DK950478
Clone id TST38A01NGRL0008_M05
Library
Length 644
Definition Adiantum capillus-veneris mRNA. clone: TST38A01NGRL0008_M05. 5' end sequence.
Accession
Tissue type prothallia
Developmental stage gametophyte
Contig ID -
Sequence
AGTTGGGGATAGCATTGGACACGGCCAAGGGTTTGGAATACCTGCACCATCATTCTGCTG
AGCACATTGTGCATTGTGATGTCAAGCCAGCAAACATACTGCTCGATGAGGATTTTCATG
CCAAGGTTGCAGACTTTGGCTTGGCCAAGCTTGTGGGCGGCGACGCCAAAAGCTTTGCTA
TGACGACACTGAAAGGGACACGGGGGTACCTAGCACCGGAGTGGCTACAGGAAACATCGA
TCACTGCCAAGTCAGACGTGTTTAGCTATGGAGTGGTGCTGCTGGAGCTCCTAACAGGGC
GTCAATGTTTGGATGCAGAAAGGGGGTACCTACCTGTATGGGCTATGAAGACAGTTGCCG
CCACTCAACATGGTACTGCTTCCAAGTCTTTATTAAATGGCTCCAAGGACTCTGCCTTCA
ATATAAGCTCGAATGATGCATCATTCTTGCAATCTGCCGTCATGGATGAGCGCTTGCACG
CTAGTGATGTTCCCACAGAGAGCTTTGTGCACGTGCTCACCTTGGCCCTTGCGTGTGTGC
AGACGGATCCAGCTGACCGTCCTAGCATGGTCTCCGTCGTGCAGATGTTGGAAGGCATGA
CGGAGGTCCCATACTCGTTACAGGGCCTCAAGCTCAGCGAATCC
■■Homology search results ■■ -
sp_hit_id P17801
Definition sp|P17801|KPRO_MAIZE Putative receptor protein kinase ZmPK1 OS=Zea mays
Align length 199
Score (bit) 131.0
E-value 3.0e-30
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= DK950478|Adiantum capillus-veneris mRNA, clone:
TST38A01NGRL0008_M05, 5'
(644 letters)

Database: uniprot_sprot.fasta
412,525 sequences; 148,809,765 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

sp|P17801|KPRO_MAIZE Putative receptor protein kinase ZmPK1 OS=Z... 131 3e-30
sp|Q9LJM4|IKU2_ARATH Receptor-like protein kinase HAIKU2 OS=Arab... 128 2e-29
sp|Q9SYQ8|CLV1_ARATH Receptor protein kinase CLAVATA1 OS=Arabido... 125 2e-28
sp|Q9ZWC8|BRL1_ARATH Serine/threonine-protein kinase BRI1-like 1... 123 7e-28
sp|Q9LJF3|BRL3_ARATH Serine/threonine-protein kinase BRI1-like 3... 122 2e-27
sp|Q94F62|BAK1_ARATH BRASSINOSTEROID INSENSITIVE 1-associated re... 119 2e-26
sp|P47735|RLK5_ARATH Receptor-like protein kinase 5 OS=Arabidops... 118 2e-26
sp|Q9FE20|PBS1_ARATH Serine/threonine-protein kinase PBS1 OS=Ara... 117 7e-26
sp|Q9ZPS9|BRL2_ARATH Serine/threonine-protein kinase BRI1-like 2... 115 1e-25
sp|Q9LYN8|EXS_ARATH Leucine-rich repeat receptor protein kinase ... 115 2e-25
sp|P93194|RPK1_IPONI Receptor-like protein kinase OS=Ipomoea nil... 112 2e-24
sp|P43298|TMK1_ARATH Putative receptor protein kinase TMK1 OS=Ar... 111 3e-24
sp|O22476|BRI1_ARATH Protein BRASSINOSTEROID INSENSITIVE 1 OS=Ar... 111 3e-24
sp|Q3EDL4|Y1154_ARATH Putative serine/threonine-protein kinase A... 110 5e-24
sp|Q9LHP4|RCH2_ARATH Receptor-like protein kinase 2 OS=Arabidops... 110 8e-24
sp|Q8L899|BRI1_SOLPE Systemin receptor SR160 OS=Solanum peruvian... 110 8e-24
sp|Q8GUQ5|BRI1_SOLLC Brassinosteroid LRR receptor kinase OS=Sola... 110 8e-24
sp|O48814|BIK1_ARATH Serine/threonine-protein kinase BIK1 OS=Ara... 110 8e-24
sp|O24585|CRI4_MAIZE Putative receptor protein kinase CRINKLY4 O... 109 1e-23
sp|Q06548|APK1A_ARATH Protein kinase APK1A, chloroplastic OS=Ara... 109 1e-23
sp|P46573|APK1B_ARATH Protein kinase APK1B, chloroplastic OS=Ara... 108 2e-23
sp|Q8L4H4|NORK_MEDTR Nodulation receptor kinase OS=Medicago trun... 108 2e-23
sp|Q8LKZ1|NORK_PEA Nodulation receptor kinase OS=Pisum sativum G... 107 5e-23
sp|Q9FNE1|CRK42_ARATH Cysteine-rich receptor-like protein kinase... 107 7e-23
sp|Q9LMB9|CRK1_ARATH Cysteine-rich receptor-like protein kinase ... 107 7e-23
sp|P27450|CX32_ARATH Probable serine/threonine-protein kinase Cx... 106 1e-22
sp|Q9XEC6|CRK36_ARATH Cysteine-rich receptor-like protein kinase... 106 1e-22
sp|Q9CAL3|CRK2_ARATH Cysteine-rich receptor-like protein kinase ... 106 1e-22
sp|Q9SYS7|CRK39_ARATH Putative cysteine-rich receptor-like prote... 105 2e-22
sp|Q9LQQ8|RLCK7_ARATH Probable serine/threonine-protein kinase R... 103 6e-22

>sp|P17801|KPRO_MAIZE Putative receptor protein kinase ZmPK1 OS=Zea
mays GN=PK1 PE=2 SV=2
Length = 817

Score = 131 bits (329), Expect = 3e-30
Identities = 78/199 (39%), Positives = 112/199 (56%), Gaps = 5/199 (2%)
Frame = +3

Query: 9 IALDTAKGLEYLHHHSAEHIVHCDVKPANILLDEDFHAKVADFGLAKLVGGDAKSFAMTT 188
IAL AKGL YLHH E ++HCDVKP NILLD+ F K+ DFGL KL+ + ++
Sbjct: 635 IALGVAKGLAYLHHECLEWVIHCDVKPENILLDQAFEPKITDFGLVKLLNRGGSTQNVSH 694

Query: 189 LKGTRGYLAPEWLQETSITAKSDVFSYGVVLLELLTGRQCLDAERGYLPVWAM-----KT 353
++GT GY+APEW+ ITAK DV+SYGVVLLELLTG + + G V +M +
Sbjct: 695 VRGTLGYIAPEWVSSLPITAKVDVYSYGVVLLELLTGTRVSELVGGTDEVHSMLRKLVRM 754

Query: 354 VAATQHGTASKSLLNGSKDSAFNISSNDASFLQSAVMDERLHASDVPTESFVHVLTLALA 533
++A G +S ++G DS N +++Q+ + + LA++
Sbjct: 755 LSAKLEG-EEQSWIDGYLDSKLN---RPVNYVQARTL-----------------IKLAVS 793

Query: 534 CVQTDPADRPSMVSVVQML 590
C++ D + RP+M VQ L
Sbjct: 794 CLEEDRSKRPTMEHAVQTL 812


>sp|Q9LJM4|IKU2_ARATH Receptor-like protein kinase HAIKU2
OS=Arabidopsis thaliana GN=IKU2 PE=1 SV=1
Length = 991

Score = 128 bits (322), Expect = 2e-29
Identities = 76/200 (38%), Positives = 109/200 (54%), Gaps = 5/200 (2%)
Frame = +3

Query: 9 IALDTAKGLEYLHHHSAEHIVHCDVKPANILLDEDFHAKVADFGLAKLVGGDA--KSFAM 182
+AL AKGLEYLHH ++H DVK +NILLDE++ ++ADFGLAK++ D+ + F+
Sbjct: 791 LALGAAKGLEYLHHGLDRPVIHRDVKSSNILLDEEWRPRIADFGLAKIIQADSVQRDFSA 850

Query: 183 TTLKGTRGYLAPEWLQETSITAKSDVFSYGVVLLELLTGRQCLDAERGY---LPVWAMKT 353
+KGT GY+APE+ T + KSDV+S+GVVL+EL+TG++ L+ + G + +W
Sbjct: 851 PLVKGTLGYIAPEYAYTTKVNEKSDVYSFGVVLMELVTGKKPLETDFGENNDIVMWVWSV 910

Query: 354 VAATQHGTASKSLLNGSKDSAFNISSNDASFLQSAVMDERLHASDVPTESFVHVLTLALA 533
T K + +++ DE E + VLT+AL
Sbjct: 911 SKETNREMMMK-------------------LIDTSIEDEY-------KEDALKVLTIALL 944

Query: 534 CVQTDPADRPSMVSVVQMLE 593
C P RP M SVV MLE
Sbjct: 945 CTDKSPQARPFMKSVVSMLE 964


>sp|Q9SYQ8|CLV1_ARATH Receptor protein kinase CLAVATA1 OS=Arabidopsis
thaliana GN=CLV1 PE=1 SV=3
Length = 980

Score = 125 bits (314), Expect = 2e-28
Identities = 79/207 (38%), Positives = 114/207 (55%)
Frame = +3

Query: 9 IALDTAKGLEYLHHHSAEHIVHCDVKPANILLDEDFHAKVADFGLAKLVGGDAKSFAMTT 188
+A++ AKGL YLHH + I+H DVK NILLD DF A VADFGLAK + A S M++
Sbjct: 794 VAVEAAKGLCYLHHDCSPLILHRDVKSNNILLDSDFEAHVADFGLAKFLVDGAASECMSS 853

Query: 189 LKGTRGYLAPEWLQETSITAKSDVFSYGVVLLELLTGRQCLDAERGYLPVWAMKTVAATQ 368
+ G+ GY+APE+ + KSDV+S+GVVLLEL+ G+ K V
Sbjct: 854 IAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELIAGK---------------KPVGEFG 898

Query: 369 HGTASKSLLNGSKDSAFNISSNDASFLQSAVMDERLHASDVPTESFVHVLTLALACVQTD 548
G ++ +++ I+ + + A++D RL + P S +HV +A+ CV+ +
Sbjct: 899 EGV---DIVRWVRNTEEEITQPSDAAIVVAIVDPRL--TGYPLTSVIHVFKIAMMCVEEE 953

Query: 549 PADRPSMVSVVQMLEGMTEVPYSLQGL 629
A RP+M VV ML T P S+ L
Sbjct: 954 AAARPTMREVVHML---TNPPKSVANL 977


>sp|Q9ZWC8|BRL1_ARATH Serine/threonine-protein kinase BRI1-like 1
OS=Arabidopsis thaliana GN=BRL1 PE=1 SV=1
Length = 1166

Score = 123 bits (309), Expect = 7e-28
Identities = 77/219 (35%), Positives = 112/219 (51%), Gaps = 7/219 (3%)
Frame = +3

Query: 9 IALDTAKGLEYLHHHSAEHIVHCDVKPANILLDEDFHAKVADFGLAKLVGGDAKSFAMTT 188
IA+ A+GL +LHH HI+H D+K +N+LLDEDF A+V+DFG+A+LV +++T
Sbjct: 964 IAIGAARGLAFLHHSCIPHIIHRDMKSSNVLLDEDFEARVSDFGMARLVSALDTHLSVST 1023

Query: 189 LKGTRGYLAPEWLQETSITAKSDVFSYGVVLLELLTGRQCLD----AERGYLPVWAMKTV 356
L GT GY+ PE+ Q TAK DV+SYGV+LLELL+G++ +D E L WA K +
Sbjct: 1024 LAGTPGYVPPEYYQSFRCTAKGDVYSYGVILLELLSGKKPIDPGEFGEDNNLVGWA-KQL 1082

Query: 357 AATQHGTASKSLLNGSKDSAFNISSNDASFLQSAVMDERLHASDVPTESFVHVLTLALAC 536
+ G + ++D L H L +A C
Sbjct: 1083 YREKRG--------------------------AEILDPELVTDKSGDVELFHYLKIASQC 1116

Query: 537 VQTDPADRPSMVSVVQMLEGM---TEVPYSLQGLKLSES 644
+ P RP+M+ ++ M + M TE SL L E+
Sbjct: 1117 LDDRPFKRPTMIQLMAMFKEMKADTEEDESLDEFSLKET 1155


>sp|Q9LJF3|BRL3_ARATH Serine/threonine-protein kinase BRI1-like 3
OS=Arabidopsis thaliana GN=BRL3 PE=1 SV=1
Length = 1164

Score = 122 bits (305), Expect = 2e-27
Identities = 71/204 (34%), Positives = 108/204 (52%), Gaps = 4/204 (1%)
Frame = +3

Query: 9 IALDTAKGLEYLHHHSAEHIVHCDVKPANILLDEDFHAKVADFGLAKLVGGDAKSFAMTT 188
IA+ A+GL +LHH HI+H D+K +N+LLD+DF A+V+DFG+A+LV +++T
Sbjct: 962 IAIGAARGLAFLHHSCIPHIIHRDMKSSNVLLDQDFVARVSDFGMARLVSALDTHLSVST 1021

Query: 189 LKGTRGYLAPEWLQETSITAKSDVFSYGVVLLELLTGRQCLDAER----GYLPVWAMKTV 356
L GT GY+ PE+ Q TAK DV+SYGV+LLELL+G++ +D E L WA K +
Sbjct: 1022 LAGTPGYVPPEYYQSFRCTAKGDVYSYGVILLELLSGKKPIDPEEFGEDNNLVGWA-KQL 1080

Query: 357 AATQHGTASKSLLNGSKDSAFNISSNDASFLQSAVMDERLHASDVPTESFVHVLTLALAC 536
+ G + ++D L +H L +A C
Sbjct: 1081 YREKRG--------------------------AEILDPELVTDKSGDVELLHYLKIASQC 1114

Query: 537 VQTDPADRPSMVSVVQMLEGMTEV 608
+ P RP+M+ V+ M + + +V
Sbjct: 1115 LDDRPFKRPTMIQVMTMFKELVQV 1138


>sp|Q94F62|BAK1_ARATH BRASSINOSTEROID INSENSITIVE 1-associated
receptor kinase 1 OS=Arabidopsis thaliana GN=BAK1 PE=1
SV=2
Length = 615

Score = 119 bits (297), Expect = 2e-26
Identities = 82/203 (40%), Positives = 108/203 (53%), Gaps = 7/203 (3%)
Frame = +3

Query: 9 IALDTAKGLEYLHHHSAEHIVHCDVKPANILLDEDFHAKVADFGLAKLVGGDAKSFAMTT 188
IAL +A+GL YLH H I+H DVK ANILLDE+F A V DFGLAKL+ D K +TT
Sbjct: 393 IALGSARGLAYLHDHCDPKIIHRDVKAANILLDEEFEAVVGDFGLAKLM--DYKDTHVTT 450

Query: 189 -LKGTRGYLAPEWLQETSITAKSDVFSYGVVLLELLTGRQCLDAER------GYLPVWAM 347
++GT G++APE+L + K+DVF YGV+LLEL+TG++ D R L W
Sbjct: 451 AVRGTIGHIAPEYLSTGKSSEKTDVFGYGVMLLELITGQRAFDLARLANDDDVMLLDWV- 509

Query: 348 KTVAATQHGTASKSLLNGSKDSAFNISSNDASFLQSAVMDERLHASDVPTESFVHVLTLA 527
K LL K A++D L + E ++ +A
Sbjct: 510 ------------KGLLKEKK--------------LEALVDVDLQ-GNYKDEEVEQLIQVA 542

Query: 528 LACVQTDPADRPSMVSVVQMLEG 596
L C Q+ P +RP M VV+MLEG
Sbjct: 543 LLCTQSSPMERPKMSEVVRMLEG 565


>sp|P47735|RLK5_ARATH Receptor-like protein kinase 5 OS=Arabidopsis
thaliana GN=RLK5 PE=1 SV=1
Length = 999

Score = 118 bits (296), Expect = 2e-26
Identities = 78/199 (39%), Positives = 105/199 (52%), Gaps = 2/199 (1%)
Frame = +3

Query: 3 LGIALDTAKGLEYLHHHSAEHIVHCDVKPANILLDEDFHAKVADFGLAKL--VGGDAKSF 176
L IALD A+GL YLHH IVH DVK +NILLD D+ AKVADFG+AK+ + G
Sbjct: 794 LRIALDAAEGLSYLHHDCVPPIVHRDVKSSNILLDSDYGAKVADFGIAKVGQMSGSKTPE 853

Query: 177 AMTTLKGTRGYLAPEWLQETSITAKSDVFSYGVVLLELLTGRQCLDAERGYLPVWAMKTV 356
AM+ + G+ GY+APE++ + KSD++S+GVVLLEL+TG+Q D+E
Sbjct: 854 AMSGIAGSCGYIAPEYVYTLRVNEKSDIYSFGVVLLELVTGKQPTDSEL----------- 902

Query: 357 AATQHGTASKSLLNGSKDSAFNISSNDASFLQSAVMDERLHASDVPTESFVHVLTLALAC 536
G KD A + + V+D +L E V+ + L C
Sbjct: 903 --------------GDKDMAKWVCTALDKCGLEPVIDPKLDLKF--KEEISKVIHIGLLC 946

Query: 537 VQTDPADRPSMVSVVQMLE 593
P +RPSM VV ML+
Sbjct: 947 TSPLPLNRPSMRKVVIMLQ 965


>sp|Q9FE20|PBS1_ARATH Serine/threonine-protein kinase PBS1
OS=Arabidopsis thaliana GN=PBS1 PE=1 SV=1
Length = 456

Score = 117 bits (292), Expect = 7e-26
Identities = 77/202 (38%), Positives = 105/202 (51%)
Frame = +3

Query: 9 IALDTAKGLEYLHHHSAEHIVHCDVKPANILLDEDFHAKVADFGLAKLVGGDAKSFAMTT 188
IA AKGLE+LH + +++ D K +NILLDE FH K++DFGLAKL KS T
Sbjct: 190 IAAGAAKGLEFLHDKANPPVIYRDFKSSNILLDEGFHPKLSDFGLAKLGPTGDKSHVSTR 249

Query: 189 LKGTRGYLAPEWLQETSITAKSDVFSYGVVLLELLTGRQCLDAERGYLPVWAMKTVAATQ 368
+ GT GY APE+ +T KSDV+S+GVV LEL+TGR+ +D+E +P VA
Sbjct: 250 VMGTYGYCAPEYAMTGQLTVKSDVYSFGVVFLELITGRKAIDSE---MPHGEQNLVA--- 303

Query: 369 HGTASKSLLNGSKDSAFNISSNDASFLQSAVMDERLHASDVPTESFVHVLTLALACVQTD 548
++ L N + F++ A D RL PT + L +A C+Q
Sbjct: 304 ---WARPLFNDRR-----------KFIKLA--DPRLKGR-FPTRALYQALAVASMCIQEQ 346

Query: 549 PADRPSMVSVVQMLEGMTEVPY 614
A RP + VV L + Y
Sbjct: 347 AATRPLIADVVTALSYLANQAY 368


>sp|Q9ZPS9|BRL2_ARATH Serine/threonine-protein kinase BRI1-like 2
OS=Arabidopsis thaliana GN=BRL1 PE=1 SV=1
Length = 1143

Score = 115 bits (289), Expect = 1e-25
Identities = 70/198 (35%), Positives = 104/198 (52%), Gaps = 4/198 (2%)
Frame = +3

Query: 9 IALDTAKGLEYLHHHSAEHIVHCDVKPANILLDEDFHAKVADFGLAKLVGGDAKSFAMTT 188
IA AKGL +LHH+ HI+H D+K +N+LLD+D A+V+DFG+A+L+ +++T
Sbjct: 943 IAKGAAKGLCFLHHNCIPHIIHRDMKSSNVLLDQDMEARVSDFGMARLISALDTHLSVST 1002

Query: 189 LKGTRGYLAPEWLQETSITAKSDVFSYGVVLLELLTGRQCLDAER---GYLPVWA-MKTV 356
L GT GY+ PE+ Q TAK DV+S GVV+LE+L+G++ D E L W+ MK
Sbjct: 1003 LAGTPGYVPPEYYQSFRCTAKGDVYSIGVVMLEILSGKRPTDKEEFGDTNLVGWSKMKAR 1062

Query: 357 AATQHGTASKSLLNGSKDSAFNISSNDASFLQSAVMDERLHASDVPTESFVHVLTLALAC 536
+ LL + N ++ V + + L +AL C
Sbjct: 1063 EGKHMEVIDEDLLKEGSSESLN--------------EKEGFEGGVIVKEMLRYLEIALRC 1108

Query: 537 VQTDPADRPSMVSVVQML 590
V P+ RP+M+ VV L
Sbjct: 1109 VDDFPSKRPNMLQVVASL 1126


>sp|Q9LYN8|EXS_ARATH Leucine-rich repeat receptor protein kinase EXS
OS=Arabidopsis thaliana GN=EXS PE=1 SV=1
Length = 1192

Score = 115 bits (288), Expect = 2e-25
Identities = 72/202 (35%), Positives = 109/202 (53%), Gaps = 5/202 (2%)
Frame = +3

Query: 3 LGIALDTAKGLEYLHHHSAEHIVHCDVKPANILLDEDFHAKVADFGLAKLVGGDAKSFAM 182
L IA+ A+GL +LHH HI+H D+K +NILLD DF KVADFGLA+L+ +S
Sbjct: 1018 LKIAVGAARGLAFLHHGFIPHIIHRDIKASNILLDGDFEPKVADFGLARLISA-CESHVS 1076

Query: 183 TTLKGTRGYLAPEWLQETSITAKSDVFSYGVVLLELLTGRQ-----CLDAERGYLPVWAM 347
T + GT GY+ PE+ Q T K DV+S+GV+LLEL+TG++ ++E G L WA+
Sbjct: 1077 TVIAGTFGYIPPEYGQSARATTKGDVYSFGVILLELVTGKEPTGPDFKESEGGNLVGWAI 1136

Query: 348 KTVAATQHGTASKSLLNGSKDSAFNISSNDASFLQSAVMDERLHASDVPTESFVHVLTLA 527
+ + G A + D + A+ + +L +L +A
Sbjct: 1137 QKI---NQGKA--------------VDVIDPLLVSVALKNSQL-----------RLLQIA 1168

Query: 528 LACVQTDPADRPSMVSVVQMLE 593
+ C+ PA RP+M+ V++ L+
Sbjct: 1169 MLCLAETPAKRPNMLDVLKALK 1190


tr_hit_id A9T3T1
Definition tr|A9T3T1|A9T3T1_PHYPA Predicted protein (Fragment) OS=Physcomitrella patens subsp. patens
Align length 206
Score (bit) 156.0
E-value 9.0e-37
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= DK950478|Adiantum capillus-veneris mRNA, clone:
TST38A01NGRL0008_M05, 5'
(644 letters)

Database: uniprot_trembl.fasta
7,341,751 sequences; 2,391,615,440 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

tr|A9T3T1|A9T3T1_PHYPA Predicted protein (Fragment) OS=Physcomit... 156 9e-37
tr|A9RE79|A9RE79_PHYPA Predicted protein OS=Physcomitrella paten... 155 2e-36
tr|A9T7Y0|A9T7Y0_PHYPA Predicted protein OS=Physcomitrella paten... 155 3e-36
tr|A7P5U0|A7P5U0_VITVI Chromosome chr4 scaffold_6, whole genome ... 154 3e-36
tr|O64477|O64477_ARATH Putative receptor-like protein kinase OS=... 152 1e-35
tr|B2Y4N4|B2Y4N4_ARAHA Putative S-locus lectin protein kinase fa... 152 1e-35
tr|A7PF57|A7PF57_VITVI Chromosome chr11 scaffold_13, whole genom... 151 4e-35
tr|Q851M7|Q851M7_ORYSJ Os03g0838100 protein OS=Oryza sativa subs... 149 1e-34
tr|A2XNU0|A2XNU0_ORYSI Putative uncharacterized protein OS=Oryza... 149 1e-34
tr|A7P1N9|A7P1N9_VITVI Chromosome chr19 scaffold_4, whole genome... 149 1e-34
tr|Q8RWZ5|Q8RWZ5_ARATH Putative S-receptor kinase OS=Arabidopsis... 149 2e-34
tr|O49361|O49361_ARATH S-receptor kinase -like protein OS=Arabid... 149 2e-34
tr|A7QLQ7|A7QLQ7_VITVI Chromosome chr18 scaffold_121, whole geno... 149 2e-34
tr|A3A014|A3A014_ORYSJ Putative uncharacterized protein OS=Oryza... 147 4e-34
tr|Q651J1|Q651J1_ORYSJ Putative receptor-like protein kinase OS=... 147 7e-34
tr|Q40713|Q40713_ORYSA Protein kinase OS=Oryza sativa PE=2 SV=1 147 7e-34
tr|Q39203|Q39203_ARATH Receptor-like protein kinase OS=Arabidops... 147 7e-34
tr|Q0DC23|Q0DC23_ORYSJ Os06g0494100 protein OS=Oryza sativa subs... 147 7e-34
tr|A5C437|A5C437_VITVI Putative uncharacterized protein OS=Vitis... 147 7e-34
tr|A3BBZ4|A3BBZ4_ORYSJ Putative uncharacterized protein OS=Oryza... 147 7e-34
tr|O82103|O82103_MAIZE S-domain receptor-like protein kinase OS=... 146 1e-33
tr|Q0JHD1|Q0JHD1_ORYSJ Os01g0870500 protein (Fragment) OS=Oryza ... 145 2e-33
tr|A3A012|A3A012_ORYSJ Putative uncharacterized protein OS=Oryza... 145 2e-33
tr|A9SE47|A9SE47_PHYPA Predicted protein (Fragment) OS=Physcomit... 145 3e-33
tr|A9TTM3|A9TTM3_PHYPA Predicted protein OS=Physcomitrella paten... 144 4e-33
tr|Q6ZF83|Q6ZF83_ORYSJ cDNA, clone: J053043L20, full insert sequ... 144 5e-33
tr|Q0D5L0|Q0D5L0_ORYSJ Os07g0553500 protein OS=Oryza sativa subs... 144 5e-33
tr|Q8LMB2|Q8LMB2_ORYSJ Putative S-receptor kinase (Putative unch... 144 6e-33
tr|A7Q3B3|A7Q3B3_VITVI Chromosome chr12 scaffold_47, whole genom... 144 6e-33
tr|A7QRC3|A7QRC3_VITVI Chromosome chr13 scaffold_149, whole geno... 143 8e-33

>tr|A9T3T1|A9T3T1_PHYPA Predicted protein (Fragment)
OS=Physcomitrella patens subsp. patens
GN=PHYPADRAFT_14536 PE=4 SV=1
Length = 307

Score = 156 bits (395), Expect = 9e-37
Identities = 91/206 (44%), Positives = 121/206 (58%), Gaps = 5/206 (2%)
Frame = +3

Query: 9 IALDTAKGLEYLHHHSAEHIVHCDVKPANILLDEDFHAKVADFGLAKLVGGDAKSFAMTT 188
+AL TAKGL YLHH E IVH D+KP NILLDE F AKV+DFGLAKL+ S +T
Sbjct: 125 VALGTAKGLAYLHHDCQERIVHLDIKPQNILLDEKFTAKVSDFGLAKLMSRSVTSQVVTQ 184

Query: 189 LKGTRGYLAPEWLQETSITAKSDVFSYGVVLLELLTGRQCL-----DAERGYLPVWAMKT 353
++GT GYLAPEWL +++T KSDV+SYG+VLLE+L+GR+ + D E+ Y P WA +
Sbjct: 185 MRGTPGYLAPEWLIFSAVTDKSDVYSYGMVLLEILSGRRNVSDVDSDVEKHYFPKWAYRK 244

Query: 354 VAATQHGTASKSLLNGSKDSAFNISSNDASFLQSAVMDERLHASDVPTESFVHVLTLALA 533
+ + G + ++ DA + D R +L +A+A
Sbjct: 245 I---EQGCSVADIV-------------DAKLCPMSEFDMR---------QADRMLRVAMA 279

Query: 534 CVQTDPADRPSMVSVVQMLEGMTEVP 611
C+Q D RPSM VVQMLEG+ +P
Sbjct: 280 CIQEDMHARPSMPLVVQMLEGVIHIP 305


>tr|A9RE79|A9RE79_PHYPA Predicted protein OS=Physcomitrella patens
subsp. patens GN=PHYPADRAFT_64940 PE=4 SV=1
Length = 834

Score = 155 bits (392), Expect = 2e-36
Identities = 90/214 (42%), Positives = 117/214 (54%), Gaps = 5/214 (2%)
Frame = +3

Query: 9 IALDTAKGLEYLHHHSAEHIVHCDVKPANILLDEDFHAKVADFGLAKLVGGDAKSFAMTT 188
IAL TA+G+ YLH E IVHCD+KP NILLDE F KV+DFGLAKL+G + +TT
Sbjct: 643 IALGTARGIMYLHEECRECIVHCDIKPENILLDETFCPKVSDFGLAKLLGLRNRERHITT 702

Query: 189 LKGTRGYLAPEWLQETSITAKSDVFSYGVVLLELLTGRQCLD-----AERGYLPVWAMKT 353
++GTRGYLAPEW +TAK+DV+SYG+VLLEL+ GR+ LD AE P W +
Sbjct: 703 IRGTRGYLAPEWSASLPLTAKADVYSYGMVLLELVVGRRTLDDMAGEAELIRFPKWVFRD 762

Query: 354 VAATQHGTASKSLLNGSKDSAFNISSNDASFLQSAVMDERLHASDVPTESFVHVLTLALA 533
+ D S ++ R V + F + A
Sbjct: 763 MI-------------------------DGSLVKRTKEQARKLGQSVDLDQFERTIFTAFW 797

Query: 534 CVQTDPADRPSMVSVVQMLEGMTEVPYSLQGLKL 635
C+Q +P RPSM VVQMLEG+ V + L+ L +
Sbjct: 798 CIQDEPTARPSMGKVVQMLEGIIPVDFPLEPLNI 831


>tr|A9T7Y0|A9T7Y0_PHYPA Predicted protein OS=Physcomitrella patens
subsp. patens GN=PHYPADRAFT_141554 PE=4 SV=1
Length = 799

Score = 155 bits (391), Expect = 3e-36
Identities = 85/206 (41%), Positives = 119/206 (57%), Gaps = 4/206 (1%)
Frame = +3

Query: 3 LGIALDTAKGLEYLHHHSAEHIVHCDVKPANILLDEDFHAKVADFGLAKLVGGDAKSFAM 182
+ +AL A+G+ YLHH I+HCDVKP NILL DF KVADFGLAKL+G D S +
Sbjct: 572 MAVALGAARGIAYLHHECRSSIIHCDVKPENILLSGDFTPKVADFGLAKLMGKDV-SRLI 630

Query: 183 TTLKGTRGYLAPEWLQETSITAKSDVFSYGVVLLELLTGRQCLD----AERGYLPVWAMK 350
T ++GTRGYLAPEWL ++T+K DV+SYG+ LLE+++GR+ +D A++ + VWA K
Sbjct: 631 TNIRGTRGYLAPEWLTNCTLTSKVDVYSYGMTLLEIISGRRTVDLSYPADKWFYAVWAYK 690

Query: 351 TVAATQHGTASKSLLNGSKDSAFNISSNDASFLQSAVMDERLHASDVPTESFVHVLTLAL 530
++ + T +++D+RL V E L + L
Sbjct: 691 EISKGRDLT--------------------------SLVDDRLAKGSVDAEELRRALHVGL 724

Query: 531 ACVQTDPADRPSMVSVVQMLEGMTEV 608
C Q DP RP+M V +MLEG+ +V
Sbjct: 725 WCTQDDPVKRPNMRDVEKMLEGVLDV 750


>tr|A7P5U0|A7P5U0_VITVI Chromosome chr4 scaffold_6, whole genome
shotgun sequence OS=Vitis vinifera GN=GSVIVT00032659001
PE=4 SV=1
Length = 790

Score = 154 bits (390), Expect = 3e-36
Identities = 88/205 (42%), Positives = 122/205 (59%), Gaps = 4/205 (1%)
Frame = +3

Query: 9 IALDTAKGLEYLHHHSAEHIVHCDVKPANILLDEDFHAKVADFGLAKLVGGDAKSFAMTT 188
IAL TAKGL YLH I+HCD+KP N+LLD+++HAKV+DFGLAKL+ + +S TT
Sbjct: 568 IALGTAKGLSYLHEDCDAKIIHCDIKPENVLLDDNYHAKVSDFGLAKLMTRE-QSHVFTT 626

Query: 189 LKGTRGYLAPEWLQETSITAKSDVFSYGVVLLELLTGRQCLD----AERGYLPVWAMKTV 356
L+GTRGYLAPEW+ +I+ KSDV+SYG+VLLE++ GR+ D +E+ + P +A K +
Sbjct: 627 LRGTRGYLAPEWITNYAISEKSDVYSYGMVLLEIIGGRKNYDPSEISEKSHFPTYAFKMM 686

Query: 357 AATQHGTASKSLLNGSKDSAFNISSNDASFLQSAVMDERLHASDVPTESFVHVLTLALAC 536
+ L DS + DER+ + + +A+ C
Sbjct: 687 --------EEGKLRDLLDSRLEVDEE----------DERVSTA----------IKVAMWC 718

Query: 537 VQTDPADRPSMVSVVQMLEGMTEVP 611
+Q D RPSM+ VVQMLEG+ VP
Sbjct: 719 IQEDMHQRPSMMKVVQMLEGLCAVP 743


>tr|O64477|O64477_ARATH Putative receptor-like protein kinase
OS=Arabidopsis thaliana GN=At2g19130 PE=2 SV=1
Length = 828

Score = 152 bits (385), Expect = 1e-35
Identities = 91/220 (41%), Positives = 124/220 (56%), Gaps = 9/220 (4%)
Frame = +3

Query: 9 IALDTAKGLEYLHHHSAEHIVHCDVKPANILLDEDFHAKVADFGLAKLVGGDAKSFAMTT 188
IAL TA+GL YLH + I+HCD+KP NILLD F KVADFGLAKLVG D S +TT
Sbjct: 596 IALGTARGLAYLHDECRDCIIHCDIKPENILLDSQFCPKVADFGLAKLVGRDF-SRVLTT 654

Query: 189 LKGTRGYLAPEWLQETSITAKSDVFSYGVVLLELLTGRQCLDAERG----YLPVWAMKTV 356
++GTRGYLAPEW+ +ITAK+DV+SYG++L EL++GR+ + + P WA +
Sbjct: 655 MRGTRGYLAPEWISGVAITAKADVYSYGMMLFELVSGRRNTEQSENEKVRFFPSWAATIL 714

Query: 357 AATQHGTASKSLLNGSKDSAFNISSNDASFLQSAVMDERLHASDVPTESFVHVLTLALAC 536
+KD +++D RL V E +A C
Sbjct: 715 ---------------TKDGDIR-----------SLVDPRLEGDAVDIEEVTRACKVACWC 748

Query: 537 VQTDPADRPSMVSVVQMLEGMTEV-----PYSLQGLKLSE 641
+Q + + RP+M VVQ+LEG+ EV P S+Q L +S+
Sbjct: 749 IQDEESHRPAMSQVVQILEGVLEVNPPPFPRSIQALVVSD 788


>tr|B2Y4N4|B2Y4N4_ARAHA Putative S-locus lectin protein kinase family
protein OS=Arabidopsis halleri subsp. halleri GN=17L07.5
PE=4 SV=1
Length = 828

Score = 152 bits (385), Expect = 1e-35
Identities = 89/216 (41%), Positives = 122/216 (56%), Gaps = 9/216 (4%)
Frame = +3

Query: 9 IALDTAKGLEYLHHHSAEHIVHCDVKPANILLDEDFHAKVADFGLAKLVGGDAKSFAMTT 188
IAL TA+GL YLH + I+HCD+KP NILLD F KVADFGLAKLVG D S +TT
Sbjct: 596 IALGTARGLAYLHDECRDCIIHCDIKPENILLDSQFCPKVADFGLAKLVGRDF-SRVLTT 654

Query: 189 LKGTRGYLAPEWLQETSITAKSDVFSYGVVLLELLTGRQCLDAERG----YLPVWAMKTV 356
++GTRGYLAPEW+ +ITAK+DV+SYG++L EL++GR+ + + P WA +
Sbjct: 655 MRGTRGYLAPEWISGVAITAKADVYSYGMMLFELVSGRRNTEQSENEKVRFFPSWAATIL 714

Query: 357 AATQHGTASKSLLNGSKDSAFNISSNDASFLQSAVMDERLHASDVPTESFVHVLTLALAC 536
+KD +++D RL +V E +A C
Sbjct: 715 ---------------TKDGDIR-----------SLLDPRLEGDEVDIEELTRACKVACWC 748

Query: 537 VQTDPADRPSMVSVVQMLEGMTEV-----PYSLQGL 629
+Q + + RP+M +VQ+LEG+ EV P S+Q L
Sbjct: 749 IQDEESHRPAMSQIVQILEGVLEVNPPPFPRSIQAL 784


>tr|A7PF57|A7PF57_VITVI Chromosome chr11 scaffold_13, whole genome
shotgun sequence OS=Vitis vinifera GN=GSVIVT00016916001
PE=4 SV=1
Length = 812

Score = 151 bits (381), Expect = 4e-35
Identities = 89/205 (43%), Positives = 128/205 (62%), Gaps = 4/205 (1%)
Frame = +3

Query: 9 IALDTAKGLEYLHHHSAEHIVHCDVKPANILLDEDFHAKVADFGLAKLVGGDAKSFAMTT 188
IAL TAKGL YLH + IVHCD+KP N+LLD+++ AKV+DFGLAKL+ + +S +TT
Sbjct: 590 IALGTAKGLAYLHDGCSVKIVHCDIKPENVLLDDNYQAKVSDFGLAKLMTRE-QSRVVTT 648

Query: 189 LKGTRGYLAPEWLQETSITAKSDVFSYGVVLLELLTGRQCLD----AERGYLPVWAMKTV 356
++GTRGYLAPEW+ + +I+ KSDV+S+G+VLLE++ GR+ D +E+ Y P +A+K +
Sbjct: 649 IRGTRGYLAPEWVTDYAISEKSDVYSFGMVLLEIIGGRRNFDPEENSEKAYFPSFALKMM 708

Query: 357 AATQHGTASKSLLNGSKDSAFNISSNDASFLQSAVMDERLHASDVPTESFVHVLTLALAC 536
+ G K + DS I + DER++ + + +AL C
Sbjct: 709 ---EEGKPEKIV-----DSKLKIEED----------DERVYTA----------IKVALWC 740

Query: 537 VQTDPADRPSMVSVVQMLEGMTEVP 611
+Q + + RPSM VVQMLEG VP
Sbjct: 741 IQGNMSQRPSMAKVVQMLEGSCVVP 765


>tr|Q851M7|Q851M7_ORYSJ Os03g0838100 protein OS=Oryza sativa subsp.
japonica GN=OSJNBa0042I09.17 PE=2 SV=1
Length = 858

Score = 149 bits (377), Expect = 1e-34
Identities = 85/201 (42%), Positives = 119/201 (59%), Gaps = 1/201 (0%)
Frame = +3

Query: 9 IALDTAKGLEYLHHHSAEHIVHCDVKPANILLDEDFHAKVADFGLAKLVG-GDAKSFAMT 185
+A+ TA+G+ YLH + IVHCD+KP NILLDE +AKV+DFGLAKLV D + +T
Sbjct: 596 VAVGTARGITYLHEECRDCIVHCDIKPENILLDEHHNAKVSDFGLAKLVNPKDHRHRTLT 655

Query: 186 TLKGTRGYLAPEWLQETSITAKSDVFSYGVVLLELLTGRQCLDAERGYLPVWAMKTVAAT 365
+++GTRGYLAPEWL ITAKSDV+SYG+VLLEL++G + D +
Sbjct: 656 SVRGTRGYLAPEWLANLPITAKSDVYSYGMVLLELVSGHRNFD--------------VSE 701

Query: 366 QHGTASKSLLNGSKDSAFNISSNDASFLQSAVMDERLHASDVPTESFVHVLTLALACVQT 545
+ G S+ + NI +A++D++L D+ L ++ C+Q
Sbjct: 702 ETGRKKYSVWAYEEYEKGNI---------AAIVDKKLPGEDIDMVQVERALQVSFWCIQE 752

Query: 546 DPADRPSMVSVVQMLEGMTEV 608
PA RPSM VVQMLEG+ ++
Sbjct: 753 QPAQRPSMGKVVQMLEGIMDL 773


>tr|A2XNU0|A2XNU0_ORYSI Putative uncharacterized protein OS=Oryza
sativa subsp. indica GN=OsI_14238 PE=4 SV=1
Length = 859

Score = 149 bits (377), Expect = 1e-34
Identities = 85/201 (42%), Positives = 119/201 (59%), Gaps = 1/201 (0%)
Frame = +3

Query: 9 IALDTAKGLEYLHHHSAEHIVHCDVKPANILLDEDFHAKVADFGLAKLVG-GDAKSFAMT 185
+A+ TA+G+ YLH + IVHCD+KP NILLDE +AKV+DFGLAKLV D + +T
Sbjct: 597 VAVGTARGITYLHEECRDCIVHCDIKPENILLDEHHNAKVSDFGLAKLVNPKDHRHRTLT 656

Query: 186 TLKGTRGYLAPEWLQETSITAKSDVFSYGVVLLELLTGRQCLDAERGYLPVWAMKTVAAT 365
+++GTRGYLAPEWL ITAKSDV+SYG+VLLEL++G + D +
Sbjct: 657 SVRGTRGYLAPEWLANLPITAKSDVYSYGMVLLELVSGHRNFD--------------VSE 702

Query: 366 QHGTASKSLLNGSKDSAFNISSNDASFLQSAVMDERLHASDVPTESFVHVLTLALACVQT 545
+ G S+ + NI +A++D++L D+ L ++ C+Q
Sbjct: 703 ETGRKKYSVWAYEEYEKGNI---------AAIVDKKLPGEDIDMVQVERALQVSFWCIQE 753

Query: 546 DPADRPSMVSVVQMLEGMTEV 608
PA RPSM VVQMLEG+ ++
Sbjct: 754 QPAQRPSMGKVVQMLEGIMDL 774


>tr|A7P1N9|A7P1N9_VITVI Chromosome chr19 scaffold_4, whole genome
shotgun sequence OS=Vitis vinifera GN=GSVIVT00027694001
PE=4 SV=1
Length = 769

Score = 149 bits (376), Expect = 1e-34
Identities = 88/204 (43%), Positives = 118/204 (57%), Gaps = 4/204 (1%)
Frame = +3

Query: 9 IALDTAKGLEYLHHHSAEHIVHCDVKPANILLDEDFHAKVADFGLAKLVGGDAKSFAMTT 188
IAL A+GLEYLH + I+HCD+KP NILLD ++ K++DFGLAKL+G D S +TT
Sbjct: 569 IALGIARGLEYLHEKCRDCIIHCDIKPENILLDAGYNPKISDFGLAKLLGRDF-SRVLTT 627

Query: 189 LKGTRGYLAPEWLQETSITAKSDVFSYGVVLLELLTGRQCL----DAERGYLPVWAMKTV 356
+KGTRGYLAPEW+ +ITAK+DVFSYG++L E+++GR+ D Y P MK +
Sbjct: 628 VKGTRGYLAPEWISGIAITAKADVFSYGMMLFEIISGRRNWEIKDDRMNDYFPAQVMKKL 687

Query: 357 AATQHGTASKSLLNGSKDSAFNISSNDASFLQSAVMDERLHASDVPTESFVHVLTLALAC 536
+ + LL ++DE+L + E V +A C
Sbjct: 688 ------SRGEELL--------------------TLLDEKLE-QNADIEELTRVCKVACWC 720

Query: 537 VQTDPADRPSMVSVVQMLEGMTEV 608
+Q D DRPSM SVVQ+LEG V
Sbjct: 721 IQDDEGDRPSMKSVVQILEGALNV 744