DK950457
Clone id TST38A01NGRL0008_L08
Library
Length 488
Definition Adiantum capillus-veneris mRNA. clone: TST38A01NGRL0008_L08. 5' end sequence.
Accession
Tissue type prothallia
Developmental stage gametophyte
Contig ID -
Sequence
GGAACAAAGTGTGGAAGCTGCCAGGTTGTAGTTCATGGACTGATCCACATATTAAGGTGC
ATGAGTTTTGTGTTGGTGATACAAAGAATGTACAAAGCAAAGGGATGGCTCGAAAGTAGA
GGATATCATGCTTAAAATGCTGCTGGCAGGGGATGAAGACTTCATGCAGCAGCATTGTGT
GTTATTGCTCATAATGTGCCTTTCATAGGGTTGACACAAGGAAGTAGCTTGCTCAACAGA
CATCAAAATGGAGAGGCCATGTCAAGGTACATTGATTGGAATGACTCTATCTTGCGTCAC
ATCAATTGTCGGAAAATCACTTACACAAAGATTCATGGTGAGAAATTCCTGCAACATTTC
TGCTAGTACAGGTAACCACAGGTAACTGACACCAAATCAAAACAATCATTGTCAGCTTTA
ATTACATCTCTCTACAGTAGAATTGAAATCGATTTGGTGCAAAAAAAAAAAAAAAAAAAA
AAACCCAA
■■Homology search results ■■ -
sp_hit_id Q6AMN0
Definition sp|Q6AMN0|F16PC_DESPS Fructose-1,6-bisphosphatase class 3 OS=Desulfotalea psychrophila
Align length 28
Score (bit) 32.7
E-value 0.77
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= DK950457|Adiantum capillus-veneris mRNA, clone:
TST38A01NGRL0008_L08, 5'
(460 letters)

Database: uniprot_sprot.fasta
412,525 sequences; 148,809,765 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

sp|Q6AMN0|F16PC_DESPS Fructose-1,6-bisphosphatase class 3 OS=Des... 33 0.77
sp|Q7YRU6|S12A7_RABIT Solute carrier family 12 member 7 OS=Oryct... 32 1.7
sp|Q7Y211|PP285_ARATH Pentatricopeptide repeat-containing protei... 30 3.8
sp|Q9FXB9|PPR84_ARATH Pentatricopeptide repeat-containing protei... 30 6.6
sp|Q64676|CGT_MOUSE 2-hydroxyacylsphingosine 1-beta-galactosyltr... 29 8.5

>sp|Q6AMN0|F16PC_DESPS Fructose-1,6-bisphosphatase class 3
OS=Desulfotalea psychrophila GN=fbp PE=3 SV=1
Length = 605

Score = 32.7 bits (73), Expect = 0.77
Identities = 17/28 (60%), Positives = 19/28 (67%)
Frame = -2

Query: 381 LWLPVLAEMLQEFLTMNLCVSDFPTIDV 298
LWL LAEML+ T L SDFPTID+
Sbjct: 299 LWLERLAEMLKTGATEELNDSDFPTIDL 326


>sp|Q7YRU6|S12A7_RABIT Solute carrier family 12 member 7
OS=Oryctolagus cuniculus GN=SLC12A7 PE=1 SV=1
Length = 1106

Score = 31.6 bits (70), Expect = 1.7
Identities = 15/39 (38%), Positives = 22/39 (56%)
Frame = +2

Query: 215 HKEVACSTDIKMERPCQGTLIGMTLSCVTSIVGKSLTQR 331
H+E S + + PC GT IG+ L C+ +I+G L R
Sbjct: 126 HEEAEDSRPRESKAPCMGTFIGVYLPCLQNILGVILFLR 164


>sp|Q7Y211|PP285_ARATH Pentatricopeptide repeat-containing protein
At3g57430, chloroplastic OS=Arabidopsis thaliana
GN=PCMP-H81 PE=2 SV=2
Length = 890

Score = 30.4 bits (67), Expect = 3.8
Identities = 17/50 (34%), Positives = 28/50 (56%)
Frame = +3

Query: 9 VWKLPGCSSWTDPHIKVHEFCVGDTKNVQSKGMARK*RISCLKCCWQGMK 158
V K PGCS W + +VH+F GD+ + QS+ ++ L+ W+ M+
Sbjct: 752 VRKEPGCS-WIEHGDEVHKFVAGDSSHPQSEKLS-----GYLETLWERMR 795


>sp|Q9FXB9|PPR84_ARATH Pentatricopeptide repeat-containing protein
At1g56690, mitochondrial OS=Arabidopsis thaliana
GN=PCMP-H69 PE=2 SV=1
Length = 704

Score = 29.6 bits (65), Expect = 6.6
Identities = 16/35 (45%), Positives = 18/35 (51%)
Frame = +3

Query: 3 NKVWKLPGCSSWTDPHIKVHEFCVGDTKNVQSKGM 107
N V K PGCS W + KVH F G KN + M
Sbjct: 563 NNVSKFPGCS-WIEVGKKVHMFTRGGIKNHPEQAM 596


>sp|Q64676|CGT_MOUSE 2-hydroxyacylsphingosine
1-beta-galactosyltransferase OS=Mus musculus GN=Ugt8
PE=2 SV=2
Length = 541

Score = 29.3 bits (64), Expect = 8.5
Identities = 17/59 (28%), Positives = 29/59 (49%)
Frame = +1

Query: 184 IAHNVPFIGLTQGSSLLNRHQNGEAMSRYIDWNDSILRHINCRKITYTKIHGEKFLQHF 360
+ +N + Q S +++ Q G ++R W D ILRH R + + +H F Q+F
Sbjct: 416 VINNPSYRQRAQKLSEIHKDQPGHPVNRTTYWIDYILRHDGARHLR-SAVHQISFCQYF 473


tr_hit_id B3U1T1
Definition tr|B3U1T1|B3U1T1_9EMBR Pentatricopeptide repeat protein (Fragment) OS=Megaceros tosanus
Align length 33
Score (bit) 39.3
E-value 0.099
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= DK950457|Adiantum capillus-veneris mRNA, clone:
TST38A01NGRL0008_L08, 5'
(460 letters)

Database: uniprot_trembl.fasta
7,341,751 sequences; 2,391,615,440 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

tr|B3U1T1|B3U1T1_9EMBR Pentatricopeptide repeat protein (Fragmen... 39 0.099
tr|B3U1T3|B3U1T3_9EMBR Pentatricopeptide repeat protein (Fragmen... 39 0.17
tr|B3U1U9|B3U1U9_CYCRE Pentatricopeptide repeat protein (Fragmen... 35 1.4
tr|B3U1Y5|B3U1Y5_9MARC Pentatricopeptide repeat protein (Fragmen... 35 1.9
tr|B3U1T2|B3U1T2_9EMBR Pentatricopeptide repeat protein (Fragmen... 35 1.9
tr|B3U1T0|B3U1T0_9EMBR Pentatricopeptide repeat protein (Fragmen... 35 1.9
tr|B3U1S9|B3U1S9_9EMBR Pentatricopeptide repeat protein (Fragmen... 35 1.9
tr|B3U1S3|B3U1S3_9MARC Pentatricopeptide repeat protein (Fragmen... 33 9.2
tr|B3U1Q3|B3U1Q3_9MARC Pentatricopeptide repeat protein (Fragmen... 33 9.2
tr|A2Q3P0|A2Q3P0_MEDTR Tetratricopeptide-like helical OS=Medicag... 33 9.2

>tr|B3U1T1|B3U1T1_9EMBR Pentatricopeptide repeat protein (Fragment)
OS=Megaceros tosanus GN=PPR PE=4 SV=1
Length = 153

Score = 39.3 bits (90), Expect = 0.099
Identities = 18/33 (54%), Positives = 22/33 (66%)
Frame = +3

Query: 9 VWKLPGCSSWTDPHIKVHEFCVGDTKNVQSKGM 107
VWK PG S WTD VH F VGD K+ +S+G+
Sbjct: 21 VWKKPGQSWWTDMGGVVHTFVVGDKKHPESEGI 53


>tr|B3U1T3|B3U1T3_9EMBR Pentatricopeptide repeat protein (Fragment)
OS=Phaeoceros laevis GN=PPR PE=4 SV=1
Length = 152

Score = 38.5 bits (88), Expect = 0.17
Identities = 17/32 (53%), Positives = 21/32 (65%)
Frame = +3

Query: 12 WKLPGCSSWTDPHIKVHEFCVGDTKNVQSKGM 107
WK PG S WTD VH F VGD K+ +S+G+
Sbjct: 21 WKKPGQSWWTDMGGVVHTFLVGDKKHAESEGI 52


>tr|B3U1U9|B3U1U9_CYCRE Pentatricopeptide repeat protein (Fragment)
OS=Cycas revoluta GN=PPR PE=4 SV=1
Length = 152

Score = 35.4 bits (80), Expect = 1.4
Identities = 16/32 (50%), Positives = 23/32 (71%)
Frame = +3

Query: 6 KVWKLPGCSSWTDPHIKVHEFCVGDTKNVQSK 101
+V K+PGCS W + + KVH F VGDT + Q++
Sbjct: 20 RVKKIPGCS-WIEVNNKVHAFLVGDTSHPQAQ 50


>tr|B3U1Y5|B3U1Y5_9MARC Pentatricopeptide repeat protein (Fragment)
OS=Diplophyllum albicans GN=PPR PE=2 SV=1
Length = 152

Score = 35.0 bits (79), Expect = 1.9
Identities = 16/33 (48%), Positives = 21/33 (63%)
Frame = +3

Query: 9 VWKLPGCSSWTDPHIKVHEFCVGDTKNVQSKGM 107
VWK PG SW + KVHEF GDT + ++K +
Sbjct: 21 VWKEPG-RSWIEVDKKVHEFVAGDTSHPEAKSI 52


>tr|B3U1T2|B3U1T2_9EMBR Pentatricopeptide repeat protein (Fragment)
OS=Phaeoceros laevis GN=PPR PE=4 SV=1
Length = 152

Score = 35.0 bits (79), Expect = 1.9
Identities = 15/32 (46%), Positives = 22/32 (68%)
Frame = +3

Query: 12 WKLPGCSSWTDPHIKVHEFCVGDTKNVQSKGM 107
WK PG S WTD VH+F VGD ++ +++G+
Sbjct: 21 WKKPGQSWWTDMCGLVHKFVVGDKEHPKTEGI 52


>tr|B3U1T0|B3U1T0_9EMBR Pentatricopeptide repeat protein (Fragment)
OS=Anthoceros agrestis GN=PPR PE=4 SV=1
Length = 153

Score = 35.0 bits (79), Expect = 1.9
Identities = 16/32 (50%), Positives = 20/32 (62%)
Frame = +3

Query: 12 WKLPGCSSWTDPHIKVHEFCVGDTKNVQSKGM 107
WK PG S WTD VH F VGD + +S+G+
Sbjct: 22 WKKPGQSWWTDMSGVVHTFFVGDKVHPESEGI 53


>tr|B3U1S9|B3U1S9_9EMBR Pentatricopeptide repeat protein (Fragment)
OS=Anthoceros agrestis GN=PPR PE=4 SV=1
Length = 153

Score = 35.0 bits (79), Expect = 1.9
Identities = 16/32 (50%), Positives = 20/32 (62%)
Frame = +3

Query: 12 WKLPGCSSWTDPHIKVHEFCVGDTKNVQSKGM 107
WK PG S WTD VH F VGD + +S+G+
Sbjct: 22 WKQPGQSWWTDMGGVVHTFGVGDKNHPESEGI 53


>tr|B3U1S3|B3U1S3_9MARC Pentatricopeptide repeat protein (Fragment)
OS=Scapania nemorea GN=PPR PE=4 SV=1
Length = 152

Score = 32.7 bits (73), Expect = 9.2
Identities = 16/33 (48%), Positives = 20/33 (60%)
Frame = +3

Query: 9 VWKLPGCSSWTDPHIKVHEFCVGDTKNVQSKGM 107
VWK PG S W KVHEF VGD + ++K +
Sbjct: 21 VWKEPGLS-WIAVDKKVHEFVVGDRSHPETKAI 52


>tr|B3U1Q3|B3U1Q3_9MARC Pentatricopeptide repeat protein (Fragment)
OS=Nardia scalaris GN=PPR PE=4 SV=1
Length = 152

Score = 32.7 bits (73), Expect = 9.2
Identities = 13/34 (38%), Positives = 22/34 (64%)
Frame = +3

Query: 6 KVWKLPGCSSWTDPHIKVHEFCVGDTKNVQSKGM 107
+VWK+PG S W + +H+F VGD + ++K +
Sbjct: 20 RVWKVPGLS-WIEVDKTIHKFAVGDRSHPEAKAI 52


>tr|A2Q3P0|A2Q3P0_MEDTR Tetratricopeptide-like helical OS=Medicago
truncatula GN=MtrDRAFT_AC155886g17v2 PE=4 SV=1
Length = 687

Score = 32.7 bits (73), Expect = 9.2
Identities = 15/30 (50%), Positives = 18/30 (60%)
Frame = +3

Query: 9 VWKLPGCSSWTDPHIKVHEFCVGDTKNVQS 98
+ K PGCS W KVH F VGD N++S
Sbjct: 549 ITKTPGCS-WLQVGNKVHTFVVGDKSNIES 577