DK950443
Clone id TST38A01NGRL0008_K18
Library
Length 656
Definition Adiantum capillus-veneris mRNA. clone: TST38A01NGRL0008_K18. 5' end sequence.
Accession
Tissue type prothallia
Developmental stage gametophyte
Contig ID
Sequence
ATCAATTAGACCTAATTGTAGATGAGAAGTTGCTATGGACAGCGTATGGACTTCGATCAC
TAGCAACTACAAGTTCAATGTACATGGCACGCAACACAGAGCATGATCCGCCTTACTGGA
GAGGCCCTGTGGATCAATATAAACTACCTCGTCCTTGGTGCTCTTCATCGCTACTCCCAA
GAACCGGGACCGTACAAGGATGCTGCATCGAGAATCTATACACAACTACGCGACAACTTA
ATAAGGAATGTCGTCGAGTCGTACAATGAGAGTGGCTATCTATGGGAACAGTATGACAAT
GCTGCCAATGGCAGAGGCAAAGGAGCACATCCATTCACAGGGTGGACTTCGTTAATTCTT
TTGGTTATGGCAGAACAATATTGAACTCCAATGTACTCTGCATCTCAGCCACTTGAGGTC
AATCCAAGCATTGGATGGACTACCACCTGTTTGGAATTTAAGCCGTCGACAAGGTCAACC
CTAGGGGCTCCTCTCTTTTGAGCTCTGGTTGTATGATCAGCGGGCATTCAATGGCAGAGG
ATGAGATGATGAAGACTTCCATCTAANAGGGCCTCAATCTGAAGGTTCGAGGGTACAATC
ATCATCTTGATAAACTGTGCAACATTAGGCATTTTTTATCGCCTGCAAAGCAAGTG
■■Homology search results ■■ -
sp_hit_id Q19426
Definition sp|Q19426|GCS1_CAEEL Probable mannosyl-oligosaccharide glucosidase OS=Caenorhabditis elegans
Align length 83
Score (bit) 106.0
E-value 1.0e-36
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= DK950443|Adiantum capillus-veneris mRNA, clone:
TST38A01NGRL0008_K18, 5'
(656 letters)

Database: uniprot_sprot.fasta
412,525 sequences; 148,809,765 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

sp|Q19426|GCS1_CAEEL Probable mannosyl-oligosaccharide glucosida... 106 1e-36
sp|Q80UM7|GCS1_MOUSE Mannosyl-oligosaccharide glucosidase OS=Mus... 110 3e-36
sp|O88941|GCS1_RAT Mannosyl-oligosaccharide glucosidase OS=Rattu... 109 8e-36
sp|Q13724|GCS1_HUMAN Mannosyl-oligosaccharide glucosidase OS=Hom... 101 7e-34
sp|O14255|GCS1_SCHPO Probable mannosyl-oligosaccharide glucosida... 89 1e-21
sp|P53008|CWH41_YEAST Mannosyl-oligosaccharide glucosidase OS=Sa... 62 5e-11
sp|A8J4S9|TREA_APIME Trehalase OS=Apis mellifera PE=1 SV=1 36 0.20
sp|Q9HXF7|NDPA_PSEAE Nucleoid-associated protein ndpA OS=Pseudom... 31 6.5
sp|Q02GN4|NDPA_PSEAB Nucleoid-associated protein ndpA OS=Pseudom... 31 6.5
sp|A6V9R6|NDPA_PSEA7 Nucleoid-associated protein ndpA OS=Pseudom... 31 6.5
sp|A4XY81|NDPA_PSEMY Nucleoid-associated protein ndpA OS=Pseudom... 30 8.5
sp|Q2V414|FBL37_ARATH F-box/LRR-repeat protein At2g40920 OS=Arab... 30 8.5

>sp|Q19426|GCS1_CAEEL Probable mannosyl-oligosaccharide glucosidase
OS=Caenorhabditis elegans GN=F13H10.4 PE=1 SV=2
Length = 796

Score = 106 bits (265), Expect(2) = 1e-36
Identities = 41/83 (49%), Positives = 65/83 (78%)
Frame = +1

Query: 127 LWININYLVLGALHRYSQEPGPYKDAASRIYTQLRDNLIRNVVESYNESGYLWEQYDNAA 306
+WIN+NY+VL +L Y+ +PGPY++ A I+++LR NL++N+ + ++G+LWE YD+
Sbjct: 711 IWINVNYMVLSSLRHYADQPGPYRENAENIFSELRANLVKNLATQFQKTGFLWENYDD-R 769

Query: 307 NGRGKGAHPFTGWTSLILLVMAE 375
G G+G HPFTGW+SLILL+M++
Sbjct: 770 TGEGRGCHPFTGWSSLILLIMSD 792



Score = 67.8 bits (164), Expect(2) = 1e-36
Identities = 29/40 (72%), Positives = 33/40 (82%)
Frame = +3

Query: 6 LDLIVDEKLLWTAYGLRSLATTSSMYMARNTEHDPPYWRG 125
LD I D K+LWT YGLRS++ +S YMARNTEHDPPYWRG
Sbjct: 670 LDKIRDPKILWTNYGLRSISRSSPYYMARNTEHDPPYWRG 709


>sp|Q80UM7|GCS1_MOUSE Mannosyl-oligosaccharide glucosidase OS=Mus
musculus GN=Gcs1 PE=2 SV=1
Length = 834

Score = 110 bits (276), Expect(2) = 3e-36
Identities = 48/86 (55%), Positives = 65/86 (75%)
Frame = +1

Query: 124 ALWININYLVLGALHRYSQEPGPYKDAASRIYTQLRDNLIRNVVESYNESGYLWEQYDNA 303
A+W+NINYL LGALH Y GP+K A+++Y +LR N++RNV + Y +G+LWEQY +
Sbjct: 750 AVWLNINYLALGALHHYGHVEGPHKVQAAKLYHELRANVVRNVRQQYQATGFLWEQYSD- 808

Query: 304 ANGRGKGAHPFTGWTSLILLVMAEQY 381
+GRG G PF GWTSL+LL+MAE+Y
Sbjct: 809 QDGRGMGCRPFQGWTSLVLLIMAEEY 834



Score = 62.0 bits (149), Expect(2) = 3e-36
Identities = 25/42 (59%), Positives = 32/42 (76%)
Frame = +3

Query: 6 LDLIVDEKLLWTAYGLRSLATTSSMYMARNTEHDPPYWRGPV 131
LD++ D + LW+ +GLRSL+ +S Y RNTEHDPPYWRG V
Sbjct: 710 LDVLADSRHLWSPFGLRSLSASSLFYKQRNTEHDPPYWRGAV 751


>sp|O88941|GCS1_RAT Mannosyl-oligosaccharide glucosidase OS=Rattus
norvegicus GN=Gcs1 PE=1 SV=1
Length = 834

Score = 109 bits (272), Expect(2) = 8e-36
Identities = 47/86 (54%), Positives = 65/86 (75%)
Frame = +1

Query: 124 ALWININYLVLGALHRYSQEPGPYKDAASRIYTQLRDNLIRNVVESYNESGYLWEQYDNA 303
A+W+NINYL LGALH Y + GP+K A+++Y +LR N++ NV + Y +G+LWEQY +
Sbjct: 750 AVWLNINYLALGALHHYGRVEGPHKVQAAKLYRELRANVVSNVRQQYQATGFLWEQYSD- 808

Query: 304 ANGRGKGAHPFTGWTSLILLVMAEQY 381
+GRG G PF GWTSL+LL+MAE+Y
Sbjct: 809 QDGRGMGCRPFQGWTSLVLLIMAEEY 834



Score = 62.0 bits (149), Expect(2) = 8e-36
Identities = 25/42 (59%), Positives = 32/42 (76%)
Frame = +3

Query: 6 LDLIVDEKLLWTAYGLRSLATTSSMYMARNTEHDPPYWRGPV 131
LD++ D + LW+ +GLRSL+ +S Y RNTEHDPPYWRG V
Sbjct: 710 LDVLADSRHLWSPFGLRSLSASSLFYKQRNTEHDPPYWRGAV 751


>sp|Q13724|GCS1_HUMAN Mannosyl-oligosaccharide glucosidase OS=Homo
sapiens GN=GCS1 PE=1 SV=5
Length = 837

Score = 101 bits (251), Expect(2) = 7e-34
Identities = 44/86 (51%), Positives = 61/86 (70%)
Frame = +1

Query: 124 ALWININYLVLGALHRYSQEPGPYKDAASRIYTQLRDNLIRNVVESYNESGYLWEQYDNA 303
A+W+N+NYL LGALH Y GP++ A++++ +LR N++ NV Y +G+LWEQY +
Sbjct: 753 AVWLNVNYLALGALHHYGHLEGPHQARAAKLHGELRANVVGNVWRQYQATGFLWEQYSD- 811

Query: 304 ANGRGKGAHPFTGWTSLILLVMAEQY 381
+GRG G PF GWTSL+LL MAE Y
Sbjct: 812 RDGRGMGCRPFHGWTSLVLLAMAEDY 837



Score = 63.5 bits (153), Expect(2) = 7e-34
Identities = 26/42 (61%), Positives = 33/42 (78%)
Frame = +3

Query: 6 LDLIVDEKLLWTAYGLRSLATTSSMYMARNTEHDPPYWRGPV 131
LD++ D + LW+ +GLRSLA +SS Y RN+EHDPPYWRG V
Sbjct: 713 LDILADSRHLWSPFGLRSLAASSSFYGQRNSEHDPPYWRGAV 754


>sp|O14255|GCS1_SCHPO Probable mannosyl-oligosaccharide glucosidase
OS=Schizosaccharomyces pombe GN=SPAC6G10.09 PE=2 SV=1
Length = 808

Score = 89.0 bits (219), Expect(2) = 1e-21
Identities = 39/86 (45%), Positives = 60/86 (69%), Gaps = 1/86 (1%)
Frame = +1

Query: 127 LWININYLVLGALHR-YSQEPGPYKDAASRIYTQLRDNLIRNVVESYNESGYLWEQYDNA 303
+WIN+NYL+L +L++ Y PGP ++ A IY +LR N++ NV E++ ++G WEQYD
Sbjct: 724 IWINMNYLILSSLYQNYINTPGPNQNLARSIYEELRTNVVNNVFENWRQTGIFWEQYD-P 782

Query: 304 ANGRGKGAHPFTGWTSLILLVMAEQY 381
G+G+ FTGWTSL++ +M+E Y
Sbjct: 783 TTGKGQRTKDFTGWTSLVVNIMSENY 808



Score = 34.7 bits (78), Expect(2) = 1e-21
Identities = 18/42 (42%), Positives = 24/42 (57%)
Frame = +3

Query: 6 LDLIVDEKLLWTAYGLRSLATTSSMYMARNTEHDPPYWRGPV 131
L LI DE LW+ YG+RSL + + +Y YWRGP+
Sbjct: 688 LKLIRDENELWSPYGIRSL-SMNDVYFGTGEN----YWRGPI 724


>sp|P53008|CWH41_YEAST Mannosyl-oligosaccharide glucosidase
OS=Saccharomyces cerevisiae GN=CWH41 PE=1 SV=1
Length = 833

Score = 61.6 bits (148), Expect(2) = 5e-11
Identities = 31/85 (36%), Positives = 48/85 (56%), Gaps = 4/85 (4%)
Frame = +1

Query: 127 LWININYLVLGALHRYSQEP----GPYKDAASRIYTQLRDNLIRNVVESYNESGYLWEQY 294
+W+NINYL L A+ Y E A ++Y L+ NL N+ + + E GY +E Y
Sbjct: 747 IWMNINYLCLDAMRYYYPEVILDVAGEASNAKKLYQSLKINLSNNIYKVWEEQGYCYENY 806

Query: 295 DNAANGRGKGAHPFTGWTSLILLVM 369
+ +G G GA FTGWT+L++ ++
Sbjct: 807 -SPIDGHGTGAEHFTGWTALVVNIL 830



Score = 26.2 bits (56), Expect(2) = 5e-11
Identities = 13/40 (32%), Positives = 21/40 (52%)
Frame = +3

Query: 12 LIVDEKLLWTAYGLRSLATTSSMYMARNTEHDPPYWRGPV 131
L+ D + +++ YGL SL+ + D YWRGP+
Sbjct: 713 LMSDPEKIFSDYGLLSLSRQDDYF-----GKDENYWRGPI 747


>sp|A8J4S9|TREA_APIME Trehalase OS=Apis mellifera PE=1 SV=1
Length = 626

Score = 35.8 bits (81), Expect = 0.20
Identities = 20/89 (22%), Positives = 48/89 (53%), Gaps = 5/89 (5%)
Frame = +1

Query: 130 WININYLVLGALHRYSQEPGPYKDAASRIYTQLRDNLIRNVVESYNESGYLWEQYDNAAN 309
W + Y V+ AL++ +++P A R+ ++ + +R+ ++YNE+ ++E+YD +
Sbjct: 486 WPPLQYFVIMALNK-TEDPW-----AQRLAYEISERWVRSNYKAYNETHSMFEKYDATVS 539

Query: 310 GRGKGAHPFT-----GWTSLILLVMAEQY 381
G G + GW++ +++ + +Y
Sbjct: 540 GGHGGGGEYEVQLGFGWSNGVIMDLLNRY 568


>sp|Q9HXF7|NDPA_PSEAE Nucleoid-associated protein ndpA
OS=Pseudomonas aeruginosa GN=ndpA PE=3 SV=1
Length = 334

Score = 30.8 bits (68), Expect = 6.5
Identities = 14/42 (33%), Positives = 23/42 (54%)
Frame = +1

Query: 220 TQLRDNLIRNVVESYNESGYLWEQYDNAANGRGKGAHPFTGW 345
+Q +NL+ ++ ESYN W + + GA+PF+GW
Sbjct: 32 SQAIENLLADLNESYNAKNKAWGFFQGES-----GAYPFSGW 68


>sp|Q02GN4|NDPA_PSEAB Nucleoid-associated protein ndpA
OS=Pseudomonas aeruginosa (strain UCBPP-PA14) GN=ndpA
PE=3 SV=1
Length = 338

Score = 30.8 bits (68), Expect = 6.5
Identities = 14/42 (33%), Positives = 23/42 (54%)
Frame = +1

Query: 220 TQLRDNLIRNVVESYNESGYLWEQYDNAANGRGKGAHPFTGW 345
+Q +NL+ ++ ESYN W + + GA+PF+GW
Sbjct: 32 SQAIENLLADLNESYNAKNKAWGFFQGES-----GAYPFSGW 68


>sp|A6V9R6|NDPA_PSEA7 Nucleoid-associated protein ndpA
OS=Pseudomonas aeruginosa (strain PA7) GN=ndpA PE=3 SV=1
Length = 340

Score = 30.8 bits (68), Expect = 6.5
Identities = 14/42 (33%), Positives = 23/42 (54%)
Frame = +1

Query: 220 TQLRDNLIRNVVESYNESGYLWEQYDNAANGRGKGAHPFTGW 345
+Q +NL+ ++ ESYN W + + GA+PF+GW
Sbjct: 32 SQAIENLLADLNESYNAKNKAWGFFQGES-----GAYPFSGW 68


tr_hit_id A7QP90
Definition tr|A7QP90|A7QP90_VITVI Chromosome chr1 scaffold_136, whole genome shotgun sequence OS=Vitis vinifera
Align length 85
Score (bit) 123.0
E-value 8.0e-43
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= DK950443|Adiantum capillus-veneris mRNA, clone:
TST38A01NGRL0008_K18, 5'
(656 letters)

Database: uniprot_trembl.fasta
7,341,751 sequences; 2,391,615,440 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

tr|A7QP90|A7QP90_VITVI Chromosome chr1 scaffold_136, whole genom... 123 8e-43
tr|Q0JGI9|Q0JGI9_ORYSJ Os01g0921200 protein OS=Oryza sativa subs... 123 3e-42
tr|A3A106|A3A106_ORYSJ Putative uncharacterized protein OS=Oryza... 123 3e-42
tr|Q8RZJ2|Q8RZJ2_ORYSJ Putative alpha-glucosidase 1 OS=Oryza sat... 123 4e-42
tr|A2WYG5|A2WYG5_ORYSI Putative uncharacterized protein OS=Oryza... 123 4e-42
tr|A9RIJ2|A9RIJ2_PHYPA Predicted protein OS=Physcomitrella paten... 120 2e-40
tr|B4L3C3|B4L3C3_DROMO GI15075 OS=Drosophila mojavensis GN=GI150... 114 3e-38
tr|Q9CAG7|Q9CAG7_ARATH Putative glucosidase I OS=Arabidopsis tha... 107 6e-37
tr|O64796|O64796_ARATH T1F15.4 protein OS=Arabidopsis thaliana G... 107 6e-37
tr|Q940D4|Q940D4_ARATH Alpha-glucosidase I OS=Arabidopsis thalia... 107 6e-37
tr|Q2V4E4|Q2V4E4_ARATH Uncharacterized protein At1g67490.2 OS=Ar... 107 6e-37
tr|Q9C5B4|Q9C5B4_ARATH Alpha-glucosidase 1 OS=Arabidopsis thalia... 107 2e-36
tr|Q8GWC8|Q8GWC8_ARATH Putative alpha-glucosidase I OS=Arabidops... 107 3e-36
tr|A5JYS7|A5JYS7_CAEEL Protein F13H10.4c, partially confirmed by... 106 1e-35
tr|B4JNW2|B4JNW2_DROGR GH24900 OS=Drosophila grimshawi GN=GH2490... 105 2e-35
tr|Q3UME9|Q3UME9_MOUSE Putative uncharacterized protein OS=Mus m... 111 2e-35
tr|B3NV78|B3NV78_DROER GG18860 OS=Drosophila erecta GN=GG18860 P... 108 2e-35
tr|Q3U026|Q3U026_MOUSE Putative uncharacterized protein OS=Mus m... 110 3e-35
tr|Q3U950|Q3U950_MOUSE Putative uncharacterized protein (Fragmen... 110 3e-35
tr|Q3U8P9|Q3U8P9_MOUSE Putative uncharacterized protein (Fragmen... 110 3e-35
tr|B4R2T0|B4R2T0_DROSI GD15993 OS=Drosophila simulans GN=GD15993... 107 4e-35
tr|A9UNC0|A9UNC0_DROME RE03215p OS=Drosophila melanogaster GN=CG... 107 6e-35
tr|B4M1C2|B4M1C2_DROVI GJ18880 OS=Drosophila virilis GN=GJ18880 ... 103 6e-35
tr|Q9VZ04|Q9VZ04_DROME CG1597 OS=Drosophila melanogaster GN=CG15... 107 6e-35
tr|Q95R68|Q95R68_DROME SD04273p OS=Drosophila melanogaster GN=CG... 107 6e-35
tr|A8X167|A8X167_CAEBR Putative uncharacterized protein OS=Caeno... 109 6e-35
tr|Q4RJC6|Q4RJC6_TETNG Chromosome 18 SCAF15038, whole genome sho... 108 7e-35
tr|Q1MX36|Q1MX36_9ANNE Putative uncharacterized protein gcs1a OS... 118 4e-34
tr|Q1MX35|Q1MX35_9ANNE Putative uncharacterized protein gcs1b OS... 118 4e-34
tr|B4NDC9|B4NDC9_DROWI GK24934 OS=Drosophila willistoni GN=GK249... 105 5e-34

>tr|A7QP90|A7QP90_VITVI Chromosome chr1 scaffold_136, whole genome
shotgun sequence OS=Vitis vinifera GN=GSVIVT00002845001
PE=4 SV=1
Length = 850

Score = 123 bits (308), Expect(2) = 8e-43
Identities = 56/85 (65%), Positives = 66/85 (77%)
Frame = +1

Query: 127 LWININYLVLGALHRYSQEPGPYKDAASRIYTQLRDNLIRNVVESYNESGYLWEQYDNAA 306
+W+N+NY +L ALH YSQ GPY+D A IY LR NLIRNVV +Y +SGYLWEQYD
Sbjct: 764 IWMNMNYRILSALHHYSQVDGPYRDKARIIYNDLRGNLIRNVVHNYYQSGYLWEQYDQ-K 822

Query: 307 NGRGKGAHPFTGWTSLILLVMAEQY 381
G+GKGA PFTGWTSL+LL+MAE Y
Sbjct: 823 KGKGKGARPFTGWTSLVLLIMAETY 847



Score = 75.1 bits (183), Expect(2) = 8e-43
Identities = 32/43 (74%), Positives = 36/43 (83%)
Frame = +3

Query: 3 QLDLIVDEKLLWTAYGLRSLATTSSMYMARNTEHDPPYWRGPV 131
QLDLI + LWT YGLRSL+ TSS+YM RNTEHDPPYWRGP+
Sbjct: 722 QLDLISNRSTLWTDYGLRSLSKTSSLYMKRNTEHDPPYWRGPI 764


>tr|Q0JGI9|Q0JGI9_ORYSJ Os01g0921200 protein OS=Oryza sativa subsp.
japonica GN=Os01g0921200 PE=4 SV=1
Length = 929

Score = 123 bits (309), Expect(2) = 3e-42
Identities = 56/114 (49%), Positives = 74/114 (64%), Gaps = 1/114 (0%)
Frame = +1

Query: 124 ALWININYLVLGALHRYSQEPGPYKDAASRIYTQLRDNLIRNVVESYNESGYLWEQYDNA 303
A+WIN+NY++L LH Y+ E GPYKD A +Y +LR NLIRN+V++Y+E+G+ WE YD
Sbjct: 762 AIWINMNYMILSGLHHYAHEDGPYKDRAKELYDELRSNLIRNIVKNYHETGFFWENYDQK 821

Query: 304 ANGRGKGAHPFTGWTSLILLVMAEQY*TPMYSASQPLEVNPS-IGWTTTCLEFK 462
G+GKGA FTGWTSL++L+M E Y T P N S W CL +
Sbjct: 822 NKGKGKGARSFTGWTSLVVLIMGESYPTLHRRDDYP---NLSWFSWINICLSLR 872



Score = 72.8 bits (177), Expect(2) = 3e-42
Identities = 31/43 (72%), Positives = 36/43 (83%)
Frame = +3

Query: 3 QLDLIVDEKLLWTAYGLRSLATTSSMYMARNTEHDPPYWRGPV 131
QLDLI + +LWT YGLRSL+ TSS+YM RNTEHDPPYWRG +
Sbjct: 721 QLDLISNSSILWTNYGLRSLSRTSSIYMKRNTEHDPPYWRGAI 763


>tr|A3A106|A3A106_ORYSJ Putative uncharacterized protein OS=Oryza
sativa subsp. japonica GN=OsJ_004478 PE=4 SV=1
Length = 839

Score = 123 bits (309), Expect(2) = 3e-42
Identities = 56/114 (49%), Positives = 74/114 (64%), Gaps = 1/114 (0%)
Frame = +1

Query: 124 ALWININYLVLGALHRYSQEPGPYKDAASRIYTQLRDNLIRNVVESYNESGYLWEQYDNA 303
A+WIN+NY++L LH Y+ E GPYKD A +Y +LR NLIRN+V++Y+E+G+ WE YD
Sbjct: 672 AIWINMNYMILSGLHHYAHEDGPYKDRAKELYDELRSNLIRNIVKNYHETGFFWENYDQK 731

Query: 304 ANGRGKGAHPFTGWTSLILLVMAEQY*TPMYSASQPLEVNPS-IGWTTTCLEFK 462
G+GKGA FTGWTSL++L+M E Y T P N S W CL +
Sbjct: 732 NKGKGKGARSFTGWTSLVVLIMGESYPTLHRRDDYP---NLSWFSWINICLSLR 782



Score = 72.8 bits (177), Expect(2) = 3e-42
Identities = 31/43 (72%), Positives = 36/43 (83%)
Frame = +3

Query: 3 QLDLIVDEKLLWTAYGLRSLATTSSMYMARNTEHDPPYWRGPV 131
QLDLI + +LWT YGLRSL+ TSS+YM RNTEHDPPYWRG +
Sbjct: 631 QLDLISNSSILWTNYGLRSLSRTSSIYMKRNTEHDPPYWRGAI 673


>tr|Q8RZJ2|Q8RZJ2_ORYSJ Putative alpha-glucosidase 1 OS=Oryza sativa
subsp. japonica GN=OJ1485_B09.4 PE=4 SV=1
Length = 889

Score = 123 bits (308), Expect(2) = 4e-42
Identities = 50/88 (56%), Positives = 67/88 (76%)
Frame = +1

Query: 124 ALWININYLVLGALHRYSQEPGPYKDAASRIYTQLRDNLIRNVVESYNESGYLWEQYDNA 303
A+WIN+NY++L LH Y+ E GPYKD A +Y +LR NLIRN+V++Y+E+G+ WE YD
Sbjct: 799 AIWINMNYMILSGLHHYAHEDGPYKDRAKELYDELRSNLIRNIVKNYHETGFFWENYDQK 858

Query: 304 ANGRGKGAHPFTGWTSLILLVMAEQY*T 387
G+GKGA FTGWTSL++L+M E Y T
Sbjct: 859 NKGKGKGARSFTGWTSLVVLIMGESYPT 886



Score = 72.8 bits (177), Expect(2) = 4e-42
Identities = 31/43 (72%), Positives = 36/43 (83%)
Frame = +3

Query: 3 QLDLIVDEKLLWTAYGLRSLATTSSMYMARNTEHDPPYWRGPV 131
QLDLI + +LWT YGLRSL+ TSS+YM RNTEHDPPYWRG +
Sbjct: 758 QLDLISNSSILWTNYGLRSLSRTSSIYMKRNTEHDPPYWRGAI 800


>tr|A2WYG5|A2WYG5_ORYSI Putative uncharacterized protein OS=Oryza
sativa subsp. indica GN=OsI_04968 PE=4 SV=1
Length = 852

Score = 123 bits (308), Expect(2) = 4e-42
Identities = 50/88 (56%), Positives = 67/88 (76%)
Frame = +1

Query: 124 ALWININYLVLGALHRYSQEPGPYKDAASRIYTQLRDNLIRNVVESYNESGYLWEQYDNA 303
A+WIN+NY++L LH Y+ E GPYKD A +Y +LR NLIRN+V++Y+E+G+ WE YD
Sbjct: 762 AIWINMNYMILSGLHHYAHEDGPYKDRAKELYDELRSNLIRNIVKNYHETGFFWENYDQK 821

Query: 304 ANGRGKGAHPFTGWTSLILLVMAEQY*T 387
G+GKGA FTGWTSL++L+M E Y T
Sbjct: 822 NKGKGKGARSFTGWTSLVVLIMGESYPT 849



Score = 72.8 bits (177), Expect(2) = 4e-42
Identities = 31/43 (72%), Positives = 36/43 (83%)
Frame = +3

Query: 3 QLDLIVDEKLLWTAYGLRSLATTSSMYMARNTEHDPPYWRGPV 131
QLDLI + +LWT YGLRSL+ TSS+YM RNTEHDPPYWRG +
Sbjct: 721 QLDLISNSSILWTNYGLRSLSRTSSIYMKRNTEHDPPYWRGAI 763


>tr|A9RIJ2|A9RIJ2_PHYPA Predicted protein OS=Physcomitrella patens
subsp. patens GN=PHYPADRAFT_159281 PE=4 SV=1
Length = 849

Score = 120 bits (300), Expect(2) = 2e-40
Identities = 54/85 (63%), Positives = 67/85 (78%)
Frame = +1

Query: 127 LWININYLVLGALHRYSQEPGPYKDAASRIYTQLRDNLIRNVVESYNESGYLWEQYDNAA 306
+W+NINYLVL AL S+ G + S Y+QLR +LIRNVV+ Y+ESGYLWEQYDNA
Sbjct: 765 VWMNINYLVLSALDHCSKVDGQHSSKCSETYSQLRAHLIRNVVKRYHESGYLWEQYDNAN 824

Query: 307 NGRGKGAHPFTGWTSLILLVMAEQY 381
G+GKG+HPFTGWTSLILL+M++ Y
Sbjct: 825 KGKGKGSHPFTGWTSLILLIMSDSY 849



Score = 70.5 bits (171), Expect(2) = 2e-40
Identities = 30/43 (69%), Positives = 36/43 (83%)
Frame = +3

Query: 3 QLDLIVDEKLLWTAYGLRSLATTSSMYMARNTEHDPPYWRGPV 131
Q++L+ +E LWT +GLRSLATTSS+YM NTEHD PYWRGPV
Sbjct: 723 QMELLRNETNLWTTFGLRSLATTSSLYMKHNTEHDAPYWRGPV 765


>tr|B4L3C3|B4L3C3_DROMO GI15075 OS=Drosophila mojavensis GN=GI15075
PE=4 SV=1
Length = 864

Score = 114 bits (284), Expect(2) = 3e-38
Identities = 49/85 (57%), Positives = 63/85 (74%)
Frame = +1

Query: 127 LWININYLVLGALHRYSQEPGPYKDAASRIYTQLRDNLIRNVVESYNESGYLWEQYDNAA 306
+WININYL + AL Y Q GPY D A +IY +LR+NL++NV Y SGY+WEQYD+ +
Sbjct: 781 IWININYLAVKALRHYGQADGPYADLARKIYGELRENLVKNVFRQYQRSGYIWEQYDD-S 839

Query: 307 NGRGKGAHPFTGWTSLILLVMAEQY 381
G GKG PFTGW+ L++L+MAEQY
Sbjct: 840 TGEGKGCRPFTGWSGLVVLLMAEQY 864



Score = 69.3 bits (168), Expect(2) = 3e-38
Identities = 29/37 (78%), Positives = 31/37 (83%)
Frame = +3

Query: 21 DEKLLWTAYGLRSLATTSSMYMARNTEHDPPYWRGPV 131
D +LLWT YGLRSLA S MYM RNTEHDPPYWRGP+
Sbjct: 745 DPELLWTNYGLRSLAKNSPMYMKRNTEHDPPYWRGPI 781


>tr|Q9CAG7|Q9CAG7_ARATH Putative glucosidase I OS=Arabidopsis thaliana
GN=F12B7.4 PE=4 SV=1
Length = 879

Score = 107 bits (268), Expect(2) = 6e-37
Identities = 46/85 (54%), Positives = 64/85 (75%)
Frame = +1

Query: 127 LWININYLVLGALHRYSQEPGPYKDAASRIYTQLRDNLIRNVVESYNESGYLWEQYDNAA 306
+W+N+NY++L +L+ YS GPY++ + IYT+LR NLIRNVV +Y E+GY+WEQYD
Sbjct: 793 IWMNMNYMILSSLYHYSIVDGPYREKSKAIYTELRSNLIRNVVRNYYETGYIWEQYDQ-V 851

Query: 307 NGRGKGAHPFTGWTSLILLVMAEQY 381
G GKG FTGW++L LL+M+E Y
Sbjct: 852 KGTGKGTRLFTGWSALTLLIMSEDY 876



Score = 70.9 bits (172), Expect(2) = 6e-37
Identities = 31/43 (72%), Positives = 35/43 (81%)
Frame = +3

Query: 3 QLDLIVDEKLLWTAYGLRSLATTSSMYMARNTEHDPPYWRGPV 131
QLDLI + +LW+ YGL SLA TSSMYM RNTEHD PYWRGP+
Sbjct: 751 QLDLISNRSILWSDYGLVSLAKTSSMYMKRNTEHDAPYWRGPI 793


>tr|O64796|O64796_ARATH T1F15.4 protein OS=Arabidopsis thaliana
GN=T1F15.4 PE=4 SV=1
Length = 864

Score = 107 bits (268), Expect(2) = 6e-37
Identities = 46/85 (54%), Positives = 64/85 (75%)
Frame = +1

Query: 127 LWININYLVLGALHRYSQEPGPYKDAASRIYTQLRDNLIRNVVESYNESGYLWEQYDNAA 306
+W+N+NY++L +L+ YS GPY++ + IYT+LR NLIRNVV +Y E+GY+WEQYD
Sbjct: 778 IWMNMNYMILSSLYHYSIVDGPYREKSKAIYTELRSNLIRNVVRNYYETGYIWEQYDQ-V 836

Query: 307 NGRGKGAHPFTGWTSLILLVMAEQY 381
G GKG FTGW++L LL+M+E Y
Sbjct: 837 KGTGKGTRLFTGWSALTLLIMSEDY 861



Score = 70.9 bits (172), Expect(2) = 6e-37
Identities = 31/43 (72%), Positives = 35/43 (81%)
Frame = +3

Query: 3 QLDLIVDEKLLWTAYGLRSLATTSSMYMARNTEHDPPYWRGPV 131
QLDLI + +LW+ YGL SLA TSSMYM RNTEHD PYWRGP+
Sbjct: 736 QLDLISNRSILWSDYGLVSLAKTSSMYMKRNTEHDAPYWRGPI 778


>tr|Q940D4|Q940D4_ARATH Alpha-glucosidase I OS=Arabidopsis thaliana
PE=2 SV=1
Length = 852

Score = 107 bits (268), Expect(2) = 6e-37
Identities = 46/85 (54%), Positives = 64/85 (75%)
Frame = +1

Query: 127 LWININYLVLGALHRYSQEPGPYKDAASRIYTQLRDNLIRNVVESYNESGYLWEQYDNAA 306
+W+N+NY++L +L+ YS GPY++ + IYT+LR NLIRNVV +Y E+GY+WEQYD
Sbjct: 766 IWMNMNYMILSSLYHYSIVDGPYREKSKAIYTELRSNLIRNVVRNYYETGYIWEQYDQ-V 824

Query: 307 NGRGKGAHPFTGWTSLILLVMAEQY 381
G GKG FTGW++L LL+M+E Y
Sbjct: 825 KGTGKGTRLFTGWSALTLLIMSEDY 849



Score = 70.9 bits (172), Expect(2) = 6e-37
Identities = 31/43 (72%), Positives = 35/43 (81%)
Frame = +3

Query: 3 QLDLIVDEKLLWTAYGLRSLATTSSMYMARNTEHDPPYWRGPV 131
QLDLI + +LW+ YGL SLA TSSMYM RNTEHD PYWRGP+
Sbjct: 724 QLDLISNRSILWSDYGLVSLAKTSSMYMKRNTEHDAPYWRGPI 766