DK950387
Clone id TST38A01NGRL0008_I09
Library
Length 646
Definition Adiantum capillus-veneris mRNA. clone: TST38A01NGRL0008_I09. 5' end sequence.
Accession
Tissue type prothallia
Developmental stage gametophyte
Contig ID -
Sequence
GAAGGCAGCAAAGCGACTACGTTTCTTGCAAAACTGAAGGAATTCTAAATGGGCATTGAG
AATCTAAGCTCTCGGAGAGAAAGCCGTTATTTTGAGCGATCTGCTCGCAGACCTCGCCCT
TACAGGTCCTCTGCTGGGGGGAGAATAAGGAAGACACCTCGGCTTCCTGTGGATATTTGC
AACAATTGCCACCGCAGTGGACACTTTGCTAGAGATTGCCCAAATCCGGCTTTGTGCAAC
AATTGTGGTCTTCCTGGGCATATTGCTTCTGTTTGTACCAATGACTCTATCTGCTGGAAC
TGCAAAGAGCCTGGGCATAATGCGAAGGGCTGTCCCAATGAAACAGTTTGCGTTCTCTGC
AACAAGCCTGGTCATGTGGCTAAGAATTGCACTGCCAAAGAGGGTGACACACGGCTGTGC
CGGAACTGTCAAAGGCCTGGACATTTGGCAGCAGATTGTAAAAACGAGAAAGCGTGCAAC
AACTGTCGCAAGCCTGGACATCTTGCAAGGGATTGCAAGAATAGTCCTGTCTGTAATGTA
TGCAATCAAGTGGGCCATATTGCCCGCGATTGTGATTCGAGCGCGCCGAGAAGACGAGCT
GCTTCCCCAATGCCAGTGAGAGAGCCTCTCATTTGCAGGAATTGTA
■■Homology search results ■■ -
sp_hit_id P53849
Definition sp|P53849|GIS2_YEAST Zinc finger protein GIS2 OS=Saccharomyces cerevisiae
Align length 146
Score (bit) 117.0
E-value 5.0e-26
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= DK950387|Adiantum capillus-veneris mRNA, clone:
TST38A01NGRL0008_I09, 5'
(646 letters)

Database: uniprot_sprot.fasta
412,525 sequences; 148,809,765 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

sp|P53849|GIS2_YEAST Zinc finger protein GIS2 OS=Saccharomyces c... 117 5e-26
sp|Q3T0Q6|CNBP_BOVIN Cellular nucleic acid-binding protein OS=Bo... 105 3e-22
sp|O42395|CNBP_CHICK Cellular nucleic acid-binding protein OS=Ga... 104 3e-22
sp|P53996|CNBP_MOUSE Cellular nucleic acid-binding protein OS=Mu... 103 8e-22
sp|P62634|CNBP_RAT Cellular nucleic acid-binding protein OS=Ratt... 102 2e-21
sp|Q5R5R5|CNBP_PONAB Cellular nucleic acid-binding protein OS=Po... 102 2e-21
sp|P62633|CNBP_HUMAN Cellular nucleic acid-binding protein OS=Ho... 102 2e-21
sp|Q04832|HEXP_LEIMA DNA-binding protein HEXBP OS=Leishmania maj... 100 1e-20
sp|P36627|BYR3_SCHPO Cellular nucleic acid-binding protein homol... 99 2e-20
sp|Q8WW36|ZCH13_HUMAN Zinc finger CCHC domain-containing protein... 95 4e-19
sp|O76743|GLH4_CAEEL ATP-dependent RNA helicase glh-4 OS=Caenorh... 78 5e-14
sp|P40507|AIR1_YEAST Protein AIR1 OS=Saccharomyces cerevisiae GN... 67 8e-11
sp|Q12476|AIR2_YEAST Protein AIR2 OS=Saccharomyces cerevisiae GN... 66 2e-10
sp|Q966L9|GLH2_CAEEL ATP-dependent RNA helicase glh-2 OS=Caenorh... 64 7e-10
sp|P31821|GAG_FIVT2 Gag polyprotein OS=Feline immunodeficiency v... 60 1e-08
sp|Q9P795|AIR1_SCHPO Protein air1 OS=Schizosaccharomyces pombe G... 59 2e-08
sp|Q8N3Z6|ZCHC7_HUMAN Zinc finger CCHC domain-containing protein... 58 4e-08
sp|P34689|GLH1_CAEEL ATP-dependent RNA helicase glh-1 OS=Caenorh... 57 8e-08
sp|Q05313|GAG_FIVWO Gag polyprotein OS=Feline immunodeficiency v... 57 1e-07
sp|P19027|GAG_FIVSD Gag polyprotein OS=Feline immunodeficiency v... 56 2e-07
sp|P16087|GAG_FIVPE Gag polyprotein OS=Feline immunodeficiency v... 55 2e-07
sp|Q82851|POL_JEMBR Gag-Pol polyprotein OS=Jembrana disease viru... 55 4e-07
sp|Q82850|GAG_JEMBR Gag polyprotein OS=Jembrana disease virus GN... 55 4e-07
sp|Q8N567|ZCHC9_HUMAN Zinc finger CCHC domain-containing protein... 54 7e-07
sp|Q9HFF2|YL92_SCHPO Uncharacterized protein C683.02c OS=Schizos... 54 7e-07
sp|P35955|GAG_VILVK Gag polyprotein OS=Maedi visna virus (strain... 52 3e-06
sp|P23425|GAG_VILV2 Gag polyprotein OS=Maedi visna virus (strain... 51 5e-06
sp|P23424|GAG_VILV1 Gag polyprotein OS=Maedi visna virus (strain... 51 5e-06
sp|P03352|GAG_VILV Gag polyprotein OS=Maedi visna virus (strain ... 51 5e-06
sp|P69732|GAG_EIAVY Gag polyprotein OS=Equine infectious anemia ... 51 5e-06

>sp|P53849|GIS2_YEAST Zinc finger protein GIS2 OS=Saccharomyces
cerevisiae GN=GIS2 PE=1 SV=1
Length = 153

Score = 117 bits (293), Expect = 5e-26
Identities = 54/146 (36%), Positives = 75/146 (51%), Gaps = 14/146 (9%)
Frame = +1

Query: 178 CNNCHRSGHFARDCPNPALCNNCGLPGHIASVCTNDSI-----CWNCKEPGHNAKGCPNE 342
C C + GH A DC + LC NC PGH+ + CT C+NC E GH C +
Sbjct: 6 CYVCGKIGHLAEDCDSERLCYNCNKPGHVQTDCTMPRTVEFKQCYNCGETGHVRSECTVQ 65

Query: 343 TVCVLCNKPGHVAKNCTAKEGDTRL----CRNCQRPGHLAADCKNEKA-----CNNCRKP 495
C CN+ GH+++ C + +R C C P H+A DC E C C +
Sbjct: 66 R-CFNCNQTGHISRECPEPKKTSRFSKVSCYKCGGPNHMAKDCMKEDGISGLKCYTCGQA 124

Query: 496 GHLARDCKNSPVCNVCNQVGHIARDC 573
GH++RDC+N +C CN+ GHI++DC
Sbjct: 125 GHMSRDCQNDRLCYNCNETGHISKDC 150



Score = 107 bits (267), Expect = 5e-23
Identities = 47/128 (36%), Positives = 72/128 (56%), Gaps = 14/128 (10%)
Frame = +1

Query: 175 ICNNCHRSGHFARDCPNPAL-----CNNCGLPGHIASVCTNDSICWNCKEPGHNAKGCP- 336
+C NC++ GH DC P C NCG GH+ S CT C+NC + GH ++ CP
Sbjct: 24 LCYNCNKPGHVQTDCTMPRTVEFKQCYNCGETGHVRSECTVQR-CFNCNQTGHISRECPE 82

Query: 337 -------NETVCVLCNKPGHVAKNCTAKEGDTRL-CRNCQRPGHLAADCKNEKACNNCRK 492
++ C C P H+AK+C ++G + L C C + GH++ DC+N++ C NC +
Sbjct: 83 PKKTSRFSKVSCYKCGGPNHMAKDCMKEDGISGLKCYTCGQAGHMSRDCQNDRLCYNCNE 142

Query: 493 PGHLARDC 516
GH+++DC
Sbjct: 143 TGHISKDC 150



Score = 90.9 bits (224), Expect = 5e-18
Identities = 43/133 (32%), Positives = 61/133 (45%), Gaps = 18/133 (13%)
Frame = +1

Query: 235 CNNCGLPGHIASVCTNDSICWNCKEPGHNAKGCPNETV-----CVLCNKPGHVAKNCTAK 399
C CG GH+A C ++ +C+NC +PGH C C C + GHV CT +
Sbjct: 6 CYVCGKIGHLAEDCDSERLCYNCNKPGHVQTDCTMPRTVEFKQCYNCGETGHVRSECTVQ 65

Query: 400 EGDTRLCRNCQRPGHLAADCKNEK--------ACNNCRKPGHLARDCKNSP-----VCNV 540
C NC + GH++ +C K +C C P H+A+DC C
Sbjct: 66 R-----CFNCNQTGHISRECPEPKKTSRFSKVSCYKCGGPNHMAKDCMKEDGISGLKCYT 120

Query: 541 CNQVGHIARDCDS 579
C Q GH++RDC +
Sbjct: 121 CGQAGHMSRDCQN 133



Score = 72.8 bits (177), Expect = 1e-12
Identities = 30/87 (34%), Positives = 47/87 (54%), Gaps = 13/87 (14%)
Frame = +1

Query: 169 VDICNNCHRSGHFARDCPNP--------ALCNNCGLPGHIASVCTNDS-----ICWNCKE 309
V C NC+++GH +R+CP P C CG P H+A C + C+ C +
Sbjct: 64 VQRCFNCNQTGHISRECPEPKKTSRFSKVSCYKCGGPNHMAKDCMKEDGISGLKCYTCGQ 123

Query: 310 PGHNAKGCPNETVCVLCNKPGHVAKNC 390
GH ++ C N+ +C CN+ GH++K+C
Sbjct: 124 AGHMSRDCQNDRLCYNCNETGHISKDC 150



Score = 72.0 bits (175), Expect = 2e-12
Identities = 33/84 (39%), Positives = 48/84 (57%), Gaps = 5/84 (5%)
Frame = +1

Query: 337 NETVCVLCNKPGHVAKNCTAKEGDTRLCRNCQRPGHLAADCK-----NEKACNNCRKPGH 501
++ C +C K GH+A++C ++ RLC NC +PGH+ DC K C NC + GH
Sbjct: 2 SQKACYVCGKIGHLAEDCDSE----RLCYNCNKPGHVQTDCTMPRTVEFKQCYNCGETGH 57

Query: 502 LARDCKNSPVCNVCNQVGHIARDC 573
+ +C C CNQ GHI+R+C
Sbjct: 58 VRSEC-TVQRCFNCNQTGHISREC 80



Score = 58.5 bits (140), Expect = 3e-08
Identities = 26/68 (38%), Positives = 33/68 (48%), Gaps = 5/68 (7%)
Frame = +1

Query: 148 RKTPRLPVDICNNCHRSGHFARDCPNP-----ALCNNCGLPGHIASVCTNDSICWNCKEP 312
+KT R C C H A+DC C CG GH++ C ND +C+NC E
Sbjct: 84 KKTSRFSKVSCYKCGGPNHMAKDCMKEDGISGLKCYTCGQAGHMSRDCQNDRLCYNCNET 143

Query: 313 GHNAKGCP 336
GH +K CP
Sbjct: 144 GHISKDCP 151


>sp|Q3T0Q6|CNBP_BOVIN Cellular nucleic acid-binding protein OS=Bos
taurus GN=CNBP PE=2 SV=1
Length = 170

Score = 105 bits (261), Expect = 3e-22
Identities = 60/166 (36%), Positives = 78/166 (46%), Gaps = 30/166 (18%)
Frame = +1

Query: 178 CNNCHRSGHFARDCPN----------------------PALCNNCGLPGHIASVC-TNDS 288
C C RSGH+AR+CP P +C CG GH+A C +
Sbjct: 6 CFKCGRSGHWARECPTGGGRGRGMRSRGRGFQFVSSSLPDICYRCGESGHLAKDCDLQED 65

Query: 289 ICWNCKEPGHNAKGC-----PNETVCVLCNKPGHVAKNCTAKEGDTRLCRNCQRPGHLAA 453
C+NC GH AK C E C C KPGH+A++C D + C +C GH+
Sbjct: 66 ACYNCGRGGHIAKDCKEPKREREQCCYNCGKPGHLARDC--DHADEQKCYSCGEFGHIQK 123

Query: 454 DCKNEKACNNCRKPGHLARDC-KNSPV-CNVCNQVGHIARDCDSSA 585
DC K C C + GH+A +C K S V C C + GH+AR+C A
Sbjct: 124 DCTKVK-CYRCGETGHVAINCSKTSEVNCYRCGESGHLARECTIEA 168



Score = 84.3 bits (207), Expect = 5e-16
Identities = 45/109 (41%), Positives = 56/109 (51%), Gaps = 7/109 (6%)
Frame = +1

Query: 163 LPVDICNNCHRSGHFARDCPNP-----ALCNNCGLPGHIASVC--TNDSICWNCKEPGHN 321
L D C NC R GH A+DC P C NCG PGH+A C ++ C++C E GH
Sbjct: 62 LQEDACYNCGRGGHIAKDCKEPKREREQCCYNCGKPGHLARDCDHADEQKCYSCGEFGHI 121

Query: 322 AKGCPNETVCVLCNKPGHVAKNCTAKEGDTRLCRNCQRPGHLAADCKNE 468
K C + C C + GHVA NC +K + C C GHLA +C E
Sbjct: 122 QKDC-TKVKCYRCGETGHVAINC-SKTSEVN-CYRCGESGHLARECTIE 167


>sp|O42395|CNBP_CHICK Cellular nucleic acid-binding protein
OS=Gallus gallus GN=CNBP PE=2 SV=1
Length = 172

Score = 104 bits (260), Expect = 3e-22
Identities = 60/168 (35%), Positives = 78/168 (46%), Gaps = 32/168 (19%)
Frame = +1

Query: 178 CNNCHRSGHFARDCPN-----------------------PALCNNCGLPGHIASVC--TN 282
C C R+GH+AR+CP P +C CG GH+A C
Sbjct: 6 CFKCGRTGHWARECPTGIGRGRGMRSRGRAGFQFMSSSLPDICYRCGESGHLAKDCDLQE 65

Query: 283 DSICWNCKEPGHNAKGC-----PNETVCVLCNKPGHVAKNCTAKEGDTRLCRNCQRPGHL 447
D C+NC GH AK C E C C KPGH+A++C D + C +C GH+
Sbjct: 66 DKACYNCGRGGHIAKDCKEPKREREQCCYNCGKPGHLARDC--DHADEQKCYSCGEFGHI 123

Query: 448 AADCKNEKACNNCRKPGHLARDC-KNSPV-CNVCNQVGHIARDCDSSA 585
DC K C C + GH+A +C K S V C C + GH+AR+C A
Sbjct: 124 QKDCTKVK-CYRCGETGHVAINCSKTSEVNCYRCGESGHLARECTIEA 170


>sp|P53996|CNBP_MOUSE Cellular nucleic acid-binding protein OS=Mus
musculus GN=Cnbp PE=2 SV=2
Length = 178

Score = 103 bits (257), Expect = 8e-22
Identities = 61/174 (35%), Positives = 78/174 (44%), Gaps = 38/174 (21%)
Frame = +1

Query: 178 CNNCHRSGHFARDCPN-----------------------------PALCNNCGLPGHIAS 270
C C RSGH+AR+CP P +C CG GH+A
Sbjct: 6 CFKCGRSGHWARECPTGGGRGRGMRSRGRGGFTSDRGFQFVSSSLPDICYRCGESGHLAK 65

Query: 271 VC--TNDSICWNCKEPGHNAKGC-----PNETVCVLCNKPGHVAKNCTAKEGDTRLCRNC 429
C D C+NC GH AK C E C C KPGH+A++C D + C +C
Sbjct: 66 DCDLQEDEACYNCGRGGHIAKDCKEPKREREQCCYNCGKPGHLARDC--DHADEQKCYSC 123

Query: 430 QRPGHLAADCKNEKACNNCRKPGHLARDC-KNSPV-CNVCNQVGHIARDCDSSA 585
GH+ DC K C C + GH+A +C K S V C C + GH+AR+C A
Sbjct: 124 GEFGHIQKDCTKVK-CYRCGETGHVAINCSKTSEVNCYRCGESGHLARECTIEA 176



Score = 82.4 bits (202), Expect = 2e-15
Identities = 43/106 (40%), Positives = 55/106 (51%), Gaps = 7/106 (6%)
Frame = +1

Query: 172 DICNNCHRSGHFARDCPNP-----ALCNNCGLPGHIASVC--TNDSICWNCKEPGHNAKG 330
+ C NC R GH A+DC P C NCG PGH+A C ++ C++C E GH K
Sbjct: 73 EACYNCGRGGHIAKDCKEPKREREQCCYNCGKPGHLARDCDHADEQKCYSCGEFGHIQKD 132

Query: 331 CPNETVCVLCNKPGHVAKNCTAKEGDTRLCRNCQRPGHLAADCKNE 468
C + C C + GHVA NC +K + C C GHLA +C E
Sbjct: 133 C-TKVKCYRCGETGHVAINC-SKTSEVN-CYRCGESGHLARECTIE 175


>sp|P62634|CNBP_RAT Cellular nucleic acid-binding protein OS=Rattus
norvegicus GN=Cnbp PE=2 SV=1
Length = 177

Score = 102 bits (254), Expect = 2e-21
Identities = 60/173 (34%), Positives = 78/173 (45%), Gaps = 37/173 (21%)
Frame = +1

Query: 178 CNNCHRSGHFARDCPN-----------------------------PALCNNCGLPGHIAS 270
C C RSGH+AR+CP P +C CG GH+A
Sbjct: 6 CFKCGRSGHWARECPTGGGRGRGMRSRGRGGFTSDRGFQFVSSSLPDICYRCGESGHLAK 65

Query: 271 VC-TNDSICWNCKEPGHNAKGC-----PNETVCVLCNKPGHVAKNCTAKEGDTRLCRNCQ 432
C + C+NC GH AK C E C C KPGH+A++C D + C +C
Sbjct: 66 DCDLQEDACYNCGRGGHIAKDCKEPKREREQCCYNCGKPGHLARDC--DHADEQKCYSCG 123

Query: 433 RPGHLAADCKNEKACNNCRKPGHLARDC-KNSPV-CNVCNQVGHIARDCDSSA 585
GH+ DC K C C + GH+A +C K S V C C + GH+AR+C A
Sbjct: 124 EFGHIQKDCTKVK-CYRCGETGHVAINCSKTSEVNCYRCGESGHLARECTIEA 175



Score = 84.3 bits (207), Expect = 5e-16
Identities = 45/109 (41%), Positives = 56/109 (51%), Gaps = 7/109 (6%)
Frame = +1

Query: 163 LPVDICNNCHRSGHFARDCPNP-----ALCNNCGLPGHIASVC--TNDSICWNCKEPGHN 321
L D C NC R GH A+DC P C NCG PGH+A C ++ C++C E GH
Sbjct: 69 LQEDACYNCGRGGHIAKDCKEPKREREQCCYNCGKPGHLARDCDHADEQKCYSCGEFGHI 128

Query: 322 AKGCPNETVCVLCNKPGHVAKNCTAKEGDTRLCRNCQRPGHLAADCKNE 468
K C + C C + GHVA NC +K + C C GHLA +C E
Sbjct: 129 QKDC-TKVKCYRCGETGHVAINC-SKTSEVN-CYRCGESGHLARECTIE 174


>sp|Q5R5R5|CNBP_PONAB Cellular nucleic acid-binding protein OS=Pongo
abelii GN=CNBP PE=2 SV=1
Length = 177

Score = 102 bits (254), Expect = 2e-21
Identities = 60/173 (34%), Positives = 78/173 (45%), Gaps = 37/173 (21%)
Frame = +1

Query: 178 CNNCHRSGHFARDCPN-----------------------------PALCNNCGLPGHIAS 270
C C RSGH+AR+CP P +C CG GH+A
Sbjct: 6 CFKCGRSGHWARECPTGGGRGRGMRSRGRGGFTSDRGFQFVSSSLPDICYRCGESGHLAK 65

Query: 271 VC-TNDSICWNCKEPGHNAKGC-----PNETVCVLCNKPGHVAKNCTAKEGDTRLCRNCQ 432
C + C+NC GH AK C E C C KPGH+A++C D + C +C
Sbjct: 66 DCDLQEDACYNCGRGGHIAKDCKEPKREREQCCYNCGKPGHLARDC--DHADEQKCYSCG 123

Query: 433 RPGHLAADCKNEKACNNCRKPGHLARDC-KNSPV-CNVCNQVGHIARDCDSSA 585
GH+ DC K C C + GH+A +C K S V C C + GH+AR+C A
Sbjct: 124 EFGHIQKDCTKVK-CYRCGETGHVAINCSKTSEVNCYRCGESGHLARECTIEA 175



Score = 84.3 bits (207), Expect = 5e-16
Identities = 45/109 (41%), Positives = 56/109 (51%), Gaps = 7/109 (6%)
Frame = +1

Query: 163 LPVDICNNCHRSGHFARDCPNP-----ALCNNCGLPGHIASVC--TNDSICWNCKEPGHN 321
L D C NC R GH A+DC P C NCG PGH+A C ++ C++C E GH
Sbjct: 69 LQEDACYNCGRGGHIAKDCKEPKREREQCCYNCGKPGHLARDCDHADEQKCYSCGEFGHI 128

Query: 322 AKGCPNETVCVLCNKPGHVAKNCTAKEGDTRLCRNCQRPGHLAADCKNE 468
K C + C C + GHVA NC +K + C C GHLA +C E
Sbjct: 129 QKDC-TKVKCYRCGETGHVAINC-SKTSEVN-CYRCGESGHLARECTIE 174


>sp|P62633|CNBP_HUMAN Cellular nucleic acid-binding protein OS=Homo
sapiens GN=CNBP PE=1 SV=1
Length = 177

Score = 102 bits (254), Expect = 2e-21
Identities = 60/173 (34%), Positives = 78/173 (45%), Gaps = 37/173 (21%)
Frame = +1

Query: 178 CNNCHRSGHFARDCPN-----------------------------PALCNNCGLPGHIAS 270
C C RSGH+AR+CP P +C CG GH+A
Sbjct: 6 CFKCGRSGHWARECPTGGGRGRGMRSRGRGGFTSDRGFQFVSSSLPDICYRCGESGHLAK 65

Query: 271 VC-TNDSICWNCKEPGHNAKGC-----PNETVCVLCNKPGHVAKNCTAKEGDTRLCRNCQ 432
C + C+NC GH AK C E C C KPGH+A++C D + C +C
Sbjct: 66 DCDLQEDACYNCGRGGHIAKDCKEPKREREQCCYNCGKPGHLARDC--DHADEQKCYSCG 123

Query: 433 RPGHLAADCKNEKACNNCRKPGHLARDC-KNSPV-CNVCNQVGHIARDCDSSA 585
GH+ DC K C C + GH+A +C K S V C C + GH+AR+C A
Sbjct: 124 EFGHIQKDCTKVK-CYRCGETGHVAINCSKTSEVNCYRCGESGHLARECTIEA 175



Score = 84.3 bits (207), Expect = 5e-16
Identities = 45/109 (41%), Positives = 56/109 (51%), Gaps = 7/109 (6%)
Frame = +1

Query: 163 LPVDICNNCHRSGHFARDCPNP-----ALCNNCGLPGHIASVC--TNDSICWNCKEPGHN 321
L D C NC R GH A+DC P C NCG PGH+A C ++ C++C E GH
Sbjct: 69 LQEDACYNCGRGGHIAKDCKEPKREREQCCYNCGKPGHLARDCDHADEQKCYSCGEFGHI 128

Query: 322 AKGCPNETVCVLCNKPGHVAKNCTAKEGDTRLCRNCQRPGHLAADCKNE 468
K C + C C + GHVA NC +K + C C GHLA +C E
Sbjct: 129 QKDC-TKVKCYRCGETGHVAINC-SKTSEVN-CYRCGESGHLARECTIE 174


>sp|Q04832|HEXP_LEIMA DNA-binding protein HEXBP OS=Leishmania major
GN=HEXBP PE=4 SV=1
Length = 271

Score = 99.8 bits (247), Expect = 1e-20
Identities = 55/200 (27%), Positives = 82/200 (41%), Gaps = 65/200 (32%)
Frame = +1

Query: 178 CNNCHRSGHFARDCPNPAL--------CNNCGLPGHIASVC------------------- 276
C C +GH +RDCPN A C CG GH++ C
Sbjct: 72 CFRCGEAGHMSRDCPNSAKPGAAKGFECYKCGQEGHLSRDCPSSQGGSRGGYGQKRGRSG 131

Query: 277 -----TNDSICWNCKEPGHNAKGCPN---------ETVCVLCNKPGHVAKNCTAKEGD-- 408
+ D C+ C + GH ++ CPN + C C GH++++C +G
Sbjct: 132 AQGGYSGDRTCYKCGDAGHISRDCPNGQGGYSGAGDRTCYKCGDAGHISRDCPNGQGGYS 191

Query: 409 ---TRLCRNCQRPGHLAADCKN-------EKACNNCRKPGHLARDCKNS----------- 525
R C C GH++ +C + ++AC C KPGH++R+C +
Sbjct: 192 GAGDRKCYKCGESGHMSRECPSAGSTGSGDRACYKCGKPGHISRECPEAGGSYGGSRGGG 251

Query: 526 -PVCNVCNQVGHIARDCDSS 582
C C + GHI+RDC SS
Sbjct: 252 DRTCYKCGEAGHISRDCPSS 271



Score = 99.4 bits (246), Expect = 1e-20
Identities = 53/197 (26%), Positives = 82/197 (41%), Gaps = 62/197 (31%)
Frame = +1

Query: 178 CNNCHRSGHFARDCP--------NPALCNNCGLPGHIASVCTNDS--------ICWNCKE 309
C NC + GH+AR+CP C CG GH++ C N++ C+ C E
Sbjct: 18 CRNCGKEGHYARECPEADSKGDERSTTCFRCGEEGHMSRECPNEARSGAAGAMTCFRCGE 77

Query: 310 PGHNAKGCPNET--------VCVLCNKPGHVAKNCTAKEGDT------------------ 411
GH ++ CPN C C + GH++++C + +G +
Sbjct: 78 AGHMSRDCPNSAKPGAAKGFECYKCGQEGHLSRDCPSSQGGSRGGYGQKRGRSGAQGGYS 137

Query: 412 --RLCRNCQRPGHLAADCKN---------EKACNNCRKPGHLARDCKNSP---------V 531
R C C GH++ DC N ++ C C GH++RDC N
Sbjct: 138 GDRTCYKCGDAGHISRDCPNGQGGYSGAGDRTCYKCGDAGHISRDCPNGQGGYSGAGDRK 197

Query: 532 CNVCNQVGHIARDCDSS 582
C C + GH++R+C S+
Sbjct: 198 CYKCGESGHMSRECPSA 214



Score = 67.4 bits (163), Expect = 6e-11
Identities = 37/102 (36%), Positives = 48/102 (47%), Gaps = 20/102 (19%)
Frame = +1

Query: 337 NETVCVLCNKPGHVAKNC--TAKEGDTR--LCRNCQRPGHLAADCKNE--------KACN 480
+ T C C K GH A+ C +GD R C C GH++ +C NE C
Sbjct: 14 SSTSCRNCGKEGHYARECPEADSKGDERSTTCFRCGEEGHMSRECPNEARSGAAGAMTCF 73

Query: 481 NCRKPGHLARDCKNSP--------VCNVCNQVGHIARDCDSS 582
C + GH++RDC NS C C Q GH++RDC SS
Sbjct: 74 RCGEAGHMSRDCPNSAKPGAAKGFECYKCGQEGHLSRDCPSS 115



Score = 52.8 bits (125), Expect = 2e-06
Identities = 24/72 (33%), Positives = 35/72 (48%), Gaps = 16/72 (22%)
Frame = +1

Query: 418 CRNCQRPGHLAADC--------KNEKACNNCRKPGHLARDCKNSP--------VCNVCNQ 549
CRNC + GH A +C + C C + GH++R+C N C C +
Sbjct: 18 CRNCGKEGHYARECPEADSKGDERSTTCFRCGEEGHMSRECPNEARSGAAGAMTCFRCGE 77

Query: 550 VGHIARDCDSSA 585
GH++RDC +SA
Sbjct: 78 AGHMSRDCPNSA 89



Score = 41.6 bits (96), Expect = 0.004
Identities = 21/59 (35%), Positives = 31/59 (52%), Gaps = 8/59 (13%)
Frame = +1

Query: 460 KNEKACNNCRKPGHLARDC--------KNSPVCNVCNQVGHIARDCDSSAPRRRAASPM 612
++ +C NC K GH AR+C + S C C + GH++R+C + A R AA M
Sbjct: 13 ESSTSCRNCGKEGHYARECPEADSKGDERSTTCFRCGEEGHMSRECPNEA-RSGAAGAM 70


>sp|P36627|BYR3_SCHPO Cellular nucleic acid-binding protein homolog
OS=Schizosaccharomyces pombe GN=byr3 PE=2 SV=1
Length = 179

Score = 99.0 bits (245), Expect = 2e-20
Identities = 53/156 (33%), Positives = 74/156 (47%), Gaps = 22/156 (14%)
Frame = +1

Query: 178 CNNCHRSGHFARDCPNPALCNNCGLPGHIASVCT---NDSICWNCKEPGHNAKGCPNE-- 342
C NC +GH AR+C ++C NC GH AS CT + C+ C GH + CP+
Sbjct: 19 CYNCGENGHQARECTKGSICYNCNQTGHKASECTEPQQEKTCYACGTAGHLVRDCPSSPN 78

Query: 343 ----TVCVLCNKPGHVAKNC--TAKEGDTRL--------CRNCQRPGHLAADCKNEKACN 480
C C + GH+A++C ++ R C C GH A DC C
Sbjct: 79 PRQGAECYKCGRVGHIARDCRTNGQQSGGRFGGHRSNMNCYACGSYGHQARDCTMGVKCY 138

Query: 481 NCRKPGHLARDCK---NSPVCNVCNQVGHIARDCDS 579
+C K GH + +C+ + +C CNQ GHIA +C S
Sbjct: 139 SCGKIGHRSFECQQASDGQLCYKCNQPGHIAVNCTS 174



Score = 91.3 bits (225), Expect = 4e-18
Identities = 47/141 (33%), Positives = 63/141 (44%), Gaps = 19/141 (13%)
Frame = +1

Query: 220 PNPALCNNCGLPGHIASVCTNDSICWNCKEPGHNAKGC---PNETVCVLCNKPGHVAKNC 390
P P C NCG GH A CT SIC+NC + GH A C E C C GH+ ++C
Sbjct: 15 PGPR-CYNCGENGHQARECTKGSICYNCNQTGHKASECTEPQQEKTCYACGTAGHLVRDC 73

Query: 391 TAKEGDTR--LCRNCQRPGHLAADC--------------KNEKACNNCRKPGHLARDCKN 522
+ + C C R GH+A DC ++ C C GH ARDC
Sbjct: 74 PSSPNPRQGAECYKCGRVGHIARDCRTNGQQSGGRFGGHRSNMNCYACGSYGHQARDCTM 133

Query: 523 SPVCNVCNQVGHIARDCDSSA 585
C C ++GH + +C ++
Sbjct: 134 GVKCYSCGKIGHRSFECQQAS 154



Score = 58.2 bits (139), Expect = 4e-08
Identities = 30/80 (37%), Positives = 37/80 (46%), Gaps = 4/80 (5%)
Frame = +1

Query: 418 CRNCQRPGHLAADCKNEKACNNCRKPGHLARDC---KNSPVCNVCNQVGHIARDCDSSA- 585
C NC GH A +C C NC + GH A +C + C C GH+ RDC SS
Sbjct: 19 CYNCGENGHQARECTKGSICYNCNQTGHKASECTEPQQEKTCYACGTAGHLVRDCPSSPN 78

Query: 586 PRRRAASPMPVREPLICRNC 645
PR+ A R I R+C
Sbjct: 79 PRQGAECYKCGRVGHIARDC 98



Score = 48.5 bits (114), Expect = 3e-05
Identities = 22/60 (36%), Positives = 29/60 (48%), Gaps = 3/60 (5%)
Frame = +1

Query: 178 CNNCHRSGHFARDCPNPALCNNCGLPGHIASVCTNDS---ICWNCKEPGHNAKGCPNETV 348
C C GH ARDC C +CG GH + C S +C+ C +PGH A C + +
Sbjct: 118 CYACGSYGHQARDCTMGVKCYSCGKIGHRSFECQQASDGQLCYKCNQPGHIAVNCTSPVI 177


>sp|Q8WW36|ZCH13_HUMAN Zinc finger CCHC domain-containing protein 13
OS=Homo sapiens GN=ZCCHC13 PE=2 SV=1
Length = 166

Score = 94.7 bits (234), Expect = 4e-19
Identities = 51/141 (36%), Positives = 72/141 (51%), Gaps = 7/141 (4%)
Frame = +1

Query: 187 CHRSGHFARDCPNPALCNNCGLPGHIASVCTNDSI---CWNCKEPGHNAKGCP-NETVCV 354
C SGH+AR CP G S C + ++ C+ C E G NAK C +C
Sbjct: 9 CGHSGHWARGCPRGGAGGRRGGGHGRGSQCGSTTLSYTCYCCGESGRNAKNCVLLGNICY 68

Query: 355 LCNKPGHVAKNCTAKEGDTRL-CRNCQRPGHLAADC--KNEKACNNCRKPGHLARDCKNS 525
C + GH+AK+C + + R C C R GHLA DC + E+ C +C K GH+ +DC
Sbjct: 69 NCGRSGHIAKDCKDPKRERRQHCYTCGRLGHLARDCDRQKEQKCYSCGKLGHIQKDCAQV 128

Query: 526 PVCNVCNQVGHIARDCDSSAP 588
C C ++GH+A +C + P
Sbjct: 129 K-CYRCGEIGHVAINCSKARP 148



Score = 65.9 bits (159), Expect = 2e-10
Identities = 33/81 (40%), Positives = 44/81 (54%), Gaps = 7/81 (8%)
Frame = +1

Query: 172 DICNNCHRSGHFARDCPNPAL-----CNNCGLPGHIASVC--TNDSICWNCKEPGHNAKG 330
+IC NC RSGH A+DC +P C CG GH+A C + C++C + GH K
Sbjct: 65 NICYNCGRSGHIAKDCKDPKRERRQHCYTCGRLGHLARDCDRQKEQKCYSCGKLGHIQKD 124

Query: 331 CPNETVCVLCNKPGHVAKNCT 393
C + C C + GHVA NC+
Sbjct: 125 CA-QVKCYRCGEIGHVAINCS 144



Score = 34.3 bits (77), Expect = 0.58
Identities = 24/85 (28%), Positives = 32/85 (37%), Gaps = 5/85 (5%)
Frame = +1

Query: 358 CNKPGHVAKNCTAKEGDTRLCRNCQRPGH-LAADCKNEKACNNCRKPGHLARDCKN---- 522
C GH A+ C R + GH + C + C G R+ KN
Sbjct: 9 CGHSGHWARGCPRGGAGGR-----RGGGHGRGSQCGSTTLSYTCYCCGESGRNAKNCVLL 63

Query: 523 SPVCNVCNQVGHIARDCDSSAPRRR 597
+C C + GHIA+DC RR
Sbjct: 64 GNICYNCGRSGHIAKDCKDPKRERR 88


tr_hit_id Q9AV38
Definition tr|Q9AV38|Q9AV38_ORYSJ Os10g0545300 protein OS=Oryza sativa subsp. japonica
Align length 172
Score (bit) 233.0
E-value 7.0e-60
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= DK950387|Adiantum capillus-veneris mRNA, clone:
TST38A01NGRL0008_I09, 5'
(646 letters)

Database: uniprot_trembl.fasta
7,341,751 sequences; 2,391,615,440 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

tr|Q9AV38|Q9AV38_ORYSJ Os10g0545300 protein OS=Oryza sativa subs... 233 7e-60
tr|A2Z9X0|A2Z9X0_ORYSI Putative uncharacterized protein OS=Oryza... 231 3e-59
tr|Q6EIC6|Q6EIC6_HYAOR Putative zinc finger protein OS=Hyacinthu... 224 3e-57
tr|Q677E2|Q677E2_HYAOR Ring zinc finger protein (Fragment) OS=Hy... 222 2e-56
tr|A7P7X8|A7P7X8_VITVI Chromosome chr3 scaffold_8, whole genome ... 221 3e-56
tr|A9NU66|A9NU66_PICSI Putative uncharacterized protein OS=Picea... 221 4e-56
tr|A7PIY4|A7PIY4_VITVI Chromosome chr13 scaffold_17, whole genom... 217 4e-55
tr|B4FLG4|B4FLG4_MAIZE DNA-binding protein HEXBP OS=Zea mays PE=... 214 5e-54
tr|B4FKN3|B4FKN3_MAIZE DNA-binding protein HEXBP OS=Zea mays PE=... 210 7e-53
tr|Q9LQZ9|Q9LQZ9_ARATH F10A5.22 OS=Arabidopsis thaliana PE=4 SV=1 207 4e-52
tr|Q8LF59|Q8LF59_ARATH DNA-binding protein OS=Arabidopsis thalia... 207 4e-52
tr|Q8GXC5|Q8GXC5_ARATH Putative DNA-binding protein OS=Arabidops... 207 4e-52
tr|A9NS35|A9NS35_PICSI Putative uncharacterized protein OS=Picea... 204 4e-51
tr|B6T3W5|B6T3W5_MAIZE Cellular nucleic acid-binding protein OS=... 204 5e-51
tr|A5C1C7|A5C1C7_VITVI Putative uncharacterized protein OS=Vitis... 173 9e-42
tr|A7QAJ6|A7QAJ6_VITVI Chromosome undetermined scaffold_71, whol... 159 1e-37
tr|Q10BE5|Q10BE5_ORYSJ Os03g0820700 protein OS=Oryza sativa subs... 153 8e-36
tr|B8AMB3|B8AMB3_ORYSI Putative uncharacterized protein OS=Oryza... 152 1e-35
tr|A9PCM2|A9PCM2_POPTR Putative uncharacterized protein OS=Popul... 135 2e-30
tr|A7PMQ7|A7PMQ7_VITVI Chromosome chr14 scaffold_21, whole genom... 132 2e-29
tr|A7PR40|A7PR40_VITVI Chromosome chr14 scaffold_26, whole genom... 130 9e-29
tr|A7QJS1|A7QJS1_VITVI Chromosome undetermined scaffold_107, who... 127 6e-28
tr|A7QUE8|A7QUE8_VITVI Chromosome undetermined scaffold_178, who... 125 2e-27
tr|Q4D8U5|Q4D8U5_TRYCR Universal minicircle sequence binding pro... 124 6e-27
tr|Q4D6T8|Q4D6T8_TRYCR Universal minicircle sequence binding pro... 123 1e-26
tr|O77233|O77233_TRYCR Poly-zinc finger protein 1 OS=Trypanosoma... 120 5e-26
tr|A5BND0|A5BND0_VITVI Putative uncharacterized protein OS=Vitis... 119 2e-25
tr|B7QMR7|B7QMR7_IXOSC E3 ubiquitin ligase, putative OS=Ixodes s... 119 2e-25
tr|B3LP98|B3LP98_YEAS1 Zinc-finger protein GIS2 OS=Saccharomyces... 117 6e-25
tr|A6ZRI8|A6ZRI8_YEAS7 Gig suppressor OS=Saccharomyces cerevisia... 117 6e-25

>tr|Q9AV38|Q9AV38_ORYSJ Os10g0545300 protein OS=Oryza sativa subsp.
japonica GN=OSJNBa0001O14.4 PE=2 SV=1
Length = 247

Score = 233 bits (594), Expect = 7e-60
Identities = 100/172 (58%), Positives = 119/172 (69%), Gaps = 6/172 (3%)
Frame = +1

Query: 148 RKTPRLPVDICNNCHRSGHFARDCPNPALCNNCGLPGHIASVCTNDSICWNCKEPGHNAK 327
R R P D+CNNC R GHFARDCPN ALC+ CGLPGHIA+ C++ +CWNCKEPGH A
Sbjct: 31 RGPSRFPNDLCNNCKRPGHFARDCPNVALCHACGLPGHIAAECSSKDLCWNCKEPGHMAN 90

Query: 328 GCPNETVCVLCNKPGHVAKNCTAK---EGDTRLCRNCQRPGHLAADCKNEKACNNCRKPG 498
CPNE +C C K GH+A+ C+A G+ RLC NC +PGHLAA+C NEKACNNCRK G
Sbjct: 91 SCPNEGICRNCGKSGHIARECSAPPMLPGEMRLCSNCYKPGHLAAECTNEKACNNCRKSG 150

Query: 499 HLARDCKNSPVCNVCNQVGHIARDCDSSAPRRRAASPMPVR---EPLICRNC 645
HLAR+C N PVCN+CN GH+AR+C S P P R ++CR C
Sbjct: 151 HLARNCPNEPVCNLCNVSGHLARECPKSDAINERGGPPPFRGGYSDVVCRAC 202



Score = 118 bits (295), Expect = 4e-25
Identities = 55/137 (40%), Positives = 74/137 (54%), Gaps = 23/137 (16%)
Frame = +1

Query: 175 ICNNCHRSGHFARDCPNPA-------LCNNCGLPGHIASVCTNDSICWNCKEPGHNAKGC 333
IC NC +SGH AR+C P LC+NC PGH+A+ CTN+ C NC++ GH A+ C
Sbjct: 97 ICRNCGKSGHIARECSAPPMLPGEMRLCSNCYKPGHLAAECTNEKACNNCRKSGHLARNC 156

Query: 334 PNETVCVLCNKPGHVAKNCTAKEGDTR--------------LCRNCQRPGHLAADCKNEK 471
PNE VC LCN GH+A+ C + +CR C + GH++ DC
Sbjct: 157 PNEPVCNLCNVSGHLARECPKSDAINERGGPPPFRGGYSDVVCRACNQVGHMSRDCMAGA 216

Query: 472 --ACNNCRKPGHLARDC 516
C+NC GH+A +C
Sbjct: 217 FMICHNCGGRGHMAYEC 233



Score = 53.1 bits (126), Expect = 1e-05
Identities = 28/93 (30%), Positives = 34/93 (36%), Gaps = 39/93 (41%)
Frame = +1

Query: 178 CNNCHRSGHFARDCPNPALCNNCGLPGHIASVCTNDS----------------------- 288
CNNC +SGH AR+CPN +CN C + GH+A C
Sbjct: 143 CNNCRKSGHLARNCPNEPVCNLCNVSGHLARECPKSDAINERGGPPPFRGGYSDVVCRAC 202

Query: 289 ----------------ICWNCKEPGHNAKGCPN 339
IC NC GH A CP+
Sbjct: 203 NQVGHMSRDCMAGAFMICHNCGGRGHMAYECPS 235


>tr|A2Z9X0|A2Z9X0_ORYSI Putative uncharacterized protein OS=Oryza
sativa subsp. indica GN=OsI_34532 PE=4 SV=1
Length = 255

Score = 231 bits (589), Expect = 3e-59
Identities = 102/180 (56%), Positives = 122/180 (67%), Gaps = 14/180 (7%)
Frame = +1

Query: 148 RKTPRLPVDICNNCHRSGHFARDCPNPALCNNCGLPGHIASVCTNDSICWNCKEPGHNAK 327
R R P D+CNNC R GHFARDCPN ALC+ CGLPGHIA+ C++ +CWNCKEPGH A
Sbjct: 31 RGPSRFPNDLCNNCKRPGHFARDCPNVALCHACGLPGHIAAECSSKDLCWNCKEPGHMAN 90

Query: 328 GCPNETVCVLCNKPGHVAKNCTAK---EGDTRLCRNCQRPGHLAADCKNEKACNNCRKPG 498
CPNE +C C K GH+A+ C+A G+ RLC NC +PGHLAA+C NEKACNNCRK G
Sbjct: 91 SCPNEGICRNCGKSGHIARECSAPPMLPGEMRLCSNCYKPGHLAAECTNEKACNNCRKSG 150

Query: 499 HLARDCKNSPVCNVCNQVGHIARDCDSS--------APRRRAASPMPVR---EPLICRNC 645
HLAR+C N PVCN+CN GH+AR+C S P R +P P R ++CR C
Sbjct: 151 HLARNCPNEPVCNLCNVSGHLARECPKSDAINERGGPPPFRGGAPPPFRGGYSDVVCRAC 210



Score = 115 bits (287), Expect = 3e-24
Identities = 55/145 (37%), Positives = 74/145 (51%), Gaps = 31/145 (21%)
Frame = +1

Query: 175 ICNNCHRSGHFARDCPNPA-------LCNNCGLPGHIASVCTNDSICWNCKEPGHNAKGC 333
IC NC +SGH AR+C P LC+NC PGH+A+ CTN+ C NC++ GH A+ C
Sbjct: 97 ICRNCGKSGHIARECSAPPMLPGEMRLCSNCYKPGHLAAECTNEKACNNCRKSGHLARNC 156

Query: 334 PNETVCVLCNKPGHVAKNCTAKEGDTR----------------------LCRNCQRPGHL 447
PNE VC LCN GH+A+ C + +CR C + GH+
Sbjct: 157 PNEPVCNLCNVSGHLARECPKSDAINERGGPPPFRGGAPPPFRGGYSDVVCRACNQVGHM 216

Query: 448 AADCKNEK--ACNNCRKPGHLARDC 516
+ DC C+NC GH+A +C
Sbjct: 217 SRDCMAGAFMICHNCGGRGHMAYEC 241



Score = 50.1 bits (118), Expect = 1e-04
Identities = 28/101 (27%), Positives = 34/101 (33%), Gaps = 47/101 (46%)
Frame = +1

Query: 178 CNNCHRSGHFARDCPNPALCNNCGLPGHIASVCTNDS----------------------- 288
CNNC +SGH AR+CPN +CN C + GH+A C
Sbjct: 143 CNNCRKSGHLARNCPNEPVCNLCNVSGHLARECPKSDAINERGGPPPFRGGAPPPFRGGY 202

Query: 289 ------------------------ICWNCKEPGHNAKGCPN 339
IC NC GH A CP+
Sbjct: 203 SDVVCRACNQVGHMSRDCMAGAFMICHNCGGRGHMAYECPS 243


>tr|Q6EIC6|Q6EIC6_HYAOR Putative zinc finger protein OS=Hyacinthus
orientalis PE=2 SV=1
Length = 244

Score = 224 bits (572), Expect = 3e-57
Identities = 99/161 (61%), Positives = 114/161 (70%), Gaps = 4/161 (2%)
Frame = +1

Query: 175 ICNNCHRSGHFARDCPNPALCNNCGLPGHIASVCTNDSICWNCKEPGHNAKGCPNETVCV 354
IC NC R GHFARDC + A+CNNCGLPGHIA+ CT ++CWNCKEPGH A C NE VC
Sbjct: 44 ICKNCKRPGHFARDCSHIAVCNNCGLPGHIAAECTAKTLCWNCKEPGHMANECSNEAVCH 103

Query: 355 LCNKPGHVAKNCTA---KEGDTRLCRNCQRPGHLAADCKNEKACNNCRKPGHLARDCKNS 525
CNK GH+A++C+A DTRLC NC RPGH+AADC N+K CNNCRKPGHLAR+C N
Sbjct: 104 NCNKTGHLARDCSASGLSSFDTRLCNNCHRPGHIAADCTNDKTCNNCRKPGHLARECTND 163

Query: 526 PVCNVCNQVGHIARDC-DSSAPRRRAASPMPVREPLICRNC 645
PVCNVCN GH+AR C S+ P P +ICR C
Sbjct: 164 PVCNVCNVSGHVARQCPKSNLPSEIHGGPF---RDIICRVC 201



Score = 129 bits (323), Expect = 2e-28
Identities = 58/130 (44%), Positives = 77/130 (59%), Gaps = 16/130 (12%)
Frame = +1

Query: 175 ICNNCHRSGHFARDCP-------NPALCNNCGLPGHIASVCTNDSICWNCKEPGHNAKGC 333
+C+NC+++GH ARDC + LCNNC PGHIA+ CTND C NC++PGH A+ C
Sbjct: 101 VCHNCNKTGHLARDCSASGLSSFDTRLCNNCHRPGHIAADCTNDKTCNNCRKPGHLAREC 160

Query: 334 PNETVCVLCNKPGHVAKNCTAKE-------GDTR--LCRNCQRPGHLAADCKNEKACNNC 486
N+ VC +CN GHVA+ C G R +CR C +PGH++ DC CN C
Sbjct: 161 TNDPVCNVCNVSGHVARQCPKSNLPSEIHGGPFRDIICRVCNQPGHISRDCVGIVICNTC 220

Query: 487 RKPGHLARDC 516
GH+A +C
Sbjct: 221 GGRGHMAYEC 230



Score = 98.6 bits (244), Expect = 3e-19
Identities = 41/107 (38%), Positives = 63/107 (58%)
Frame = +1

Query: 325 KGCPNETVCVLCNKPGHVAKNCTAKEGDTRLCRNCQRPGHLAADCKNEKACNNCRKPGHL 504
+G + +C C +PGH A++C+ +C NC PGH+AA+C + C NC++PGH+
Sbjct: 37 RGFRQDVICKNCKRPGHFARDCS----HIAVCNNCGLPGHIAAECTAKTLCWNCKEPGHM 92

Query: 505 ARDCKNSPVCNVCNQVGHIARDCDSSAPRRRAASPMPVREPLICRNC 645
A +C N VC+ CN+ GH+ARDC +AS + + +C NC
Sbjct: 93 ANECSNEAVCHNCNKTGHLARDC--------SASGLSSFDTRLCNNC 131



Score = 51.2 bits (121), Expect = 5e-05
Identities = 26/68 (38%), Positives = 30/68 (44%), Gaps = 13/68 (19%)
Frame = +1

Query: 175 ICNNCHRSGHFARDCPNPAL-------------CNNCGLPGHIASVCTNDSICWNCKEPG 315
+CN C+ SGH AR CP L C C PGHI+ C IC C G
Sbjct: 165 VCNVCNVSGHVARQCPKSNLPSEIHGGPFRDIICRVCNQPGHISRDCVGIVICNTCGGRG 224

Query: 316 HNAKGCPN 339
H A CP+
Sbjct: 225 HMAYECPS 232


>tr|Q677E2|Q677E2_HYAOR Ring zinc finger protein (Fragment)
OS=Hyacinthus orientalis GN=HRZ1 PE=2 SV=1
Length = 196

Score = 222 bits (565), Expect = 2e-56
Identities = 93/139 (66%), Positives = 106/139 (76%), Gaps = 3/139 (2%)
Frame = +1

Query: 175 ICNNCHRSGHFARDCPNPALCNNCGLPGHIASVCTNDSICWNCKEPGHNAKGCPNETVCV 354
IC NC R GHFARDC + A+CNNCGLPGHIA+ CT ++CWNCKEPGH A C NE VC
Sbjct: 44 ICKNCKRPGHFARDCSHIAVCNNCGLPGHIAAECTAKTLCWNCKEPGHMANECSNEAVCH 103

Query: 355 LCNKPGHVAKNCTA---KEGDTRLCRNCQRPGHLAADCKNEKACNNCRKPGHLARDCKNS 525
CNK GH+A++C+A DTRLC NC RPGH+AADC N+K CNNCRKPGHLAR+C N
Sbjct: 104 NCNKTGHLARDCSASGLSSFDTRLCNNCHRPGHIAADCTNDKTCNNCRKPGHLARECTND 163

Query: 526 PVCNVCNQVGHIARDCDSS 582
PVCNVCN GH+AR C S
Sbjct: 164 PVCNVCNVSGHVARQCPKS 182



Score = 98.6 bits (244), Expect = 3e-19
Identities = 41/107 (38%), Positives = 63/107 (58%)
Frame = +1

Query: 325 KGCPNETVCVLCNKPGHVAKNCTAKEGDTRLCRNCQRPGHLAADCKNEKACNNCRKPGHL 504
+G + +C C +PGH A++C+ +C NC PGH+AA+C + C NC++PGH+
Sbjct: 37 RGFRQDVICKNCKRPGHFARDCS----HIAVCNNCGLPGHIAAECTAKTLCWNCKEPGHM 92

Query: 505 ARDCKNSPVCNVCNQVGHIARDCDSSAPRRRAASPMPVREPLICRNC 645
A +C N VC+ CN+ GH+ARDC +AS + + +C NC
Sbjct: 93 ANECSNEAVCHNCNKTGHLARDC--------SASGLSSFDTRLCNNC 131



Score = 80.1 bits (196), Expect = 1e-13
Identities = 31/58 (53%), Positives = 36/58 (62%)
Frame = +1

Query: 175 ICNNCHRSGHFARDCPNPALCNNCGLPGHIASVCTNDSICWNCKEPGHNAKGCPNETV 348
+CNNCHR GH A DC N CNNC PGH+A CTND +C C GH A+ CP +
Sbjct: 127 LCNNCHRPGHIAADCTNDKTCNNCRKPGHLARECTNDPVCNVCNVSGHVARQCPKSNL 184


>tr|A7P7X8|A7P7X8_VITVI Chromosome chr3 scaffold_8, whole genome
shotgun sequence OS=Vitis vinifera GN=GSVIVT00035958001
PE=4 SV=1
Length = 246

Score = 221 bits (563), Expect = 3e-56
Identities = 93/163 (57%), Positives = 116/163 (71%), Gaps = 5/163 (3%)
Frame = +1

Query: 172 DICNNCHRSGHFARDCPNPALCNNCGLPGHIASVCTNDSICWNCKEPGHNAKGCPNETVC 351
++C NC R GH+AR+CPN A+C+NC LPGHIAS CT S+CWNC+EPGH A CPNE +C
Sbjct: 41 NLCKNCKRPGHYARECPNVAVCHNCSLPGHIASECTTRSLCWNCQEPGHTASNCPNEGIC 100

Query: 352 VLCNKPGHVAKNCTA---KEGDTRLCRNCQRPGHLAADCKNEKACNNCRKPGHLARDCKN 522
C K GH+A++C+A GD RLC NC + GH+AADC N+KACNNCRK GHLARDC+N
Sbjct: 101 HTCGKTGHLARDCSAPPVPPGDLRLCNNCYKQGHIAADCTNDKACNNCRKTGHLARDCRN 160

Query: 523 SPVCNVCNQVGHIARDC-DSSAPRRRAASPMPVR-EPLICRNC 645
PVCN+CN GH+AR C ++ R P ++CRNC
Sbjct: 161 DPVCNLCNVSGHVARQCPKANVLGDRGGGPRSSGFRDIVCRNC 203



Score = 118 bits (295), Expect = 4e-25
Identities = 59/135 (43%), Positives = 75/135 (55%), Gaps = 21/135 (15%)
Frame = +1

Query: 175 ICNNCHRSGHFARDCPNPA-------LCNNCGLPGHIASVCTNDSICWNCKEPGHNAKGC 333
IC+ C ++GH ARDC P LCNNC GHIA+ CTND C NC++ GH A+ C
Sbjct: 99 ICHTCGKTGHLARDCSAPPVPPGDLRLCNNCYKQGHIAADCTNDKACNNCRKTGHLARDC 158

Query: 334 PNETVCVLCNKPGHVAKNCTA------KEGDTR-------LCRNCQRPGHLAADCKNE-K 471
N+ VC LCN GHVA+ C + G R +CRNCQ+ GH++ DC
Sbjct: 159 RNDPVCNLCNVSGHVARQCPKANVLGDRGGGPRSSGFRDIVCRNCQQLGHMSRDCAAPLM 218

Query: 472 ACNNCRKPGHLARDC 516
C NC GH+A +C
Sbjct: 219 ICRNCGGRGHMAFEC 233



Score = 50.4 bits (119), Expect = 9e-05
Identities = 27/91 (29%), Positives = 34/91 (37%), Gaps = 37/91 (40%)
Frame = +1

Query: 178 CNNCHRSGHFARDCPNPALCNNCGLPGHIASVCTNDS----------------------- 288
CNNC ++GH ARDC N +CN C + GH+A C +
Sbjct: 145 CNNCRKTGHLARDCRNDPVCNLCNVSGHVARQCPKANVLGDRGGGPRSSGFRDIVCRNCQ 204

Query: 289 --------------ICWNCKEPGHNAKGCPN 339
IC NC GH A CP+
Sbjct: 205 QLGHMSRDCAAPLMICRNCGGRGHMAFECPS 235


>tr|A9NU66|A9NU66_PICSI Putative uncharacterized protein OS=Picea
sitchensis PE=2 SV=1
Length = 248

Score = 221 bits (562), Expect = 4e-56
Identities = 97/167 (58%), Positives = 114/167 (68%), Gaps = 9/167 (5%)
Frame = +1

Query: 172 DICNNCHRSGHFARDCPNPALCNNCGLPGHIASVCTNDSICWNCKEPGHNAKGCPNETVC 351
D C NC R GHFARDCPN ++CNNCGLPGHIA CT S+CWNC+EPGH A C N+ +C
Sbjct: 40 DACKNCKRPGHFARDCPNVSVCNNCGLPGHIAVECTTKSLCWNCREPGHVASQCSNDPIC 99

Query: 352 VLCNKPGHVAKNCTAKE---GDTRLCRNCQRPGHLAADCKNEKACNNCRKPGHLARDCKN 522
C K GH++++CTA E GD RLC NC + GH+AA+C NEKACNNCRK GHLARDC N
Sbjct: 100 HTCGKSGHLSRDCTAPELPPGDIRLCNNCYKQGHIAAECTNEKACNNCRKTGHLARDCTN 159

Query: 523 SPVCNVCNQVGHIARDCDSS--APRRRAASPMPVR----EPLICRNC 645
SPVCN+CN GH+AR+C R M R +ICR C
Sbjct: 160 SPVCNLCNISGHVARECPKGRILDDNRGGRFMDERRGRFNDIICRTC 206



Score = 99.8 bits (247), Expect = 1e-19
Identities = 47/128 (36%), Positives = 66/128 (51%), Gaps = 3/128 (2%)
Frame = +1

Query: 157 PRLP---VDICNNCHRSGHFARDCPNPALCNNCGLPGHIASVCTNDSICWNCKEPGHNAK 327
P LP + +CNNC++ GH A +C N CNNC GH+A CTN +C C GH A+
Sbjct: 115 PELPPGDIRLCNNCYKQGHIAAECTNEKACNNCRKTGHLARDCTNSPVCNLCNISGHVAR 174

Query: 328 GCPNETVCVLCNKPGHVAKNCTAKEGDTRLCRNCQRPGHLAADCKNEKACNNCRKPGHLA 507
CP + + N+ G + D +CR C PGH + +C C+NC GH+A
Sbjct: 175 ECPKGRI-LDDNRGGRFMDERRGRFNDI-ICRTCNEPGHTSRECTPILICHNCGGRGHVA 232

Query: 508 RDCKNSPV 531
+C + V
Sbjct: 233 YECPSGRV 240



Score = 56.6 bits (135), Expect = 1e-06
Identities = 21/42 (50%), Positives = 29/42 (69%)
Frame = +1

Query: 460 KNEKACNNCRKPGHLARDCKNSPVCNVCNQVGHIARDCDSSA 585
+++ AC NC++PGH ARDC N VCN C GHIA +C + +
Sbjct: 37 RSDDACKNCKRPGHFARDCPNVSVCNNCGLPGHIAVECTTKS 78



Score = 55.5 bits (132), Expect = 3e-06
Identities = 33/93 (35%), Positives = 39/93 (41%), Gaps = 26/93 (27%)
Frame = +1

Query: 148 RKTPRLPVD-----ICNNCHRSGHFARDCP---------------------NPALCNNCG 249
RKT L D +CN C+ SGH AR+CP N +C C
Sbjct: 148 RKTGHLARDCTNSPVCNLCNISGHVARECPKGRILDDNRGGRFMDERRGRFNDIICRTCN 207

Query: 250 LPGHIASVCTNDSICWNCKEPGHNAKGCPNETV 348
PGH + CT IC NC GH A CP+ V
Sbjct: 208 EPGHTSRECTPILICHNCGGRGHVAYECPSGRV 240


>tr|A7PIY4|A7PIY4_VITVI Chromosome chr13 scaffold_17, whole genome
shotgun sequence OS=Vitis vinifera GN=GSVIVT00018520001
PE=4 SV=1
Length = 238

Score = 217 bits (553), Expect = 4e-55
Identities = 91/160 (56%), Positives = 109/160 (68%), Gaps = 3/160 (1%)
Frame = +1

Query: 175 ICNNCHRSGHFARDCPNPALCNNCGLPGHIASVCTNDSICWNCKEPGHNAKGCPNETVCV 354
+CN C R GHFARDCPN +CNNCGLPGHIA+ C + ++CWNCKE GH A CPN+ VC
Sbjct: 40 LCNKCKRPGHFARDCPNVTVCNNCGLPGHIAAECNSTTMCWNCKESGHLASQCPNDPVCH 99

Query: 355 LCNKPGHVAKNCTA---KEGDTRLCRNCQRPGHLAADCKNEKACNNCRKPGHLARDCKNS 525
+C K GH+A++C++ D RLC NC +PGH+AADC NEKACNNC K GHLARDC N
Sbjct: 100 MCGKMGHLARDCSSPGLPAHDARLCNNCYKPGHIAADCTNEKACNNCHKTGHLARDCLNE 159

Query: 526 PVCNVCNQVGHIARDCDSSAPRRRAASPMPVREPLICRNC 645
PVCN+CN GH+AR C S P + C NC
Sbjct: 160 PVCNICNISGHVARQCPKSRLVPETGGPF---RDITCHNC 196



Score = 60.5 bits (145), Expect = 9e-08
Identities = 30/85 (35%), Positives = 37/85 (43%), Gaps = 31/85 (36%)
Frame = +1

Query: 178 CNNCHRSGHFARDCPNPALCN-------------------------------NCGLPGHI 264
CNNCH++GH ARDC N +CN NCG PGHI
Sbjct: 143 CNNCHKTGHLARDCLNEPVCNICNISGHVARQCPKSRLVPETGGPFRDITCHNCGQPGHI 202

Query: 265 ASVCTNDSICWNCKEPGHNAKGCPN 339
+ C + IC NC GH + CP+
Sbjct: 203 SRDCVSIVICNNCGGRGHQSFECPS 227



Score = 56.6 bits (135), Expect = 1e-06
Identities = 21/41 (51%), Positives = 28/41 (68%)
Frame = +1

Query: 460 KNEKACNNCRKPGHLARDCKNSPVCNVCNQVGHIARDCDSS 582
+ + CN C++PGH ARDC N VCN C GHIA +C+S+
Sbjct: 36 RQDYLCNKCKRPGHFARDCPNVTVCNNCGLPGHIAAECNST 76


>tr|B4FLG4|B4FLG4_MAIZE DNA-binding protein HEXBP OS=Zea mays PE=2
SV=1
Length = 261

Score = 214 bits (544), Expect = 5e-54
Identities = 87/153 (56%), Positives = 107/153 (69%), Gaps = 3/153 (1%)
Frame = +1

Query: 172 DICNNCHRSGHFARDCPNPALCNNCGLPGHIASVCTNDSICWNCKEPGHNAKGCPNETVC 351
D+CNNC R GHFAR+CP+ A+C+ CGLPGHIA+ C++ +CWNCKEPGH A CPNE +C
Sbjct: 39 DLCNNCKRPGHFARECPSVAVCHTCGLPGHIAAECSSKGVCWNCKEPGHMANSCPNEGIC 98

Query: 352 VLCNKPGHVAKNCTA---KEGDTRLCRNCQRPGHLAADCKNEKACNNCRKPGHLARDCKN 522
C K GH+A++CTA G+ LC NC +PGH +C NEKACNNCR+ GHLAR+C N
Sbjct: 99 RNCGKSGHIARDCTAPPVPPGEVILCSNCYKPGHFREECTNEKACNNCRQSGHLARNCTN 158

Query: 523 SPVCNVCNQVGHIARDCDSSAPRRRAASPMPVR 621
PVCN+CN GH+AR C S P P R
Sbjct: 159 DPVCNLCNVAGHLARQCPKSDTLGERGGPPPFR 191



Score = 95.9 bits (237), Expect = 2e-18
Identities = 40/100 (40%), Positives = 57/100 (57%)
Frame = +1

Query: 346 VCVLCNKPGHVAKNCTAKEGDTRLCRNCQRPGHLAADCKNEKACNNCRKPGHLARDCKNS 525
+C C +PGH A+ C + +C C PGH+AA+C ++ C NC++PGH+A C N
Sbjct: 40 LCNNCKRPGHFARECPS----VAVCHTCGLPGHIAAECSSKGVCWNCKEPGHMANSCPNE 95

Query: 526 PVCNVCNQVGHIARDCDSSAPRRRAASPMPVREPLICRNC 645
+C C + GHIARDC A P+P E ++C NC
Sbjct: 96 GICRNCGKSGHIARDC--------TAPPVPPGEVILCSNC 127



Score = 89.4 bits (220), Expect = 2e-16
Identities = 43/129 (33%), Positives = 60/129 (46%), Gaps = 32/129 (24%)
Frame = +1

Query: 169 VDICNNCHRSGHFARDCPNPALCNNCGLPGHIASVCTNDSICWNCKEPGHNAKGCP---- 336
V +C+NC++ GHF +C N CNNC GH+A CTND +C C GH A+ CP
Sbjct: 121 VILCSNCYKPGHFREECTNEKACNNCRQSGHLARNCTNDPVCNLCNVAGHLARQCPKSDT 180

Query: 337 ----------------------------NETVCVLCNKPGHVAKNCTAKEGDTRLCRNCQ 432
++ VC CN+ GH +++C A G +C NC
Sbjct: 181 LGERGGPPPFRGVGAPFHDVGAPFRGGFSDVVCRACNQIGHTSRDCMA--GAFMICHNCG 238

Query: 433 RPGHLAADC 459
GH+A +C
Sbjct: 239 GRGHMAYEC 247



Score = 40.0 bits (92), Expect = 0.12
Identities = 17/41 (41%), Positives = 26/41 (63%), Gaps = 2/41 (4%)
Frame = +1

Query: 175 ICNNCHRSGHFARDCPNPA--LCNNCGLPGHIASVCTNDSI 291
+C C++ GH +RDC A +C+NCG GH+A C + S+
Sbjct: 212 VCRACNQIGHTSRDCMAGAFMICHNCGGRGHMAYECPSASL 252


>tr|B4FKN3|B4FKN3_MAIZE DNA-binding protein HEXBP OS=Zea mays PE=2
SV=1
Length = 261

Score = 210 bits (534), Expect = 7e-53
Identities = 85/151 (56%), Positives = 105/151 (69%), Gaps = 3/151 (1%)
Frame = +1

Query: 172 DICNNCHRSGHFARDCPNPALCNNCGLPGHIASVCTNDSICWNCKEPGHNAKGCPNETVC 351
D+CNNC R GHFAR+CP+ A+C+ CGLPGHIA+ C++ CWNCKEPGH A CPNE +C
Sbjct: 39 DLCNNCKRPGHFARECPSVAVCHTCGLPGHIAAECSSKGTCWNCKEPGHMANSCPNEGIC 98

Query: 352 VLCNKPGHVAKNCTA---KEGDTRLCRNCQRPGHLAADCKNEKACNNCRKPGHLARDCKN 522
C K GH+A++CTA G+ LC NC +PGH +C NEKACNNCR+ GH+AR+C N
Sbjct: 99 RNCGKSGHIARDCTAPPVPPGEVILCSNCYKPGHFREECTNEKACNNCRQSGHIARNCTN 158

Query: 523 SPVCNVCNQVGHIARDCDSSAPRRRAASPMP 615
PVCN+CN GH+AR C S P P
Sbjct: 159 DPVCNLCNVAGHLARQCPKSDTLGERGGPPP 189



Score = 88.6 bits (218), Expect = 3e-16
Identities = 43/129 (33%), Positives = 59/129 (45%), Gaps = 32/129 (24%)
Frame = +1

Query: 169 VDICNNCHRSGHFARDCPNPALCNNCGLPGHIASVCTNDSICWNCKEPGHNAKGCP---- 336
V +C+NC++ GHF +C N CNNC GHIA CTND +C C GH A+ CP
Sbjct: 121 VILCSNCYKPGHFREECTNEKACNNCRQSGHIARNCTNDPVCNLCNVAGHLARQCPKSDT 180

Query: 337 ----------------------------NETVCVLCNKPGHVAKNCTAKEGDTRLCRNCQ 432
++ +C CN+ GH +++C A G +C NC
Sbjct: 181 LGERGGPPPFHGVGAPFRGVGVPFRGGLSDVICRACNQIGHASRDCMA--GAFMICHNCG 238

Query: 433 RPGHLAADC 459
GH A +C
Sbjct: 239 GRGHTAYEC 247



Score = 39.3 bits (90), Expect = 0.21
Identities = 18/41 (43%), Positives = 25/41 (60%), Gaps = 2/41 (4%)
Frame = +1

Query: 175 ICNNCHRSGHFARDCPNPA--LCNNCGLPGHIASVCTNDSI 291
IC C++ GH +RDC A +C+NCG GH A C + S+
Sbjct: 212 ICRACNQIGHASRDCMAGAFMICHNCGGRGHTAYECPSVSL 252


>tr|Q9LQZ9|Q9LQZ9_ARATH F10A5.22 OS=Arabidopsis thaliana PE=4 SV=1
Length = 265

Score = 207 bits (527), Expect = 4e-52
Identities = 84/137 (61%), Positives = 104/137 (75%), Gaps = 3/137 (2%)
Frame = +1

Query: 172 DICNNCHRSGHFARDCPNPALCNNCGLPGHIASVCTNDSICWNCKEPGHNAKGCPNETVC 351
++CNNC R GHFARDC N ++CNNCGLPGHIA+ CT +S CWNC+EPGH A C NE +C
Sbjct: 63 NLCNNCKRPGHFARDCSNVSVCNNCGLPGHIAAECTAESRCWNCREPGHVASNCSNEGIC 122

Query: 352 VLCNKPGHVAKNCT---AKEGDTRLCRNCQRPGHLAADCKNEKACNNCRKPGHLARDCKN 522
C K GH A++C+ ++ GD RLC NC + GHLAADC N+KAC NCR GH+ARDC+N
Sbjct: 123 HSCGKSGHRARDCSNSDSRAGDLRLCNNCFKQGHLAADCTNDKACKNCRTSGHIARDCRN 182

Query: 523 SPVCNVCNQVGHIARDC 573
PVCN+C+ GH+AR C
Sbjct: 183 DPVCNICSISGHVARHC 199



Score = 92.8 bits (229), Expect = 2e-17
Identities = 40/100 (40%), Positives = 58/100 (58%)
Frame = +1

Query: 346 VCVLCNKPGHVAKNCTAKEGDTRLCRNCQRPGHLAADCKNEKACNNCRKPGHLARDCKNS 525
+C C +PGH A++C+ + +C NC PGH+AA+C E C NCR+PGH+A +C N
Sbjct: 64 LCNNCKRPGHFARDCS----NVSVCNNCGLPGHIAAECTAESRCWNCREPGHVASNCSNE 119

Query: 526 PVCNVCNQVGHIARDCDSSAPRRRAASPMPVREPLICRNC 645
+C+ C + GH ARDC +S R + +C NC
Sbjct: 120 GICHSCGKSGHRARDCSNSDSR--------AGDLRLCNNC 151



Score = 73.9 bits (180), Expect = 8e-12
Identities = 42/121 (34%), Positives = 57/121 (47%)
Frame = +1

Query: 175 ICNNCHRSGHFARDCPNPALCNNCGLPGHIASVCTNDSICWNCKEPGHNAKGCPNETVCV 354
+CNNC + GH A DC N C NC GHIA C ND +C C GH A+ CP
Sbjct: 147 LCNNCFKQGHLAADCTNDKACKNCRTSGHIARDCRNDPVCNICSISGHVARHCPKGD-SN 205

Query: 355 LCNKPGHVAKNCTAKEGDTRLCRNCQRPGHLAADCKNEKACNNCRKPGHLARDCKNSPVC 534
++ V + G +R+ R+ R G A C+NC GH A +C ++ V
Sbjct: 206 YSDRGSRVRDGGMQRGGLSRMSRD--REGVSAM-----IICHNCGGRGHRAYECPSARVA 258

Query: 535 N 537
+
Sbjct: 259 D 259