DK950434
Clone id TST38A01NGRL0008_K09
Library
Length 663
Definition Adiantum capillus-veneris mRNA. clone: TST38A01NGRL0008_K09. 5' end sequence.
Accession
Tissue type prothallia
Developmental stage gametophyte
Contig ID -
Sequence
GCCAGATCAAGTATATGACAGAGACAAGCGTGGTGACTCATTTTTGCATGTCGCAGCTAA
GTCTGGGAATTTGAAAGTCTTGCAAGCCCTCAAGGCATTCAAGCCAGATGACATTGACAT
GGCACGCTTGCTGACCAATGGTGAACGCGACTGCATCAACAGCCCTGGTATGTATGCCCT
CCTTTACGATCACCGTGAATTTTTTGATGAGCTTGTTACCATGGGTAAAGTAGAGATCAC
CTTAAGCTGCATAATCAAAGCGCTCCTAGCTGAGCTTATCGACAACCCAGAAATCCAGCC
TAGATTAGCTTTGTTTGCGAGCACATTACCTACTTACTTGGCCCTCTATGCGAAGAAGAA
TTGCATTTTTGATTTTTTGTTAGAGACCGACCTCTTAAGCCTGAGCCAGTGGGATGATGA
GTACAATCGGACATGCTTGCACTGGGCGGTTGTGGACAAGAGGATAGACATTGTACAGAA
GCTTTGCAAGGATGTCAAGCTGTGGCCGGGGATTCAGGACAGAGATGGTAAAACTGCGCT
ACAGCATGCGTTTGAGCAGAAAAACCATATGATGCTGGAGATTCTGAGCTTCAAGCGCGT
CTTTAAAGAGCATGAAGAGAAATTGTACAGAGATAGGGAAGTGTATGTCCAAGCACTTAA
TTC
■■Homology search results ■■ -
sp_hit_id A6NHY2
Definition sp|A6NHY2|YE015_HUMAN Ankyrin repeat and death domain-containing protein ENSP00000345065 OS=Homo sapiens
Align length 232
Score (bit) 39.3
E-value 0.019
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= DK950434|Adiantum capillus-veneris mRNA, clone:
TST38A01NGRL0008_K09, 5'
(663 letters)

Database: uniprot_sprot.fasta
412,525 sequences; 148,809,765 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

sp|A6NHY2|YE015_HUMAN Ankyrin repeat and death domain-containing... 39 0.019
sp|Q6AWW5|Y5262_ARATH Ankyrin repeat-containing protein At5g0262... 37 0.093
sp|P46683|YAR1_YEAST Ankyrin repeat-containing protein YAR1 OS=S... 35 0.35
sp|Q8BLD6|ANR55_MOUSE Ankyrin repeat domain-containing protein 5... 35 0.35
sp|Q554E7|ZDHC5_DICDI Putative ZDHHC-type palmitoyltransferase 5... 34 0.60
sp|Q9CWU2|ZDH13_MOUSE Probable palmitoyltransferase ZDHHC13 OS=M... 34 0.79
sp|Q6P6B7|ANR16_HUMAN Ankyrin repeat domain-containing protein 1... 34 0.79
sp|Q3KP44|ANR55_HUMAN Ankyrin repeat domain-containing protein 5... 33 1.0
sp|Q14DN9|YE015_MOUSE Ankyrin repeat and death domain-containing... 33 1.3
sp|Q1RHQ8|Y1025_RICBR Putative ankyrin repeat protein RBE_1025 O... 33 1.3
sp|O89019|INVS_MOUSE Inversin OS=Mus musculus GN=Invs PE=1 SV=2 33 1.3
sp|Q9Y283|INVS_HUMAN Inversin OS=Homo sapiens GN=INVS PE=1 SV=2 33 1.3
sp|Q6JAN1|INVS_CANFA Inversin OS=Canis familiaris GN=INVS PE=1 SV=1 33 1.3
sp|Q71S22|INVSA_XENLA Inversin-A OS=Xenopus laevis GN=invs-A PE=... 33 1.3
sp|P28492|GLSL_RAT Glutaminase liver isoform, mitochondrial OS=R... 33 1.3
sp|Q86XJ1|GA2L3_HUMAN GAS2-like protein 3 OS=Homo sapiens GN=GAS... 33 1.8
sp|Q8UVC3|INVS_CHICK Inversin OS=Gallus gallus GN=INVS PE=2 SV=2 32 2.3
sp|Q9HFE7|YNW5_SCHPO Ankyrin repeat-containing protein P16F5.05c... 32 3.0
sp|Q8IUH5|ZDH17_HUMAN Palmitoyltransferase ZDHHC17 OS=Homo sapie... 32 3.9
sp|Q05823|RN5A_HUMAN 2-5A-dependent ribonuclease OS=Homo sapiens... 32 3.9
sp|Q01317|NUC2_NEUCR Ankyrin repeat protein nuc-2 OS=Neurospora ... 32 3.9
sp|Q71S21|INVSB_XENLA Inversin-B OS=Xenopus laevis GN=invs-B PE=... 32 3.9
sp|Q571F8|GLSL_MOUSE Glutaminase liver isoform, mitochondrial OS... 32 3.9
sp|Q8NA70|FA47B_HUMAN Protein FAM47B OS=Homo sapiens GN=FAM47B P... 32 3.9
sp|Q09YK6|ASZ1_ATEGE Ankyrin repeat, SAM and basic leucine zippe... 32 3.9
sp|P59975|Y2664_MYCBO UPF0027 protein Mb2664 OS=Mycobacterium bo... 31 5.1
sp|P71930|Y2631_MYCTU UPF0027 protein Rv2631/MT2707 OS=Mycobacte... 31 5.1
sp|Q9J504|V231_FOWPV Putative ankyrin repeat protein FPV231 OS=F... 31 5.1
sp|Q9Z148|EHMT2_MOUSE Histone-lysine N-methyltransferase, H3 lys... 31 5.1
sp|Q96KQ7|EHMT2_HUMAN Histone-lysine N-methyltransferase, H3 lys... 31 5.1

>sp|A6NHY2|YE015_HUMAN Ankyrin repeat and death domain-containing
protein ENSP00000345065 OS=Homo sapiens PE=4 SV=2
Length = 467

Score = 39.3 bits (90), Expect = 0.019
Identities = 59/232 (25%), Positives = 105/232 (45%), Gaps = 29/232 (12%)
Frame = +2

Query: 17 DRDKRGDSFLHVAAKSGNLKVLQALKAFKPDDIDMARLLTNGERDCINSPGMYALLYDHR 196
++DK G++ LH+AAK G+ +Q L A D +M NGE +P ++ H
Sbjct: 136 EKDKGGNTALHLAAKHGHSPAVQVLLAQWQDINEMNE---NGE-----TPFFLSVEGGHE 187

Query: 197 EFFDELVTMG-------KVEITL---------SCIIKALLAELID-NPEIQPRLALFAST 325
E L+T G K+ I+ + ++ LL+E +D + +++P+ +
Sbjct: 188 ECSKVLLTAGSDTNIPNKLNISSLQIATRNGHASLVNFLLSENVDLHQKVEPKES----- 242

Query: 326 LPTYLALYAKKNCIFDFLL----ETDLLSLSQWDDEYNRTCLHWAVVDKRIDIVQKLCK- 490
P +L + + + LL + D+L+ Q +T LH A +++V+ L K
Sbjct: 243 -PLHLVVINNHITVVNSLLSAQHDIDILNQKQ------QTPLHVAADRGNVELVETLLKA 295

Query: 491 --DVKLWPGIQDRDGKTALQHAFEQKNH-----MMLEILSFKRVFKEHEEKL 625
D+K D+ GKTAL A + NH M+++ + +EH E +
Sbjct: 296 GCDLK----AVDKQGKTALAVA-SRSNHSLVVGMLIKAERYYAWREEHHESI 342


>sp|Q6AWW5|Y5262_ARATH Ankyrin repeat-containing protein At5g02620
OS=Arabidopsis thaliana GN=At5g02620 PE=1 SV=1
Length = 524

Score = 37.0 bits (84), Expect = 0.093
Identities = 47/203 (23%), Positives = 87/203 (42%), Gaps = 16/203 (7%)
Frame = +2

Query: 26 KRGDSFLHVAAKSGNLKVLQALKAFKPDDIDMARLLTNGERDCINSPGMYALLYDHREFF 205
K G H+AAK+GNL+VL L P+ ++ + + +++ A H E
Sbjct: 89 KNGFDAFHIAAKNGNLQVLDVLIEANPE---LSFTFDSSKTTALHT----AASQGHGEIV 141

Query: 206 DELVTMGKVEITLSCIIKA----------------LLAELIDNPEIQPRLALFASTLPTY 337
L+ G + L+ I ++ ++ +LI+ +
Sbjct: 142 CFLLDKG---VDLAAIARSNGKTALHSAARNGHTVIVKKLIEKKAGMVTRVDKKGQTALH 198

Query: 338 LALYAKKNCIFDFLLETDLLSLSQWDDEYNRTCLHWAVVDKRIDIVQKLCKDVKLWPGIQ 517
+A+ + I D L+E D ++ D++ N T LH AV R +IVQ + K ++
Sbjct: 199 MAVKGQNTEIVDVLMEADGSLINSADNKGN-TPLHIAVRKNRAEIVQTVLKYCEVSRVAV 257

Query: 518 DRDGKTALQHAFEQKNHMMLEIL 586
++ G+TAL A + H ++ +L
Sbjct: 258 NKSGETALDIAEKTGLHEIVPLL 280


>sp|P46683|YAR1_YEAST Ankyrin repeat-containing protein YAR1
OS=Saccharomyces cerevisiae GN=YAR1 PE=1 SV=1
Length = 200

Score = 35.0 bits (79), Expect = 0.35
Identities = 19/68 (27%), Positives = 38/68 (55%)
Frame = +2

Query: 389 DLLSLSQWDDEYNRTCLHWAVVDKRIDIVQKLCKDVKLWPGIQDRDGKTALQHAFEQKNH 568
DL + ++ T LHWA ++ ++D+V+ LC + + P I+++ G A+ FE +N
Sbjct: 81 DLKAFVNEVNKTGNTALHWASLNGKLDVVKLLCDEYEADPFIRNKFGHDAI---FEAENS 137

Query: 569 MMLEILSF 592
E+ ++
Sbjct: 138 GKEEVETY 145


>sp|Q8BLD6|ANR55_MOUSE Ankyrin repeat domain-containing protein 55
OS=Mus musculus GN=Ankrd55 PE=2 SV=1
Length = 626

Score = 35.0 bits (79), Expect = 0.35
Identities = 31/100 (31%), Positives = 41/100 (41%)
Frame = +2

Query: 287 PEIQPRLALFASTLPTYLALYAKKNCIFDFLLETDLLSLSQWDDEYNRTCLHWAVVDKRI 466
P+ RL L A+T + L LL+ LS D T LHWA R
Sbjct: 122 PDKNGRLPLHAATAEPDVRLLI-------VLLQQSSLSEINHQDTEGMTPLHWAAFHNRP 174

Query: 467 DIVQKLCKDVKLWPGIQDRDGKTALQHAFEQKNHMMLEIL 586
Q L K P + D+D KTAL A + N ++ I+
Sbjct: 175 QHTQMLLKK-GADPTLVDKDFKTALHWAVQSGNRILCSII 213


>sp|Q554E7|ZDHC5_DICDI Putative ZDHHC-type palmitoyltransferase 5
OS=Dictyostelium discoideum GN=DDB_G0275097 PE=3 SV=1
Length = 751

Score = 34.3 bits (77), Expect = 0.60
Identities = 19/63 (30%), Positives = 30/63 (47%), Gaps = 3/63 (4%)
Frame = +2

Query: 416 DEYNRTCLHWAVVDKRIDIVQKLCK---DVKLWPGIQDRDGKTALQHAFEQKNHMMLEIL 586
D RT HW + +V LC + I+D DGKTA Q A ++++ +++ L
Sbjct: 291 DIQGRTAFHWGCIKGHKQVVSMLCSFEGQDSIDKTIRDNDGKTAYQLAESKEHYEIIDYL 350

Query: 587 SFK 595
K
Sbjct: 351 DTK 353


>sp|Q9CWU2|ZDH13_MOUSE Probable palmitoyltransferase ZDHHC13 OS=Mus
musculus GN=Zdhhc13 PE=2 SV=2
Length = 622

Score = 33.9 bits (76), Expect = 0.79
Identities = 23/79 (29%), Positives = 40/79 (50%), Gaps = 1/79 (1%)
Frame = +2

Query: 398 SLSQWDDEYNRTCLHWAVVDKRIDIVQKLCKDVKLWPGIQDRDGKTALQHAFEQKNHMML 577
SLS D + T LHWAV + V KL + I++ G+T L A + KN ++
Sbjct: 208 SLSVVDKTHQNTPLHWAVAAGNVSAVDKLL-EAGSSLDIRNAKGETPLDMALQSKNQLIS 266

Query: 578 EILSFKRVFKEHEE-KLYR 631
+L + + +++ +L+R
Sbjct: 267 HMLRTEAKMRANKQFRLWR 285


>sp|Q6P6B7|ANR16_HUMAN Ankyrin repeat domain-containing protein 16
OS=Homo sapiens GN=ANKRD16 PE=2 SV=1
Length = 361

Score = 33.9 bits (76), Expect = 0.79
Identities = 46/186 (24%), Positives = 73/186 (39%), Gaps = 11/186 (5%)
Frame = +2

Query: 32 GDSFLHVAAKSGNLKVLQALKAFKPDDID---------MARLLTNGERDCINSPGMYALL 184
GD+ LH AA+ G+ VL L DI+ + + G RDC+ L
Sbjct: 37 GDTLLHCAARHGHRDVLAYLAEAWGMDIEATNRDYKRPLHEAASMGHRDCVR------YL 90

Query: 185 YDHREFFDELVTMGKVEITLSCIIKAL--LAELIDNPEIQPRLALFASTLPTYLALYAKK 358
D L + ++C K L + EL+++ P L ++A
Sbjct: 91 LGRGAAVDCLKKADWTPLMMACTRKNLGVIQELVEH-GANPLLKNKDGWNSFHIASREGD 149

Query: 359 NCIFDFLLETDLLSLSQWDDEYNRTCLHWAVVDKRIDIVQKLCKDVKLWPGIQDRDGKTA 538
I +LL T + + + RT LH A + ++ V+ L K + P +D G TA
Sbjct: 150 PLILQYLL-TVCPGAWKTESKIRRTPLHTAAMHGHLEAVKVLLKRCQYEPDYRDNCGVTA 208

Query: 539 LQHAFE 556
L A +
Sbjct: 209 LMDAIQ 214


>sp|Q3KP44|ANR55_HUMAN Ankyrin repeat domain-containing protein 55
OS=Homo sapiens GN=ANKRD55 PE=2 SV=2
Length = 613

Score = 33.5 bits (75), Expect = 1.0
Identities = 25/87 (28%), Positives = 36/87 (41%)
Frame = +2

Query: 326 LPTYLALYAKKNCIFDFLLETDLLSLSQWDDEYNRTCLHWAVVDKRIDIVQKLCKDVKLW 505
LP + A + LL+ +S D T LHWA + Q L K
Sbjct: 128 LPLHAATAEPDMRLLTVLLQQSNISEINHQDNEGMTPLHWAAFHNQPQHTQMLLKK-GAD 186

Query: 506 PGIQDRDGKTALQHAFEQKNHMMLEIL 586
P + D+D KTAL A + N ++ I+
Sbjct: 187 PTLVDKDFKTALHWAVQSGNRILCSII 213


>sp|Q14DN9|YE015_MOUSE Ankyrin repeat and death domain-containing
protein ENSP00000345065 homolog OS=Mus musculus PE=2
SV=1
Length = 464

Score = 33.1 bits (74), Expect = 1.3
Identities = 54/226 (23%), Positives = 104/226 (46%), Gaps = 23/226 (10%)
Frame = +2

Query: 17 DRDKRGDSFLHVAAKSGNLKVLQALKAFKPDDIDMARLLTNGERDCINSPGMYALLYDHR 196
++DK G++ LH+AA G+ +Q L + +++ + NGE +P + A++ H
Sbjct: 134 EKDKDGNTALHLAAMHGHSPAVQVLLT-QWSEVNESN--ENGE-----TPFLLAVVGGHE 185

Query: 197 EFFDELVTMGK-VEITLSCIIKALLAE------------LIDNPEIQPRLALFASTLPTY 337
E L+ G V I + AL L +N ++Q + + P +
Sbjct: 186 ECSRVLLAGGSDVNIPNKLNVSALQTATRNGHTALVNFLLGENADLQQQKE--SKEPPLH 243

Query: 338 LALYAKKNCIFDFLL---ETDLLSLSQWDDEYNRTCLHWAVVDKRIDIVQKLCK---DVK 499
LA+ + + + L + D+L D+ +T LH A +++V+ L K ++K
Sbjct: 244 LAVINNRPAVVNSLSARHDVDVL------DQRRQTPLHVAADLGNVELVETLLKAGCNLK 297

Query: 500 LWPGIQDRDGKTALQHAFEQKNHMMLEIL-SFKRVF---KEHEEKL 625
I D+ GKTAL A ++ +++++L +R + +EH E +
Sbjct: 298 ----ITDKQGKTALAVAARSQHSLVVDMLIKAERYYAWREEHRESI 339


>sp|Q1RHQ8|Y1025_RICBR Putative ankyrin repeat protein RBE_1025
OS=Rickettsia bellii (strain RML369-C) GN=RBE_1025 PE=4
SV=1
Length = 225

Score = 33.1 bits (74), Expect = 1.3
Identities = 25/82 (30%), Positives = 35/82 (42%), Gaps = 3/82 (3%)
Frame = +2

Query: 311 LFASTLPTYLALYAKKN---CIFDFLLETDLLSLSQWDDEYNRTCLHWAVVDKRIDIVQK 481
+F L L L A+ N + L +T DE +T LHWAV++ I
Sbjct: 1 MFDDKLSKDLLLSARANNNLAVIRILQDTTSAINPNLQDENGKTALHWAVINLNPLITCY 60

Query: 482 LCKDVKLWPGIQDRDGKTALQH 547
+ K K+ IQD G T L +
Sbjct: 61 ILKIEKVNVNIQDNTGFTVLHY 82


tr_hit_id Q22CW3
Definition tr|Q22CW3|Q22CW3_TETTH Putative uncharacterized protein OS=Tetrahymena thermophila SB210
Align length 206
Score (bit) 48.1
E-value 0.0005
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= DK950434|Adiantum capillus-veneris mRNA, clone:
TST38A01NGRL0008_K09, 5'
(663 letters)

Database: uniprot_trembl.fasta
7,341,751 sequences; 2,391,615,440 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

tr|Q22CW3|Q22CW3_TETTH Putative uncharacterized protein OS=Tetra... 48 5e-04
tr|B3S9D3|B3S9D3_TRIAD Putative uncharacterized protein OS=Trich... 46 0.002
tr|A2FWZ1|A2FWZ1_TRIVA Putative uncharacterized protein OS=Trich... 45 0.004
tr|A2E850|A2E850_TRIVA Putative uncharacterized protein OS=Trich... 45 0.005
tr|A2G0N5|A2G0N5_TRIVA Putative uncharacterized protein OS=Trich... 44 0.009
tr|B3ESB9|B3ESB9_AMOA5 Putative uncharacterized protein OS=Amoeb... 44 0.012
tr|A2FK61|A2FK61_TRIVA Ankyrin repeat protein, putative OS=Trich... 44 0.012
tr|B0Y996|B0Y996_ASPFC Ankyrin repeat protein OS=Aspergillus fum... 44 0.012
tr|B3CLW4|B3CLW4_WOLPP Ankyrin repeat domain protein OS=Wolbachi... 42 0.026
tr|B6Y682|B6Y682_9RICK Ankyrin repeat domain protein OS=Wolbachi... 42 0.026
tr|Q8V3F4|Q8V3F4_SWPV SPV142 ankyrin repeat protein OS=Swinepox ... 42 0.034
tr|A3LPD6|A3LPD6_PICST Ankyrin repeat-containing protein (Fragme... 42 0.034
tr|A8B9E2|A8B9E2_GIALA Kinase, NEK OS=Giardia lamblia ATCC 50803... 42 0.044
tr|A2DTB1|A2DTB1_TRIVA Ankyrin repeat protein, putative OS=Trich... 42 0.044
tr|A2DQP5|A2DQP5_TRIVA Ankyrin repeat protein, putative OS=Trich... 42 0.044
tr|Q2XW28|Q2XW28_GLOMM Relish OS=Glossina morsitans morsitans PE... 41 0.058
tr|Q4WBY1|Q4WBY1_ASPFU Pfs, NB-ARC and Ankyrin domain protein OS... 41 0.075
tr|B0Y910|B0Y910_ASPFC Pfs, NB-ARC and Ankyrin domain protein OS... 41 0.075
tr|Q7Q8L0|Q7Q8L0_ANOGA AGAP008559-PA (Fragment) OS=Anopheles gam... 40 0.098
tr|Q16Z25|Q16Z25_AEDAE Ion channel nompc (Fragment) OS=Aedes aeg... 40 0.098
tr|Q16PD7|Q16PD7_AEDAE Ion channel nompc OS=Aedes aegypti GN=AAE... 40 0.098
tr|B0W065|B0W065_CULQU Ion channel nompc OS=Culex quinquefasciat... 40 0.098
tr|Q2TZT8|Q2TZT8_ASPOR Ankyrin OS=Aspergillus oryzae GN=AO090011... 40 0.098
tr|B8NBG2|B8NBG2_ASPFL Ankyrin, putative OS=Aspergillus flavus N... 40 0.098
tr|A2DA40|A2DA40_TRIVA Putative uncharacterized protein OS=Trich... 40 0.13
tr|A8NAH5|A8NAH5_COPC7 Putative uncharacterized protein OS=Copri... 40 0.13
tr|A6S2T9|A6S2T9_BOTFB Putative uncharacterized protein OS=Botry... 40 0.13
tr|A1D8J5|A1D8J5_NEOFI Ankyrin repeat protein OS=Neosartorya fis... 40 0.13
tr|A2FNS2|A2FNS2_TRIVA Ankyrin repeat protein, putative OS=Trich... 40 0.17
tr|A2EFB2|A2EFB2_TRIVA Putative uncharacterized protein OS=Trich... 40 0.17

>tr|Q22CW3|Q22CW3_TETTH Putative uncharacterized protein
OS=Tetrahymena thermophila SB210 GN=TTHERM_01014730 PE=4
SV=1
Length = 358

Score = 48.1 bits (113), Expect = 5e-04
Identities = 53/206 (25%), Positives = 96/206 (46%), Gaps = 14/206 (6%)
Frame = +2

Query: 11 VYDRDKRGDSFLHVAAKSGNLKVLQALKAFKPDDIDMARLLTNGERDCINSPGMYALLYD 190
++ ++ G++ LH+AA NL +A+K ++ D+ +G+ +P YA++
Sbjct: 118 IFAPNEDGNTLLHIAAFYRNL---EAVKFALENNSDVNACNKDGD-----TPLFYAIVKQ 169

Query: 191 HREFFDELVTMGKVEITLSC--IIKALLAELIDNPEIQPRLALFASTL-----------P 331
E + ++ G ++ + + A + N EI + LF TL P
Sbjct: 170 SPEIIEYFLSKGANDLVKNNNGLYPIHEATVTGNIEI---IKLFEKTLTQVRNSKPDLDP 226

Query: 332 TYLALYAKKNCIFDFLLETDLLSLSQWDDEYNRTCLHWAVVDKRIDIVQ-KLCKDVKLWP 508
+LA + + D+LLE + ++ D+ +T LH+AV++K+ + + L K K P
Sbjct: 227 IHLAAQLESTDVLDYLLEKNPSFVNLPDNSNQQTPLHYAVIEKKYECARYLLLKGAK--P 284

Query: 509 GIQDRDGKTALQHAFEQKNHMMLEIL 586
IQD+ G T L A K+ M IL
Sbjct: 285 NIQDKFGNTPLHFATLNKDLDMCYIL 310


>tr|B3S9D3|B3S9D3_TRIAD Putative uncharacterized protein
OS=Trichoplax adhaerens GN=TRIADDRAFT_60865 PE=4 SV=1
Length = 382

Score = 45.8 bits (107), Expect = 0.002
Identities = 53/207 (25%), Positives = 85/207 (41%), Gaps = 18/207 (8%)
Frame = +2

Query: 20 RDKRGDSFLHVAAKSGNLKVLQAL-KAFKP-------------DDIDMARLLTNGERDCI 157
RD G + LH AA+S N K+L+ L A +P ++I R NGE++C
Sbjct: 26 RDNDGKTALHYAAESSNTKILEELITAIRPQKCMELEDTIAQEEEIQKIRGTRNGEKEC- 84

Query: 158 NSPGMYALLYDHREFFDELVTMGKVEITLSCIIKALLAELIDNPEIQPRLALFAST--LP 331
M L D R+ E +I LL + D A ++T L
Sbjct: 85 ----MQGLRIDQRKL---------AESQQQAVINFLLVQDNDGKTALHYAAESSNTKILE 131

Query: 332 TYLALYAKKNCIF--DFLLETDLLSLSQWDDEYNRTCLHWAVVDKRIDIVQKLCKDVKLW 505
+ + CI D +++ + + + + C+ +D+R + + + V
Sbjct: 132 ELITAIRPQKCIELEDTIVQEEEIQKIKGTRNGEKECMQGLRIDQR-KLAESQQQAVSNL 190

Query: 506 PGIQDRDGKTALQHAFEQKNHMMLEIL 586
I+D DGKTAL +A E N +LE L
Sbjct: 191 LQIRDNDGKTALHYAAESSNTKILEEL 217


>tr|A2FWZ1|A2FWZ1_TRIVA Putative uncharacterized protein
OS=Trichomonas vaginalis G3 GN=TVAG_376240 PE=4 SV=1
Length = 546

Score = 45.1 bits (105), Expect = 0.004
Identities = 24/69 (34%), Positives = 38/69 (55%), Gaps = 4/69 (5%)
Frame = +2

Query: 392 LLSLSQWD----DEYNRTCLHWAVVDKRIDIVQKLCKDVKLWPGIQDRDGKTALQHAFEQ 559
LL++ +D D Y T LH+AV + +DI++ +C + P I+D KT AFE+
Sbjct: 321 LLTVKSFDPNIQDNYGNTLLHYAVQYQNLDIIKTVCSLPNINPNIKDESNKTPFLLAFER 380

Query: 560 KNHMMLEIL 586
KN ++ L
Sbjct: 381 KNPEIINCL 389



Score = 43.5 bits (101), Expect = 0.012
Identities = 45/207 (21%), Positives = 87/207 (42%), Gaps = 18/207 (8%)
Frame = +2

Query: 20 RDKRGDSFLHVAAKSGNLKVLQALKAFKPDDIDMARLLTNGERDCINSPGMYALLYDHRE 199
+D G++ LH A + NL +++ + + + N + + +P + A + E
Sbjct: 332 QDNYGNTLLHYAVQYQNLDIIKTV-------CSLPNINPNIKDESNKTPFLLAFERKNPE 384

Query: 200 FFDELVTMGKVEITLSC------------------IIKALLAELIDNPEIQPRLALFAST 325
+ L+T+ ++ + II +LL +P IQ + + T
Sbjct: 385 IINCLLTVKNIDPNIQDNEGNTLLHYAVQYQKLPEIINSLLTVKNIDPNIQDK---YGRT 441

Query: 326 LPTYLALYAKKNCIFDFLLETDLLSLSQWDDEYNRTCLHWAVVDKRIDIVQKLCKDVKLW 505
Y K I + L+ + + D+ +T LH AV + +DI++ +C +
Sbjct: 442 FLHNAVYYQKLPEIINSLITVKNIDPNIQDNN-GQTLLHHAVQYQNLDIIKTVCSLPNIN 500

Query: 506 PGIQDRDGKTALQHAFEQKNHMMLEIL 586
P I+D+ KT AFE+KN ++ L
Sbjct: 501 PNIKDKSNKTPFLLAFERKNTEIINCL 527


>tr|A2E850|A2E850_TRIVA Putative uncharacterized protein
OS=Trichomonas vaginalis G3 GN=TVAG_498620 PE=4 SV=1
Length = 689

Score = 44.7 bits (104), Expect = 0.005
Identities = 53/202 (26%), Positives = 81/202 (40%), Gaps = 4/202 (1%)
Frame = +2

Query: 2 PDQVYDRDKRGDSFLHVAAKSGNLKVLQALKAFKPDDIDMARLLTNGERDCINSPGMYAL 181
PD ++ + +G + L VAA G L FK ID+ N E N+P A+
Sbjct: 338 PDTIFKANHKGRNPLAVAASWGKTDSLDFF--FKVKGIDLCSP-DNEE----NTPLHLAI 390

Query: 182 LYDHREFFDELVTMGKVEITLSCIIKALLAELIDNPEIQPRLALFASTLPTYLALYAKKN 361
H EF L+ +VEI A P LA+ N
Sbjct: 391 YGGHHEFAKALLRTKEVEINAQND---------------------AGETPLMLAIV---N 426

Query: 362 CIFDFLLETDLLSLSQWD----DEYNRTCLHWAVVDKRIDIVQKLCKDVKLWPGIQDRDG 529
+ D + +D+ S S+WD D Y RT L A + + D+VQ + + ++ P + D DG
Sbjct: 427 WLRDVI--SDIFSTSEWDPNLADNYGRTALMLAAKEGQADVVQVILSNPRIDPSVTDNDG 484

Query: 530 KTALQHAFEQKNHMMLEILSFK 595
A + +++IL K
Sbjct: 485 WGPQHFAAFLRTPEVMKILESK 506


>tr|A2G0N5|A2G0N5_TRIVA Putative uncharacterized protein
OS=Trichomonas vaginalis G3 GN=TVAG_222290 PE=4 SV=1
Length = 391

Score = 43.9 bits (102), Expect = 0.009
Identities = 22/68 (32%), Positives = 39/68 (57%)
Frame = +2

Query: 386 TDLLSLSQWDDEYNRTCLHWAVVDKRIDIVQKLCKDVKLWPGIQDRDGKTALQHAFEQKN 565
T+ +++ +++ N + LH+A + R D+ + LCK + IQD GKT L A E KN
Sbjct: 320 TEFFDINEVNND-NSSALHFAAYNDRADVCEFLCKLPNIQKNIQDSSGKTPLMIAKENKN 378

Query: 566 HMMLEILS 589
+++L+
Sbjct: 379 QKCIDVLT 386


>tr|B3ESB9|B3ESB9_AMOA5 Putative uncharacterized protein
OS=Amoebophilus asiaticus (strain 5a2) GN=Aasi_0738 PE=4
SV=1
Length = 1005

Score = 43.5 bits (101), Expect = 0.012
Identities = 49/170 (28%), Positives = 82/170 (48%), Gaps = 3/170 (1%)
Frame = +2

Query: 161 SPGMYALLYDHREFFDELVTMGKVEITLSCIIKALLAELIDNPEIQPRLALFASTLPTYL 340
SPG+ L +F + +T E+ IIK L + +N + T T+L
Sbjct: 139 SPGLINKLKRVNDFLNMHIT----ELIKEKIIKDLYEKYDENKD----------TNATFL 184

Query: 341 ALYAKKNCI--FDFLLETDLLSLSQWDDEYNRTCLHWAVVDKRIDIVQKL-CKDVKLWPG 511
L +K I FL+ + L+ DEY++T LH AV ++ I++V L K+ +
Sbjct: 185 QLAVRKGNIEAAKFLIGKNSLNNR---DEYHKTLLHEAVTNEHINMVVFLIAKEADI--N 239

Query: 512 IQDRDGKTALQHAFEQKNHMMLEILSFKRVFKEHEEKLYRDREVYVQALN 661
+D+DG T L AFE KN ++++L K+ K ++ + R ++ LN
Sbjct: 240 TKDKDGNTPLDLAFEHKNIEIMKLL-LKKEGKFRDDADDKKRSHLLKILN 288


>tr|A2FK61|A2FK61_TRIVA Ankyrin repeat protein, putative
OS=Trichomonas vaginalis G3 GN=TVAG_321380 PE=4 SV=1
Length = 345

Score = 43.5 bits (101), Expect = 0.012
Identities = 22/61 (36%), Positives = 37/61 (60%)
Frame = +2

Query: 416 DEYNRTCLHWAVVDKRIDIVQKLCKDVKLWPGIQDRDGKTALQHAFEQKNHMMLEILSFK 595
D +T LH+AV+ +++V+ LC ++ +D DG TAL +A E N +++ILS K
Sbjct: 285 DYQKKTPLHYAVLINNVEVVKYLCSLPEIDINAEDNDGFTALHYAVENDNVEIIDILSKK 344

Query: 596 R 598
+
Sbjct: 345 K 345


>tr|B0Y996|B0Y996_ASPFC Ankyrin repeat protein OS=Aspergillus
fumigatus (strain CEA10 / CBS 144.89 / FGSC A1163)
GN=AFUB_080240 PE=4 SV=1
Length = 1508

Score = 43.5 bits (101), Expect = 0.012
Identities = 27/91 (29%), Positives = 45/91 (49%)
Frame = +2

Query: 314 FASTLPTYLALYAKKNCIFDFLLETDLLSLSQWDDEYNRTCLHWAVVDKRIDIVQKLCKD 493
F + T +A Y I + LL+T+ + + D EY RT L WA V+ IV+ L
Sbjct: 803 FPDSNDTLIASYLGLTAIVEILLQTEDIDVESKDSEYGRTPLSWAAVNGHEGIVKLLLDT 862

Query: 494 VKLWPGIQDRDGKTALQHAFEQKNHMMLEIL 586
++ +D G+T L A E + ++++L
Sbjct: 863 GRVDVDSKDSGGQTPLSWAAENGHEGIVKLL 893



Score = 37.7 bits (86), Expect = 0.64
Identities = 44/187 (23%), Positives = 81/187 (43%)
Frame = +2

Query: 26 KRGDSFLHVAAKSGNLKVLQALKAFKPDDIDMARLLTNGERDCINSPGMYALLYDHREFF 205
K G + L AA++G+ +++ L +D R+ + + +P +A H+E
Sbjct: 1078 KYGRTPLSWAAENGHEGIVKLL-------LDTGRVDLDSKDSDGRTPLSWAARRGHKEIV 1130

Query: 206 DELVTMGKVEITLSCIIKALLAELIDNPEIQPRLALFASTLPTYLALYAKKNCIFDFLLE 385
L+ G+V++ D+ + R L ++ AL + I LL+
Sbjct: 1131 KLLLDTGRVDL--------------DSKDSDGRPPL------SWAALSGHEG-IVKLLLD 1169

Query: 386 TDLLSLSQWDDEYNRTCLHWAVVDKRIDIVQKLCKDVKLWPGIQDRDGKTALQHAFEQKN 565
T + + D EY RT L WA V+ IV+ L ++ +D G+T L A E +
Sbjct: 1170 TGRVDVESKDSEYGRTPLSWAAVNGHEGIVKLLLDTGRVDVDSKDSGGQTPLSWAAENGH 1229

Query: 566 HMMLEIL 586
++++L
Sbjct: 1230 EGIVKLL 1236



Score = 34.3 bits (77), Expect = 7.1
Identities = 21/74 (28%), Positives = 37/74 (50%)
Frame = +2

Query: 365 IFDFLLETDLLSLSQWDDEYNRTCLHWAVVDKRIDIVQKLCKDVKLWPGIQDRDGKTALQ 544
I LL+T + + D +Y RT L WA + IV+ L ++ +D DG+T L
Sbjct: 1060 IVKLLLDTGRVDVESKDSKYGRTPLSWAAENGHEGIVKLLLDTGRVDLDSKDSDGRTPLS 1119

Query: 545 HAFEQKNHMMLEIL 586
A + + ++++L
Sbjct: 1120 WAARRGHKEIVKLL 1133


>tr|B3CLW4|B3CLW4_WOLPP Ankyrin repeat domain protein OS=Wolbachia
pipientis subsp. Culex pipiens (strain wPip) GN=WP0774
PE=4 SV=1
Length = 554

Score = 42.4 bits (98), Expect = 0.026
Identities = 21/43 (48%), Positives = 26/43 (60%)
Frame = +2

Query: 413 DDEYNRTCLHWAVVDKRIDIVQKLCKDVKLWPGIQDRDGKTAL 541
D+ + RT LHWA + +IV+ L W IQDRDGKTAL
Sbjct: 114 DERHGRTALHWAAYHDKFEIVKLLVNKGADW-NIQDRDGKTAL 155


>tr|B6Y682|B6Y682_9RICK Ankyrin repeat domain protein OS=Wolbachia
endosymbiont of Culex quinquefasciatus JHB GN=C1A_352
PE=4 SV=1
Length = 1058

Score = 42.4 bits (98), Expect = 0.026
Identities = 21/43 (48%), Positives = 26/43 (60%)
Frame = +2

Query: 413 DDEYNRTCLHWAVVDKRIDIVQKLCKDVKLWPGIQDRDGKTAL 541
D+ + RT LHWA + +IV+ L W IQDRDGKTAL
Sbjct: 618 DERHGRTALHWAAYHDKFEIVKLLVNKGADW-NIQDRDGKTAL 659