDAMPEHNLVTWKVIITGFAQNGLCEEAL 569

Query: 362 DCFRQMQTEAIFLDRVVFICSLKAC 436
MQ E +D V L +C
Sbjct: 570 KYMYLMQQEGHEVDDFVLSTVLTSC 594



Score = 90.5 bits (223), Expect = 7e-17
Identities = 59/197 (29%), Positives = 97/197 (49%)
Frame = +2

Query: 35 YGFPEEAINCFERMQQEGVSPVEVTFVHTLKACGEGRALTTGHAVHGEMIKRGWEGNLDL 214
YG PE+ + E P +L+ CG + HAV + G
Sbjct: 67 YGSPEQ------EGRGESSLPNAEALASSLRDCGGADGVRRVHAVAVRSLDS--LGTFVA 118

Query: 215 NNSLVDFYGKCGSVLEARMLFDLLPVRSAVSWTALISGYAEIGLGYEVLDCFRQMQTEAI 394
NN L+ Y + V +AR +FD +P RS VSWTA+++ Y ++G EV+ F M +
Sbjct: 119 NN-LISAYARFDEVSDAREVFDEMPERSVVSWTAMMNVYLKLGHYGEVVRLFFDMVGSGV 177

Query: 395 FLDRVVFICSLKACNMFEAFEIGRILHSHVVKRGWERDVTIGNMLLIMYAKCGFLAEAQV 574
+ + F+C LK+C ++G+ +H +VK GW +V + + + YA+CG +A A
Sbjct: 178 QGNSLTFVCLLKSCGERCDAKLGQQVHCCIVKGGWS-NVIVDSAIAHFYAQCGDVASASA 236

Query: 575 LFDELQVQSAESWALLI 625
+FD++ + SW +I
Sbjct: 237 IFDKMAYRDVISWTTMI 253