DK950413
Clone id TST38A01NGRL0008_J11
Library
Length 617
Definition Adiantum capillus-veneris mRNA. clone: TST38A01NGRL0008_J11. 5' end sequence.
Accession
Tissue type prothallia
Developmental stage gametophyte
Contig ID -
Sequence
CACAGATCCTGACTATAAATTCGATCTCGCTGTTCAGTTAGGGGAGTTGGAAGTGGCAAA
GGATATTGCAGAGAAAGCCCAAAGCGAGTCTAAATGGAAGCAGCTTGGGGAGTTGGCAAT
GTCATCGGGAAAGCTGGATGTTGCTGAGGAGTGTATGACGAAGGCGGAAGATTTAAGTGG
TTTGTTACTGTTATATTCGTCGCTTGGAAACTCAACAGGAATGAAAAAGCTAGCTTCTTT
AGCTCAAGGGAAGGGGAAGATCAACGTGGCCTTTGTATGCCTCTTTATGCTTGGACAGCT
TGAAGAGTGTTTGCAACTTTTGGTTGATAGTAACCGCATACCTGAAGCTGCCTTCATGGC
CCGAGCATACCTTCCTAGTAAAGTTTCCGAGATTGTCAAGCTTTGGCGCAATGACCTGAA
AAAGATCAATCAGAAGGCTGCGGAATCTCTGGCGGATCCTCAAGAATATCCGAACTTGTT
TACAGACTGGCAATGGGCTTTAGAGGCGGAAGCAAGAATGAAACCCCTCAGAGAGAACCT
TTTACCAGCTAATGAGTACATGAACCATTTGGGACGCACAAAAATGAACATTATTGAGGA
AATGAAGGCCTTGCATT
■■Homology search results ■■ -
sp_hit_id Q5VQ78
Definition sp|Q5VQ78|COB21_ORYSJ Coatomer subunit beta'-1 OS=Oryza sativa subsp. japonica
Align length 204
Score (bit) 259.0
E-value 1.0e-68
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= DK950413|Adiantum capillus-veneris mRNA, clone:
TST38A01NGRL0008_J11, 5'
(617 letters)

Database: uniprot_sprot.fasta
412,525 sequences; 148,809,765 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

sp|Q5VQ78|COB21_ORYSJ Coatomer subunit beta'-1 OS=Oryza sativa s... 259 1e-68
sp|Q9CAA0|COB21_ARATH Coatomer subunit beta'-1 OS=Arabidopsis th... 248 1e-65
sp|Q6H8D5|COB22_ORYSJ Coatomer subunit beta'-2 OS=Oryza sativa s... 248 2e-65
sp|Q9C827|COB22_ARATH Coatomer subunit beta'-2 OS=Arabidopsis th... 245 1e-64
sp|Q8L828|COB23_ARATH Coatomer subunit beta'-3 OS=Arabidopsis th... 245 2e-64
sp|Q6H8D6|COB23_ORYSJ Putative coatomer subunit beta'-3 OS=Oryza... 244 2e-64
sp|O35142|COPB2_RAT Coatomer subunit beta' OS=Rattus norvegicus ... 186 1e-46
sp|O55029|COPB2_MOUSE Coatomer subunit beta' OS=Mus musculus GN=... 186 1e-46
sp|P35605|COPB2_BOVIN Coatomer subunit beta' OS=Bos taurus GN=CO... 185 1e-46
sp|Q5R664|COPB2_PONAB Coatomer subunit beta' OS=Pongo abelii GN=... 183 5e-46
sp|P35606|COPB2_HUMAN Coatomer subunit beta' OS=Homo sapiens GN=... 183 7e-46
sp|Q4R4I8|COPB2_MACFA Coatomer subunit beta' OS=Macaca fascicula... 182 2e-45
sp|O62621|COPB2_DROME Coatomer subunit beta' OS=Drosophila melan... 155 2e-37
sp|Q54YD8|COPB2_DICDI Coatomer subunit beta' OS=Dictyostelium di... 155 2e-37
sp|Q20168|COPB2_CAEEL Probable coatomer subunit beta' OS=Caenorh... 130 7e-30
sp|O42937|COPB2_SCHPO Probable coatomer subunit beta' OS=Schizos... 91 5e-18
sp|P41811|COPB2_YEAST Coatomer subunit beta' OS=Saccharomyces ce... 79 1e-14
sp|P53622|COPA_YEAST Coatomer subunit alpha OS=Saccharomyces cer... 48 5e-05
sp|Q96WV5|COPA_SCHPO Putative coatomer subunit alpha OS=Schizosa... 45 4e-04
sp|Q8CIE6|COPA_MOUSE Coatomer subunit alpha OS=Mus musculus GN=C... 45 4e-04
sp|P53621|COPA_HUMAN Coatomer subunit alpha OS=Homo sapiens GN=C... 45 4e-04
sp|Q27954|COPA_BOVIN Coatomer subunit alpha OS=Bos taurus GN=COP... 45 4e-04
sp|Q5XQN5|K2C5_BOVIN Keratin, type II cytoskeletal 5 OS=Bos taur... 34 0.69
sp|P34574|CLH_CAEEL Probable clathrin heavy chain 1 OS=Caenorhab... 33 0.90
sp|A2QBZ0|SEC31_ASPNC Protein transport protein sec31 OS=Aspergi... 33 1.2
sp|Q9U6A9|NOG1_TRYBB Nucleolar GTP-binding protein 1 OS=Trypanos... 33 1.5
sp|P48668|K2C6C_HUMAN Keratin, type II cytoskeletal 6C OS=Homo s... 33 1.5
sp|Q9Z331|K2C6B_MOUSE Keratin, type II cytoskeletal 6B OS=Mus mu... 33 1.5
sp|P04259|K2C6B_HUMAN Keratin, type II cytoskeletal 6B OS=Homo s... 33 1.5
sp|P50446|K2C6A_MOUSE Keratin, type II cytoskeletal 6A OS=Mus mu... 33 1.5

>sp|Q5VQ78|COB21_ORYSJ Coatomer subunit beta'-1 OS=Oryza sativa subsp.
japonica GN=Os06g0143900 PE=2 SV=1
Length = 907

Score = 259 bits (661), Expect = 1e-68
Identities = 129/204 (63%), Positives = 157/204 (76%)
Frame = +2

Query: 2 TDPDYKFDLAVQLGELEVAKDIAEKAQSESKWKQLGELAMSSGKLDVAEECMTKAEDXXX 181
TD DY+FDLAVQLG+LEVAK IA +AQSESKWKQLGELAMS+GKLD+AEEC+ +A+D
Sbjct: 640 TDADYRFDLAVQLGKLEVAKAIAMEAQSESKWKQLGELAMSTGKLDMAEECLVQAKDLSG 699

Query: 182 XXXXXXXXXXXTGMKKLASLAQGKGKINVAFVCLFMLGQLEECLQLLVDSNRIPEAAFMA 361
G++KLAS A+ GK NVAF+CLFMLG+LE+C+QLL+DSNRIPEAA MA
Sbjct: 700 LLLLYSSLGDAEGIEKLASQAKEHGKNNVAFLCLFMLGKLEDCIQLLIDSNRIPEAALMA 759

Query: 362 RAYLPSKVSEIVKLWRNDLKKINQKAAESLADPQEYPNLFTDWQWALEAEARMKPLRENL 541
R+YLPSKVSEIV +WRNDL K+N KAAESLADP EYPNLF DWQ AL E + R +
Sbjct: 760 RSYLPSKVSEIVAIWRNDLSKVNPKAAESLADPSEYPNLFEDWQVALTVEKNVASRRVHY 819

Query: 542 LPANEYMNHLGRTKMNIIEEMKAL 613
PA+EY+NH ++ M ++E K +
Sbjct: 820 PPADEYLNHAEKSDMTLVEAFKRM 843


>sp|Q9CAA0|COB21_ARATH Coatomer subunit beta'-1 OS=Arabidopsis
thaliana GN=At1g79990 PE=2 SV=2
Length = 920

Score = 248 bits (634), Expect = 1e-65
Identities = 127/204 (62%), Positives = 151/204 (74%)
Frame = +2

Query: 2 TDPDYKFDLAVQLGELEVAKDIAEKAQSESKWKQLGELAMSSGKLDVAEECMTKAEDXXX 181
TDPDY+F+LA+QLG L VAKDIA +AQ+ESKWKQLGELAMSSGKLD+AEECM A D
Sbjct: 639 TDPDYRFELAIQLGRLAVAKDIAVEAQNESKWKQLGELAMSSGKLDMAEECMRHAMDLSG 698

Query: 182 XXXXXXXXXXXTGMKKLASLAQGKGKINVAFVCLFMLGQLEECLQLLVDSNRIPEAAFMA 361
GM KLA+LA+ +GK NVAF+CLFMLGQ+E+CL LLV+SNRIPEAA MA
Sbjct: 699 LLLLYSSLGDADGMMKLAALAKEQGKNNVAFLCLFMLGQVEDCLHLLVESNRIPEAALMA 758

Query: 362 RAYLPSKVSEIVKLWRNDLKKINQKAAESLADPQEYPNLFTDWQWALEAEARMKPLRENL 541
R+YLPSKVSEIV LWRNDL KI+ KAAESLADP+EYPNLF +WQ AL E R R
Sbjct: 759 RSYLPSKVSEIVALWRNDLTKISPKAAESLADPEEYPNLFEEWQVALSLENRAAETRGVH 818

Query: 542 LPANEYMNHLGRTKMNIIEEMKAL 613
PA +Y +H R +++ + +
Sbjct: 819 PPAGDYCSHADRDHTTLVDAFRIM 842


>sp|Q6H8D5|COB22_ORYSJ Coatomer subunit beta'-2 OS=Oryza sativa subsp.
japonica GN=Os02g0209100 PE=2 SV=1
Length = 910

Score = 248 bits (633), Expect = 2e-65
Identities = 125/205 (60%), Positives = 151/205 (73%)
Frame = +2

Query: 2 TDPDYKFDLAVQLGELEVAKDIAEKAQSESKWKQLGELAMSSGKLDVAEECMTKAEDXXX 181
TD +Y+FDLAVQLG LEVAK IA +AQSESKW+QLGELAMS+GKLD+AEEC+ A D
Sbjct: 640 TDSNYRFDLAVQLGRLEVAKAIAIEAQSESKWRQLGELAMSTGKLDMAEECLLHAMDLSG 699

Query: 182 XXXXXXXXXXXTGMKKLASLAQGKGKINVAFVCLFMLGQLEECLQLLVDSNRIPEAAFMA 361
G+ KL S+A+ +GK NVAF+C FMLG+LEECLQLL++SNRIPEAA M+
Sbjct: 700 LLLLYSSLGDAEGLTKLTSMAKEQGKNNVAFLCFFMLGKLEECLQLLIESNRIPEAALMS 759

Query: 362 RAYLPSKVSEIVKLWRNDLKKINQKAAESLADPQEYPNLFTDWQWALEAEARMKPLRENL 541
R+YLPSKV EIV LW+ DL+K+N KAAESLADP EYPNLF DWQ AL EA + P R
Sbjct: 760 RSYLPSKVPEIVTLWKKDLQKVNPKAAESLADPDEYPNLFEDWQIALNVEANVAPKRGIY 819

Query: 542 LPANEYMNHLGRTKMNIIEEMKALH 616
PA EY+ H R ++E K++H
Sbjct: 820 PPAEEYIIHAERPNETLVEAFKSMH 844


>sp|Q9C827|COB22_ARATH Coatomer subunit beta'-2 OS=Arabidopsis
thaliana GN=At1g52360 PE=2 SV=1
Length = 926

Score = 245 bits (626), Expect = 1e-64
Identities = 124/204 (60%), Positives = 151/204 (74%)
Frame = +2

Query: 2 TDPDYKFDLAVQLGELEVAKDIAEKAQSESKWKQLGELAMSSGKLDVAEECMTKAEDXXX 181
TDPDY+F+LA+QLG LE+A++IA + QSESKWKQLGELAMSSGKL +AEECM A D
Sbjct: 640 TDPDYRFELAIQLGRLEIAQEIAVEVQSESKWKQLGELAMSSGKLQMAEECMKYAMDLSG 699

Query: 182 XXXXXXXXXXXTGMKKLASLAQGKGKINVAFVCLFMLGQLEECLQLLVDSNRIPEAAFMA 361
G+ KLA+LA+ +GK NVAF+CLFMLG+LE+CLQLLV+SNRIPEAA MA
Sbjct: 700 LLLLYSSLGDAEGVTKLATLAKEQGKNNVAFLCLFMLGKLEDCLQLLVESNRIPEAALMA 759

Query: 362 RAYLPSKVSEIVKLWRNDLKKINQKAAESLADPQEYPNLFTDWQWALEAEARMKPLRENL 541
R+YLPSKVSEIV LWR DL K+N KAAESLADP+EY NLF DWQ AL EA+ R
Sbjct: 760 RSYLPSKVSEIVALWRKDLSKVNSKAAESLADPEEYSNLFEDWQVALSVEAKAVETRGVY 819

Query: 542 LPANEYMNHLGRTKMNIIEEMKAL 613
A +Y +H ++ M ++E + L
Sbjct: 820 TGAKDYPSHADKSSMTLVEAFRNL 843


>sp|Q8L828|COB23_ARATH Coatomer subunit beta'-3 OS=Arabidopsis
thaliana GN=At3g15980 PE=2 SV=1
Length = 909

Score = 245 bits (625), Expect = 2e-64
Identities = 125/204 (61%), Positives = 147/204 (72%)
Frame = +2

Query: 2 TDPDYKFDLAVQLGELEVAKDIAEKAQSESKWKQLGELAMSSGKLDVAEECMTKAEDXXX 181
TDPDYKFDLA+QLG LE+AK+IAE+ QSESKWKQLGELAMSSGKL +AE+CM A D
Sbjct: 640 TDPDYKFDLAIQLGRLEIAKEIAEEVQSESKWKQLGELAMSSGKLQLAEDCMKYAMDLSG 699

Query: 182 XXXXXXXXXXXTGMKKLASLAQGKGKINVAFVCLFMLGQLEECLQLLVDSNRIPEAAFMA 361
G+ KLA LA+ +GK NVAF+CLF LG+LE+CLQLLV+SNRIPEAA MA
Sbjct: 700 LLLLYSSLGDAEGVSKLACLAKEQGKNNVAFLCLFTLGRLEDCLQLLVESNRIPEAALMA 759

Query: 362 RAYLPSKVSEIVKLWRNDLKKINQKAAESLADPQEYPNLFTDWQWALEAEARMKPLRENL 541
R+YLPSKVSEIV LWR DL K+N KAAESLADP+EY NLF DWQ AL EA R
Sbjct: 760 RSYLPSKVSEIVALWREDLSKVNPKAAESLADPEEYSNLFEDWQVALSVEANTAETRGVY 819

Query: 542 LPANEYMNHLGRTKMNIIEEMKAL 613
A Y +H + + ++E + L
Sbjct: 820 TAAENYPSHADKPSITLVEAFRNL 843


>sp|Q6H8D6|COB23_ORYSJ Putative coatomer subunit beta'-3 OS=Oryza
sativa subsp. japonica GN=Os02g0209000 PE=3 SV=2
Length = 910

Score = 244 bits (624), Expect = 2e-64
Identities = 124/202 (61%), Positives = 148/202 (73%)
Frame = +2

Query: 2 TDPDYKFDLAVQLGELEVAKDIAEKAQSESKWKQLGELAMSSGKLDVAEECMTKAEDXXX 181
TD +Y+FDLAVQLG LEVAK IA +AQSESKW+QLGELAMS+GKLD+AEEC+ A D
Sbjct: 640 TDSNYRFDLAVQLGRLEVAKAIAIEAQSESKWRQLGELAMSTGKLDMAEECLLHAMDLSG 699

Query: 182 XXXXXXXXXXXTGMKKLASLAQGKGKINVAFVCLFMLGQLEECLQLLVDSNRIPEAAFMA 361
G+ KL S+A+ +GK NVAF+C FMLG+LEECLQLL++SNRIPEAA M+
Sbjct: 700 LLLLYSSLGDAEGLTKLTSMAKEQGKNNVAFLCFFMLGKLEECLQLLIESNRIPEAALMS 759

Query: 362 RAYLPSKVSEIVKLWRNDLKKINQKAAESLADPQEYPNLFTDWQWALEAEARMKPLRENL 541
R+YLPSKV EIV LW+ DL+K+N KAAESLADP EYPNLF DWQ AL EA + P R
Sbjct: 760 RSYLPSKVPEIVTLWKKDLQKVNPKAAESLADPNEYPNLFEDWQIALNVEANVAPKRGIY 819

Query: 542 LPANEYMNHLGRTKMNIIEEMK 607
PA EY+ H R ++E K
Sbjct: 820 APAKEYIIHAERPNETLVEAFK 841


>sp|O35142|COPB2_RAT Coatomer subunit beta' OS=Rattus norvegicus
GN=Copb2 PE=2 SV=3
Length = 905

Score = 186 bits (471), Expect = 1e-46
Identities = 95/202 (47%), Positives = 134/202 (66%)
Frame = +2

Query: 2 TDPDYKFDLAVQLGELEVAKDIAEKAQSESKWKQLGELAMSSGKLDVAEECMTKAEDXXX 181
TDP+++F+LA+QLGEL++A +A +A+SE KWKQL ELA+S + +A+EC+ A+D
Sbjct: 639 TDPEHRFELALQLGELKIAYQLAVEAESEQKWKQLAELAISKCQFSLAQECLHHAQDYGG 698

Query: 182 XXXXXXXXXXXTGMKKLASLAQGKGKINVAFVCLFMLGQLEECLQLLVDSNRIPEAAFMA 361
+ + KLA A+ GK NVAF+ F+ G+L+ CL+LL+ + R+PEAAF+A
Sbjct: 699 LLLLATASGNASMVNKLAEGAERDGKNNVAFMSYFLQGKLDACLELLIRTGRLPEAAFLA 758

Query: 362 RAYLPSKVSEIVKLWRNDLKKINQKAAESLADPQEYPNLFTDWQWALEAEARMKPLRENL 541
R YLPS+VS +VKLWR +L K+NQKAAESLADP EY NLF + A E +K +L
Sbjct: 759 RTYLPSQVSRVVKLWRENLSKVNQKAAESLADPTEYENLFPGLKEAFVVEEWVKETHADL 818

Query: 542 LPANEYMNHLGRTKMNIIEEMK 607
PA +Y + N++EE K
Sbjct: 819 WPAKQYPLVTPNEERNVMEEAK 840


>sp|O55029|COPB2_MOUSE Coatomer subunit beta' OS=Mus musculus GN=Copb2
PE=2 SV=2
Length = 905

Score = 186 bits (471), Expect = 1e-46
Identities = 95/202 (47%), Positives = 134/202 (66%)
Frame = +2

Query: 2 TDPDYKFDLAVQLGELEVAKDIAEKAQSESKWKQLGELAMSSGKLDVAEECMTKAEDXXX 181
TDP+++F+LA+QLGEL++A +A +A+SE KWKQL ELA+S + +A+EC+ A+D
Sbjct: 639 TDPEHRFELALQLGELKIAYQLAVEAESEQKWKQLAELAISKCQFSLAQECLHHAQDYGG 698

Query: 182 XXXXXXXXXXXTGMKKLASLAQGKGKINVAFVCLFMLGQLEECLQLLVDSNRIPEAAFMA 361
+ + KLA A+ GK NVAF+ F+ G+L+ CL+LL+ + R+PEAAF+A
Sbjct: 699 LLLLATASGNASMVNKLAEGAERDGKNNVAFMSYFLQGKLDACLELLIRTGRLPEAAFLA 758

Query: 362 RAYLPSKVSEIVKLWRNDLKKINQKAAESLADPQEYPNLFTDWQWALEAEARMKPLRENL 541
R YLPS+VS +VKLWR +L K+NQKAAESLADP EY NLF + A E +K +L
Sbjct: 759 RTYLPSQVSRVVKLWRENLSKVNQKAAESLADPTEYENLFPGLKEAFVVEEWVKETHADL 818

Query: 542 LPANEYMNHLGRTKMNIIEEMK 607
PA +Y + N++EE K
Sbjct: 819 WPAKQYPLVTPNEERNVMEEAK 840


>sp|P35605|COPB2_BOVIN Coatomer subunit beta' OS=Bos taurus GN=COPB2
PE=1 SV=3
Length = 906

Score = 185 bits (470), Expect = 1e-46
Identities = 95/202 (47%), Positives = 134/202 (66%)
Frame = +2

Query: 2 TDPDYKFDLAVQLGELEVAKDIAEKAQSESKWKQLGELAMSSGKLDVAEECMTKAEDXXX 181
TDP+++F+LA+QLGEL++A +A +A+SE KWKQL ELA+S + +A+EC+ A+D
Sbjct: 639 TDPEHRFELALQLGELKIAYQLAVEAESEQKWKQLAELAISKCQFGLAQECLHHAQDYGG 698

Query: 182 XXXXXXXXXXXTGMKKLASLAQGKGKINVAFVCLFMLGQLEECLQLLVDSNRIPEAAFMA 361
+ + KLA A+ GK NVAF+ F+ G+L+ CL+LL+ + R+PEAAF+A
Sbjct: 699 LLLLATASGNASMVNKLAEGAERDGKNNVAFMSYFLQGKLDACLELLIRTGRLPEAAFLA 758

Query: 362 RAYLPSKVSEIVKLWRNDLKKINQKAAESLADPQEYPNLFTDWQWALEAEARMKPLRENL 541
R YLPS+VS +VKLWR +L K+NQKAAESLADP EY NLF + A E +K +L
Sbjct: 759 RTYLPSQVSRVVKLWRENLSKVNQKAAESLADPTEYENLFPGLKEAFVVEEWVKETHADL 818

Query: 542 LPANEYMNHLGRTKMNIIEEMK 607
PA +Y + N++EE K
Sbjct: 819 WPAKQYPLVTPNEERNVMEEAK 840


>sp|Q5R664|COPB2_PONAB Coatomer subunit beta' OS=Pongo abelii GN=COPB2
PE=2 SV=1
Length = 906

Score = 183 bits (465), Expect = 5e-46
Identities = 94/202 (46%), Positives = 132/202 (65%)
Frame = +2

Query: 2 TDPDYKFDLAVQLGELEVAKDIAEKAQSESKWKQLGELAMSSGKLDVAEECMTKAEDXXX 181
TDP+++F+LA+QLGEL++A +A +A+SE KWKQL ELA+S + +A+EC+ A+D
Sbjct: 639 TDPEHRFELALQLGELKIAYQLAVEAESEQKWKQLAELAISKCQFGLAQECLHHAQDYGG 698

Query: 182 XXXXXXXXXXXTGMKKLASLAQGKGKINVAFVCLFMLGQLEECLQLLVDSNRIPEAAFMA 361
+ KLA A+ GK NVAF+ F+ G+++ CL+LL+ + R+PEAAF+A
Sbjct: 699 LLLLATASGNANMVNKLAEGAERDGKNNVAFMSYFLQGKVDACLELLIRTGRLPEAAFLA 758

Query: 362 RAYLPSKVSEIVKLWRNDLKKINQKAAESLADPQEYPNLFTDWQWALEAEARMKPLRENL 541
R YLPS+VS +VKLWR +L K+NQKAAESLADP EY NLF + A E +K L
Sbjct: 759 RTYLPSQVSRVVKLWRENLSKVNQKAAESLADPTEYENLFPGLKEAFVVEEWVKETHAEL 818

Query: 542 LPANEYMNHLGRTKMNIIEEMK 607
PA +Y + N++EE K
Sbjct: 819 WPAKQYPLVTPNEERNVMEEAK 840


tr_hit_id Q5VQ77
Definition tr|Q5VQ77|Q5VQ77_ORYSJ Coatomer protein complex, beta prime subunit-like OS=Oryza sativa subsp. japonica
Align length 204
Score (bit) 259.0
E-value 1.0e-67
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= DK950413|Adiantum capillus-veneris mRNA, clone:
TST38A01NGRL0008_J11, 5'
(617 letters)

Database: uniprot_trembl.fasta
7,341,751 sequences; 2,391,615,440 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

tr|Q5VQ77|Q5VQ77_ORYSJ Coatomer protein complex, beta prime subu... 259 1e-67
tr|A3B8B8|A3B8B8_ORYSJ Putative uncharacterized protein OS=Oryza... 259 1e-67
tr|A2Y963|A2Y963_ORYSI Putative uncharacterized protein OS=Oryza... 259 1e-67
tr|A7P7E9|A7P7E9_VITVI Chromosome chr9 scaffold_7, whole genome ... 257 3e-67
tr|A5AWP2|A5AWP2_VITVI Putative uncharacterized protein OS=Vitis... 257 3e-67
tr|A9SAN0|A9SAN0_PHYPA Predicted protein OS=Physcomitrella paten... 257 4e-67
tr|A1YKF7|A1YKF7_BRASY Coatomer complex subunit OS=Brachypodium ... 256 6e-67
tr|A7PES4|A7PES4_VITVI Chromosome chr11 scaffold_13, whole genom... 249 1e-64
tr|B3H5V5|B3H5V5_ARATH Uncharacterized protein At1g79990.2 OS=Ar... 248 2e-64
tr|A9PF13|A9PF13_POPTR Putative uncharacterized protein OS=Popul... 247 3e-64
tr|A9TJC1|A9TJC1_PHYPA Predicted protein OS=Physcomitrella paten... 246 8e-64
tr|A9SHI8|A9SHI8_PHYPA Predicted protein OS=Physcomitrella paten... 243 7e-63
tr|B8ADW8|B8ADW8_ORYSI Putative uncharacterized protein OS=Oryza... 235 2e-60
tr|A3A4F1|A3A4F1_ORYSJ Putative uncharacterized protein OS=Oryza... 218 3e-55
tr|A3A4F0|A3A4F0_ORYSJ Putative uncharacterized protein OS=Oryza... 214 3e-54
tr|A3EXX1|A3EXX1_MACHI Putative coatomer protein complex, subuni... 198 2e-49
tr|A7RL77|A7RL77_NEMVE Predicted protein OS=Nematostella vectens... 194 3e-48
tr|B8AE85|B8AE85_ORYSI Putative uncharacterized protein OS=Oryza... 191 4e-47
tr|Q7ZTR0|Q7ZTR0_XENLA Wu:fc55e05-prov protein OS=Xenopus laevis... 189 1e-46
tr|Q4VA86|Q4VA86_XENTR Putative uncharacterized protein mgc10808... 188 2e-46
tr|A8JGS8|A8JGS8_CHLRE Beta'-cop OS=Chlamydomonas reinhardtii GN... 188 2e-46
tr|Q5M7X1|Q5M7X1_RAT Coatomer protein complex, subunit beta 2 (B... 186 1e-45
tr|B4DZI8|B4DZI8_HUMAN cDNA FLJ56271, highly similar to Coatomer... 183 8e-45
tr|Q6JWU7|Q6JWU7_DANRE Coatomer protein complex subunit beta 2 O... 181 2e-44
tr|B3DH83|B3DH83_DANRE Coatomer protein complex, subunit beta 2 ... 181 2e-44
tr|B0R171|B0R171_DANRE Coatomer protein complex, subunit beta 2 ... 181 2e-44
tr|A4RR16|A4RR16_OSTLU Predicted protein OS=Ostreococcus lucimar... 177 6e-43
tr|Q4SBJ7|Q4SBJ7_TETNG Chromosome 15 SCAF14667, whole genome sho... 174 5e-42
tr|B6LX76|B6LX76_BRAFL Putative uncharacterized protein OS=Branc... 173 8e-42
tr|Q01GI8|Q01GI8_OSTTA Coatomer complex subunit, putative; 33791... 172 1e-41

>tr|Q5VQ77|Q5VQ77_ORYSJ Coatomer protein complex, beta prime
subunit-like OS=Oryza sativa subsp. japonica
GN=OSJNBa0007O20.8-2 PE=4 SV=1
Length = 328

Score = 259 bits (661), Expect = 1e-67
Identities = 129/204 (63%), Positives = 157/204 (76%)
Frame = +2

Query: 2 TDPDYKFDLAVQLGELEVAKDIAEKAQSESKWKQLGELAMSSGKLDVAEECMTKAEDXXX 181
TD DY+FDLAVQLG+LEVAK IA +AQSESKWKQLGELAMS+GKLD+AEEC+ +A+D
Sbjct: 57 TDADYRFDLAVQLGKLEVAKAIAMEAQSESKWKQLGELAMSTGKLDMAEECLVQAKDLSG 116

Query: 182 XXXXXXXXXXXTGMKKLASLAQGKGKINVAFVCLFMLGQLEECLQLLVDSNRIPEAAFMA 361
G++KLAS A+ GK NVAF+CLFMLG+LE+C+QLL+DSNRIPEAA MA
Sbjct: 117 LLLLYSSLGDAEGIEKLASQAKEHGKNNVAFLCLFMLGKLEDCIQLLIDSNRIPEAALMA 176

Query: 362 RAYLPSKVSEIVKLWRNDLKKINQKAAESLADPQEYPNLFTDWQWALEAEARMKPLRENL 541
R+YLPSKVSEIV +WRNDL K+N KAAESLADP EYPNLF DWQ AL E + R +
Sbjct: 177 RSYLPSKVSEIVAIWRNDLSKVNPKAAESLADPSEYPNLFEDWQVALTVEKNVASRRVHY 236

Query: 542 LPANEYMNHLGRTKMNIIEEMKAL 613
PA+EY+NH ++ M ++E K +
Sbjct: 237 PPADEYLNHAEKSDMTLVEAFKRM 260


>tr|A3B8B8|A3B8B8_ORYSJ Putative uncharacterized protein OS=Oryza
sativa subsp. japonica GN=OsJ_019290 PE=4 SV=1
Length = 902

Score = 259 bits (661), Expect = 1e-67
Identities = 129/204 (63%), Positives = 157/204 (76%)
Frame = +2

Query: 2 TDPDYKFDLAVQLGELEVAKDIAEKAQSESKWKQLGELAMSSGKLDVAEECMTKAEDXXX 181
TD DY+FDLAVQLG+LEVAK IA +AQSESKWKQLGELAMS+GKLD+AEEC+ +A+D
Sbjct: 635 TDADYRFDLAVQLGKLEVAKAIAMEAQSESKWKQLGELAMSTGKLDMAEECLVQAKDLSG 694

Query: 182 XXXXXXXXXXXTGMKKLASLAQGKGKINVAFVCLFMLGQLEECLQLLVDSNRIPEAAFMA 361
G++KLAS A+ GK NVAF+CLFMLG+LE+C+QLL+DSNRIPEAA MA
Sbjct: 695 LLLLYSSLGDAEGIEKLASQAKEHGKNNVAFLCLFMLGKLEDCIQLLIDSNRIPEAALMA 754

Query: 362 RAYLPSKVSEIVKLWRNDLKKINQKAAESLADPQEYPNLFTDWQWALEAEARMKPLRENL 541
R+YLPSKVSEIV +WRNDL K+N KAAESLADP EYPNLF DWQ AL E + R +
Sbjct: 755 RSYLPSKVSEIVAIWRNDLSKVNPKAAESLADPSEYPNLFEDWQVALTVEKNVASRRVHY 814

Query: 542 LPANEYMNHLGRTKMNIIEEMKAL 613
PA+EY+NH ++ M ++E K +
Sbjct: 815 PPADEYLNHAEKSDMTLVEAFKRM 838


>tr|A2Y963|A2Y963_ORYSI Putative uncharacterized protein OS=Oryza
sativa subsp. indica GN=OsI_21602 PE=4 SV=1
Length = 902

Score = 259 bits (661), Expect = 1e-67
Identities = 129/204 (63%), Positives = 157/204 (76%)
Frame = +2

Query: 2 TDPDYKFDLAVQLGELEVAKDIAEKAQSESKWKQLGELAMSSGKLDVAEECMTKAEDXXX 181
TD DY+FDLAVQLG+LEVAK IA +AQSESKWKQLGELAMS+GKLD+AEEC+ +A+D
Sbjct: 635 TDADYRFDLAVQLGKLEVAKAIAMEAQSESKWKQLGELAMSTGKLDMAEECLVQAKDLSG 694

Query: 182 XXXXXXXXXXXTGMKKLASLAQGKGKINVAFVCLFMLGQLEECLQLLVDSNRIPEAAFMA 361
G++KLAS A+ GK NVAF+CLFMLG+LE+C+QLL+DSNRIPEAA MA
Sbjct: 695 LLLLYSSLGDAEGIEKLASQAKEHGKNNVAFLCLFMLGKLEDCIQLLIDSNRIPEAALMA 754

Query: 362 RAYLPSKVSEIVKLWRNDLKKINQKAAESLADPQEYPNLFTDWQWALEAEARMKPLRENL 541
R+YLPSKVSEIV +WRNDL K+N KAAESLADP EYPNLF DWQ AL E + R +
Sbjct: 755 RSYLPSKVSEIVAIWRNDLSKVNPKAAESLADPSEYPNLFEDWQVALTVEKNVASRRVHY 814

Query: 542 LPANEYMNHLGRTKMNIIEEMKAL 613
PA+EY+NH ++ M ++E K +
Sbjct: 815 PPADEYLNHAEKSDMTLVEAFKRM 838


>tr|A7P7E9|A7P7E9_VITVI Chromosome chr9 scaffold_7, whole genome
shotgun sequence OS=Vitis vinifera GN=GSVIVT00034434001
PE=4 SV=1
Length = 1017

Score = 257 bits (657), Expect = 3e-67
Identities = 130/204 (63%), Positives = 155/204 (75%)
Frame = +2

Query: 2 TDPDYKFDLAVQLGELEVAKDIAEKAQSESKWKQLGELAMSSGKLDVAEECMTKAEDXXX 181
TDPDY+F+LA+QLG LEVAKDIA + QSESKWKQLGELAMS+GKL++AEEC+ A D
Sbjct: 697 TDPDYRFELAMQLGRLEVAKDIATEVQSESKWKQLGELAMSTGKLEMAEECLKHAMDLSG 756

Query: 182 XXXXXXXXXXXTGMKKLASLAQGKGKINVAFVCLFMLGQLEECLQLLVDSNRIPEAAFMA 361
G+ KLASLA+ +GK NVAF+CLFMLG+LEECLQLLVDSNRIPEAA MA
Sbjct: 757 LLLLYSSLGDADGISKLASLAKEQGKNNVAFLCLFMLGKLEECLQLLVDSNRIPEAALMA 816

Query: 362 RAYLPSKVSEIVKLWRNDLKKINQKAAESLADPQEYPNLFTDWQWALEAEARMKPLRENL 541
R+YLPSKVSEIV LWR DL K+N KAAESLADP+EYPNLF DWQ L E+++ R
Sbjct: 817 RSYLPSKVSEIVALWRKDLNKVNPKAAESLADPEEYPNLFEDWQVGLAIESKVAETRSIY 876

Query: 542 LPANEYMNHLGRTKMNIIEEMKAL 613
PA EY+N R+ +N++E + L
Sbjct: 877 PPAEEYLNCADRSHINLVEAFRNL 900


>tr|A5AWP2|A5AWP2_VITVI Putative uncharacterized protein OS=Vitis
vinifera GN=VITISV_004513 PE=4 SV=1
Length = 901

Score = 257 bits (657), Expect = 3e-67
Identities = 130/204 (63%), Positives = 155/204 (75%)
Frame = +2

Query: 2 TDPDYKFDLAVQLGELEVAKDIAEKAQSESKWKQLGELAMSSGKLDVAEECMTKAEDXXX 181
TDPDY+F+LA+QLG LEVAKDIA + QSESKWKQLGELAMS+GKL++AEEC+ A D
Sbjct: 633 TDPDYRFELAMQLGRLEVAKDIATEVQSESKWKQLGELAMSTGKLEMAEECLKHAMDLSG 692

Query: 182 XXXXXXXXXXXTGMKKLASLAQGKGKINVAFVCLFMLGQLEECLQLLVDSNRIPEAAFMA 361
G+ KLASLA+ +GK NVAF+CLFMLG+LEECLQLLVDSNRIPEAA MA
Sbjct: 693 LLLLYSSLGDADGISKLASLAKEQGKNNVAFLCLFMLGKLEECLQLLVDSNRIPEAALMA 752

Query: 362 RAYLPSKVSEIVKLWRNDLKKINQKAAESLADPQEYPNLFTDWQWALEAEARMKPLRENL 541
R+YLPSKVSEIV LWR DL K+N KAAESLADP+EYPNLF DWQ L E+++ R
Sbjct: 753 RSYLPSKVSEIVALWRKDLNKVNPKAAESLADPEEYPNLFEDWQVGLAIESKVAETRSIY 812

Query: 542 LPANEYMNHLGRTKMNIIEEMKAL 613
PA EY+N R+ +N++E + L
Sbjct: 813 PPAEEYLNCADRSHINLVEAFRNL 836


>tr|A9SAN0|A9SAN0_PHYPA Predicted protein OS=Physcomitrella patens
subsp. patens GN=PHYPADRAFT_210315 PE=4 SV=1
Length = 909

Score = 257 bits (656), Expect = 4e-67
Identities = 126/204 (61%), Positives = 158/204 (77%)
Frame = +2

Query: 2 TDPDYKFDLAVQLGELEVAKDIAEKAQSESKWKQLGELAMSSGKLDVAEECMTKAEDXXX 181
TDPDYKFDLAVQLG+L++AK IAE++ SESKWKQLGELAMS+GKLDVAEEC+ +A+D
Sbjct: 640 TDPDYKFDLAVQLGKLDMAKAIAEESHSESKWKQLGELAMSAGKLDVAEECLNQAKDQSG 699

Query: 182 XXXXXXXXXXXTGMKKLASLAQGKGKINVAFVCLFMLGQLEECLQLLVDSNRIPEAAFMA 361
G+++LA+ A+ GK NVAFV LF+LG++EEC+ LL++SNRIPEAAFMA
Sbjct: 700 LLLLYSAVGDAEGLERLAASARENGKNNVAFVSLFLLGKVEECIDLLIESNRIPEAAFMA 759

Query: 362 RAYLPSKVSEIVKLWRNDLKKINQKAAESLADPQEYPNLFTDWQWALEAEARMKPLRENL 541
R Y PS VS IV LWRNDLKKINQKAAESLADP+EYPNLF+DW+ AL EA+MK LR
Sbjct: 760 RTYAPSHVSRIVSLWRNDLKKINQKAAESLADPEEYPNLFSDWESALATEAKMKDLRSKY 819

Query: 542 LPANEYMNHLGRTKMNIIEEMKAL 613
+PA Y+N + + + E+++ L
Sbjct: 820 IPAATYLNFINGVEEELTEDLQGL 843


>tr|A1YKF7|A1YKF7_BRASY Coatomer complex subunit OS=Brachypodium
sylvaticum GN=57h21.22 PE=4 SV=1
Length = 911

Score = 256 bits (655), Expect = 6e-67
Identities = 129/204 (63%), Positives = 155/204 (75%)
Frame = +2

Query: 2 TDPDYKFDLAVQLGELEVAKDIAEKAQSESKWKQLGELAMSSGKLDVAEECMTKAEDXXX 181
TD DYKFDLAVQLG LEVAKDIA +AQSESKWKQLGELAMS+GKL+ AEEC+ +A+D
Sbjct: 640 TDADYKFDLAVQLGRLEVAKDIAVEAQSESKWKQLGELAMSTGKLEAAEECLLQAKDLSG 699

Query: 182 XXXXXXXXXXXTGMKKLASLAQGKGKINVAFVCLFMLGQLEECLQLLVDSNRIPEAAFMA 361
G++KLASLA+ GK NVAF+CLFMLG+LE+C+QLLVDSNRIPEAA MA
Sbjct: 700 LLLLYSSLGDAIGIEKLASLAKEHGKNNVAFLCLFMLGKLEDCIQLLVDSNRIPEAALMA 759

Query: 362 RAYLPSKVSEIVKLWRNDLKKINQKAAESLADPQEYPNLFTDWQWALEAEARMKPLRENL 541
R+YLPSKVSEIV WRNDL K+N KAA+SLADP EYPNLF DWQ AL E + P R +
Sbjct: 760 RSYLPSKVSEIVATWRNDLSKVNPKAADSLADPSEYPNLFEDWQVALTVEKNIAPQRGHY 819

Query: 542 LPANEYMNHLGRTKMNIIEEMKAL 613
A+EY+N+ ++ ++E K +
Sbjct: 820 PSADEYLNYADKSDSTLVEAFKRM 843


>tr|A7PES4|A7PES4_VITVI Chromosome chr11 scaffold_13, whole genome
shotgun sequence OS=Vitis vinifera GN=GSVIVT00016769001
PE=4 SV=1
Length = 899

Score = 249 bits (635), Expect = 1e-64
Identities = 120/204 (58%), Positives = 154/204 (75%)
Frame = +2

Query: 2 TDPDYKFDLAVQLGELEVAKDIAEKAQSESKWKQLGELAMSSGKLDVAEECMTKAEDXXX 181
TDPDY+FDLA+QLG L AK+IA + QSE+KWKQLGELAMS+GK ++AEEC+ A D
Sbjct: 660 TDPDYRFDLAIQLGRLGTAKEIASEVQSETKWKQLGELAMSNGKFEMAEECLLHAMDLSG 719

Query: 182 XXXXXXXXXXXTGMKKLASLAQGKGKINVAFVCLFMLGQLEECLQLLVDSNRIPEAAFMA 361
G+ KL SLA+ +GK NVAF+CLF LG+LEECLQLLV+SNRIPEAA MA
Sbjct: 720 LLLLYSSFGDANGISKLVSLAKKQGKNNVAFLCLFTLGKLEECLQLLVESNRIPEAALMA 779

Query: 362 RAYLPSKVSEIVKLWRNDLKKINQKAAESLADPQEYPNLFTDWQWALEAEARMKPLRENL 541
R+YLPSKV EI+ +WRNDL K+++KAAESLADP+EYPNLF DWQ AL+ E+++ R
Sbjct: 780 RSYLPSKVPEIITIWRNDLNKVSKKAAESLADPEEYPNLFEDWQVALDIESKISEKRGTY 839

Query: 542 LPANEYMNHLGRTKMNIIEEMKAL 613
PA Y+N+ R+ +N++E K++
Sbjct: 840 PPAEHYLNYAERSNINLMESFKSM 863


>tr|B3H5V5|B3H5V5_ARATH Uncharacterized protein At1g79990.2
OS=Arabidopsis thaliana GN=At1g79990 PE=4 SV=1
Length = 912

Score = 248 bits (634), Expect = 2e-64
Identities = 127/204 (62%), Positives = 151/204 (74%)
Frame = +2

Query: 2 TDPDYKFDLAVQLGELEVAKDIAEKAQSESKWKQLGELAMSSGKLDVAEECMTKAEDXXX 181
TDPDY+F+LA+QLG L VAKDIA +AQ+ESKWKQLGELAMSSGKLD+AEECM A D
Sbjct: 639 TDPDYRFELAIQLGRLAVAKDIAVEAQNESKWKQLGELAMSSGKLDMAEECMRHAMDLSG 698

Query: 182 XXXXXXXXXXXTGMKKLASLAQGKGKINVAFVCLFMLGQLEECLQLLVDSNRIPEAAFMA 361
GM KLA+LA+ +GK NVAF+CLFMLGQ+E+CL LLV+SNRIPEAA MA
Sbjct: 699 LLLLYSSLGDADGMMKLAALAKEQGKNNVAFLCLFMLGQVEDCLHLLVESNRIPEAALMA 758

Query: 362 RAYLPSKVSEIVKLWRNDLKKINQKAAESLADPQEYPNLFTDWQWALEAEARMKPLRENL 541
R+YLPSKVSEIV LWRNDL KI+ KAAESLADP+EYPNLF +WQ AL E R R
Sbjct: 759 RSYLPSKVSEIVALWRNDLTKISPKAAESLADPEEYPNLFEEWQVALSLENRAAETRGVH 818

Query: 542 LPANEYMNHLGRTKMNIIEEMKAL 613
PA +Y +H R +++ + +
Sbjct: 819 PPAGDYCSHADRDHTTLVDAFRIM 842


>tr|A9PF13|A9PF13_POPTR Putative uncharacterized protein OS=Populus
trichocarpa PE=2 SV=1
Length = 470

Score = 247 bits (631), Expect = 3e-64
Identities = 123/202 (60%), Positives = 149/202 (73%)
Frame = +2

Query: 2 TDPDYKFDLAVQLGELEVAKDIAEKAQSESKWKQLGELAMSSGKLDVAEECMTKAEDXXX 181
TDPDY+F+LA+QLG LEVAK+IA + QSESKWKQLGELAMS+GKL++AEECM A D
Sbjct: 199 TDPDYRFELAIQLGRLEVAKEIAIEVQSESKWKQLGELAMSNGKLEMAEECMKHATDLSG 258

Query: 182 XXXXXXXXXXXTGMKKLASLAQGKGKINVAFVCLFMLGQLEECLQLLVDSNRIPEAAFMA 361
G+ KL SLA +GKINVAF+CLFMLG++E+CLQLLV+ NRIPEAA MA
Sbjct: 259 LLLLYSSLGDAEGISKLGSLAIEQGKINVAFLCLFMLGKVEDCLQLLVERNRIPEAALMA 318

Query: 362 RAYLPSKVSEIVKLWRNDLKKINQKAAESLADPQEYPNLFTDWQWALEAEARMKPLRENL 541
R+YLPSKVSEIV LWR DL K+N KAAESLADP+EYPN+F DWQ AL E+R R
Sbjct: 319 RSYLPSKVSEIVALWRKDLNKVNPKAAESLADPEEYPNMFDDWQIALSVESRAAETRGVY 378

Query: 542 LPANEYMNHLGRTKMNIIEEMK 607
PA +Y H + + ++E +
Sbjct: 379 PPAEDYQTHADKPHITLVEAFR 400