DK950483
Clone id TST38A01NGRL0008_M10
Library
Length 627
Definition Adiantum capillus-veneris mRNA. clone: TST38A01NGRL0008_M10. 5' end sequence.
Accession
Tissue type prothallia
Developmental stage gametophyte
Contig ID
Sequence
CGCTCCTCTCCCTTTGAACCTCATCGGATTAACCCACCATGAGCACTGAGAAGGAGCGCG
AAAGCCATGTCTACATGGCTAAGCTCGCCGAGCAGGCCGAGCGTTACGACGAGATGGTGG
AATCCATGAAAAAGGTGGCAAAGCTAGATGTTGAACTTACAGTGGAAGAGAGGAATTTGC
TGTCTGTTGGTTACAAGAACGTGATTGGTGCCCGGCGTGCATCCTGGAGGATTTTGTCGT
CCATTGAGCAGAAAGAGGAAGCCAAAGGTAATGAACACAATGTGAAGAGGATCAAGGAAT
ACCGCAACAAGGTTGAGGAGGAACTTTCCAAGATCTGTAATGACATCTTGATGATTATTG
ATGAGCACCTTATCCCATCTTCGGGAACTGGAGAGTCTACAGTCTTCTATTACAAGATGA
AAGGAGACTATTTCCGGTATCTTGCTGAGTTCAAAACCAGCAGTGAACGGAAAGAGGCTG
CCGATCAATCGTTGAAAGCATACCAGGCTGCGTCCAACACGGCTGGAACTGACCTACCTC
CAACTCACCCCATTCGACTTGGTCTAGCATTGAACTTTTCGGTATTTTACTATGAAATTA
TGAACTCTCCAGAGAGAGCTTGCCATC
■■Homology search results ■■ -
sp_hit_id P93212
Definition sp|P93212|14337_SOLLC 14-3-3 protein 7 OS=Solanum lycopersicum
Align length 193
Score (bit) 325.0
E-value 9.0e-89
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= DK950483|Adiantum capillus-veneris mRNA, clone:
TST38A01NGRL0008_M10, 5'
(627 letters)

Database: uniprot_sprot.fasta
412,525 sequences; 148,809,765 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

sp|P93212|14337_SOLLC 14-3-3 protein 7 OS=Solanum lycopersicum G... 325 9e-89
sp|Q96453|1433D_SOYBN 14-3-3-like protein D OS=Glycine max GN=GF... 323 3e-88
sp|P42654|1433B_VICFA 14-3-3-like protein B OS=Vicia faba PE=2 SV=1 318 1e-86
sp|Q9C5W6|14312_ARATH 14-3-3-like protein GF14 iota OS=Arabidops... 318 2e-86
sp|Q9S9Z8|14311_ARATH 14-3-3-like protein GF14 omicron OS=Arabid... 316 5e-86
sp|P93214|14339_SOLLC 14-3-3 protein 9 OS=Solanum lycopersicum G... 312 8e-85
sp|Q96452|1433C_SOYBN 14-3-3-like protein C OS=Glycine max GN=GF... 309 7e-84
sp|P93213|14338_SOLLC 14-3-3 protein 8 OS=Solanum lycopersicum G... 307 3e-83
sp|P48347|14310_ARATH 14-3-3-like protein GF14 epsilon OS=Arabid... 306 4e-83
sp|Q41246|1433_TOBAC 14-3-3-like protein OS=Nicotiana tabacum PE... 306 6e-83
sp|Q96299|14339_ARATH 14-3-3-like protein GF14 mu OS=Arabidopsis... 305 2e-82
sp|P54632|1433_DICDI 14-3-3-like protein OS=Dictyostelium discoi... 300 4e-81
sp|P52908|1433_CHLRE 14-3-3-like protein OS=Chlamydomonas reinha... 297 3e-80
sp|P62262|1433E_SHEEP 14-3-3 protein epsilon OS=Ovis aries GN=YW... 291 2e-78
sp|P62260|1433E_RAT 14-3-3 protein epsilon OS=Rattus norvegicus ... 291 2e-78
sp|P62259|1433E_MOUSE 14-3-3 protein epsilon OS=Mus musculus GN=... 291 2e-78
sp|P62258|1433E_HUMAN 14-3-3 protein epsilon OS=Homo sapiens GN=... 291 2e-78
sp|Q5ZMT0|1433E_CHICK 14-3-3 protein epsilon OS=Gallus gallus GN... 291 2e-78
sp|P62261|1433E_BOVIN 14-3-3 protein epsilon OS=Bos taurus GN=YW... 291 2e-78
sp|P92177|1433E_DROME 14-3-3 protein epsilon OS=Drosophila melan... 287 3e-77
sp|O42766|1433_CANAL 14-3-3 protein homolog OS=Candida albicans ... 286 5e-77
sp|Q99002|1433_TRIHA 14-3-3 protein homolog OS=Trichoderma harzi... 278 1e-74
sp|P93259|1433_MESCR 14-3-3-like protein OS=Mesembryanthemum cry... 278 2e-74
sp|Q6EUP4|14335_ORYSJ 14-3-3-like protein GF14-E OS=Oryza sativa... 278 2e-74
sp|Q6ZKC0|14333_ORYSJ 14-3-3-like protein GF14-C OS=Oryza sativa... 278 2e-74
sp|Q41418|14331_SOLTU 14-3-3-like protein OS=Solanum tuberosum P... 277 4e-74
sp|Q7XTE8|14332_ORYSJ 14-3-3-like protein GF14-B OS=Oryza sativa... 276 6e-74
sp|P93208|14332_SOLLC 14-3-3 protein 2 OS=Solanum lycopersicum G... 276 8e-74
sp|P42656|RAD24_SCHPO DNA damage checkpoint protein rad24 OS=Sch... 275 1e-73
sp|P93343|1433C_TOBAC 14-3-3-like protein C OS=Nicotiana tabacum... 275 1e-73

>sp|P93212|14337_SOLLC 14-3-3 protein 7 OS=Solanum lycopersicum
GN=TFT7 PE=2 SV=2
Length = 252

Score = 325 bits (834), Expect = 9e-89
Identities = 157/193 (81%), Positives = 179/193 (92%)
Frame = +3

Query: 48 EKERESHVYMAKLAEQAERYDEMVESMKKVAKLDVELTVEERNLLSVGYKNVIGARRASW 227
EKERE VY+A+LAEQAERYDEMVE+MK +AK+DVELTVEERNL+SVGYKNVIGARRASW
Sbjct: 2 EKEREKQVYLARLAEQAERYDEMVEAMKAIAKMDVELTVEERNLVSVGYKNVIGARRASW 61

Query: 228 RILSSIEQKEEAKGNEHNVKRIKEYRNKVEEELSKICNDILMIIDEHLIPSSGTGESTVF 407
RILSSIEQKEE+KG+E NVKRIK YR +VE+EL+KIC+DIL +IDEHL+PSS TGESTVF
Sbjct: 62 RILSSIEQKEESKGHEQNVKRIKTYRQRVEDELTKICSDILSVIDEHLVPSSTTGESTVF 121

Query: 408 YYKMKGDYFRYLAEFKTSSERKEAADQSLKAYQAASNTAGTDLPPTHPIRLGLALNFSVF 587
YYKMKGDY+RYLAEFK +RKEA++QSLKAY+AA+ TA +DL PTHPIRLGLALNFSVF
Sbjct: 122 YYKMKGDYYRYLAEFKAGDDRKEASEQSLKAYEAATATASSDLAPTHPIRLGLALNFSVF 181

Query: 588 YYEIMNSPERACH 626
YYEI+NSPERACH
Sbjct: 182 YYEILNSPERACH 194


>sp|Q96453|1433D_SOYBN 14-3-3-like protein D OS=Glycine max GN=GF14D
PE=2 SV=1
Length = 261

Score = 323 bits (829), Expect = 3e-88
Identities = 158/192 (82%), Positives = 175/192 (91%)
Frame = +3

Query: 51 KERESHVYMAKLAEQAERYDEMVESMKKVAKLDVELTVEERNLLSVGYKNVIGARRASWR 230
K+RE+ VY+AKLAEQAERY+EMVESMK VA LDVELTVEERNLLSVGYKNVIGARRASWR
Sbjct: 5 KDRENFVYIAKLAEQAERYEEMVESMKNVANLDVELTVEERNLLSVGYKNVIGARRASWR 64

Query: 231 ILSSIEQKEEAKGNEHNVKRIKEYRNKVEEELSKICNDILMIIDEHLIPSSGTGESTVFY 410
ILSSIEQKEE KGNE N KRIKEYR KVE ELS ICND++ +IDEHLIPS+ GESTVFY
Sbjct: 65 ILSSIEQKEETKGNELNAKRIKEYRQKVELELSNICNDVMRVIDEHLIPSAAAGESTVFY 124

Query: 411 YKMKGDYFRYLAEFKTSSERKEAADQSLKAYQAASNTAGTDLPPTHPIRLGLALNFSVFY 590
YKMKGDY+RYLAEFK+ +E+KEAADQS+KAY++A+ A DLPPTHPIRLGLALNFSVFY
Sbjct: 125 YKMKGDYYRYLAEFKSGNEKKEAADQSMKAYESATAAAEADLPPTHPIRLGLALNFSVFY 184

Query: 591 YEIMNSPERACH 626
YEI+NSPERACH
Sbjct: 185 YEILNSPERACH 196


>sp|P42654|1433B_VICFA 14-3-3-like protein B OS=Vicia faba PE=2 SV=1
Length = 261

Score = 318 bits (815), Expect = 1e-86
Identities = 153/192 (79%), Positives = 175/192 (91%)
Frame = +3

Query: 51 KERESHVYMAKLAEQAERYDEMVESMKKVAKLDVELTVEERNLLSVGYKNVIGARRASWR 230
K+RE+ VY+AKLAEQAERY+EMV+SMK VA LDVELT+EERNLLSVGYKNVIGARRASWR
Sbjct: 5 KDRENFVYIAKLAEQAERYEEMVDSMKNVANLDVELTIEERNLLSVGYKNVIGARRASWR 64

Query: 231 ILSSIEQKEEAKGNEHNVKRIKEYRNKVEEELSKICNDILMIIDEHLIPSSGTGESTVFY 410
ILSSIEQKEE+KGN+ N KRIKEYR+KVE ELS IC D++ +IDEHLIPS+ GESTVFY
Sbjct: 65 ILSSIEQKEESKGNDVNAKRIKEYRHKVETELSNICIDVMRVIDEHLIPSAAAGESTVFY 124

Query: 411 YKMKGDYFRYLAEFKTSSERKEAADQSLKAYQAASNTAGTDLPPTHPIRLGLALNFSVFY 590
YKMKGDY+RYLAEFKT +E+KEA DQS+KAY++A+ A +LPPTHPIRLGLALNFSVFY
Sbjct: 125 YKMKGDYYRYLAEFKTGNEKKEAGDQSMKAYESATTAAEAELPPTHPIRLGLALNFSVFY 184

Query: 591 YEIMNSPERACH 626
YEI+NSPERACH
Sbjct: 185 YEILNSPERACH 196


>sp|Q9C5W6|14312_ARATH 14-3-3-like protein GF14 iota OS=Arabidopsis
thaliana GN=GRF12 PE=2 SV=1
Length = 268

Score = 318 bits (814), Expect = 2e-86
Identities = 155/193 (80%), Positives = 176/193 (91%)
Frame = +3

Query: 48 EKERESHVYMAKLAEQAERYDEMVESMKKVAKLDVELTVEERNLLSVGYKNVIGARRASW 227
+KERE+ VYMAKL+EQAERYDEMVE+MKKVA+++ ELTVEERNLLSVGYKNVIGARRASW
Sbjct: 7 DKERETFVYMAKLSEQAERYDEMVETMKKVARVNSELTVEERNLLSVGYKNVIGARRASW 66

Query: 228 RILSSIEQKEEAKGNEHNVKRIKEYRNKVEEELSKICNDILMIIDEHLIPSSGTGESTVF 407
RI+SSIEQKEE+KGNE NVK+IK YR KVE+EL+ IC DIL IID+HLIP + +GE+TVF
Sbjct: 67 RIMSSIEQKEESKGNESNVKQIKGYRQKVEDELANICQDILTIIDQHLIPHATSGEATVF 126

Query: 408 YYKMKGDYFRYLAEFKTSSERKEAADQSLKAYQAASNTAGTDLPPTHPIRLGLALNFSVF 587
YYKMKGDY+RYLAEFKT ERKEAA+QSLK Y+AA+ A T+LP THPIRLGLALNFSVF
Sbjct: 127 YYKMKGDYYRYLAEFKTEQERKEAAEQSLKGYEAATQAASTELPSTHPIRLGLALNFSVF 186

Query: 588 YYEIMNSPERACH 626
YYEIMNSPERACH
Sbjct: 187 YYEIMNSPERACH 199


>sp|Q9S9Z8|14311_ARATH 14-3-3-like protein GF14 omicron
OS=Arabidopsis thaliana GN=GRF11 PE=2 SV=1
Length = 241

Score = 316 bits (810), Expect = 5e-86
Identities = 155/193 (80%), Positives = 175/193 (90%)
Frame = +3

Query: 48 EKERESHVYMAKLAEQAERYDEMVESMKKVAKLDVELTVEERNLLSVGYKNVIGARRASW 227
E ER VY+AKL EQAERYDEMVE+MKKVA LDVELT+EERNLLSVGYKNVIGARRASW
Sbjct: 2 ENERAKQVYLAKLNEQAERYDEMVEAMKKVAALDVELTIEERNLLSVGYKNVIGARRASW 61

Query: 228 RILSSIEQKEEAKGNEHNVKRIKEYRNKVEEELSKICNDILMIIDEHLIPSSGTGESTVF 407
RILSSIEQKEE+KGNE N KRIK+YR KVEEELSKIC DIL +ID+HL+P + +GESTVF
Sbjct: 62 RILSSIEQKEESKGNEQNAKRIKDYRTKVEEELSKICYDILAVIDKHLVPFATSGESTVF 121

Query: 408 YYKMKGDYFRYLAEFKTSSERKEAADQSLKAYQAASNTAGTDLPPTHPIRLGLALNFSVF 587
YYKMKGDYFRYLAEFK+ ++R+EAAD SLKAY+AA+++A T+L THPIRLGLALNFSVF
Sbjct: 122 YYKMKGDYFRYLAEFKSGADREEAADLSLKAYEAATSSASTELSTTHPIRLGLALNFSVF 181

Query: 588 YYEIMNSPERACH 626
YYEI+NSPERACH
Sbjct: 182 YYEILNSPERACH 194


>sp|P93214|14339_SOLLC 14-3-3 protein 9 OS=Solanum lycopersicum
GN=TFT9 PE=2 SV=2
Length = 261

Score = 312 bits (800), Expect = 8e-85
Identities = 151/192 (78%), Positives = 172/192 (89%)
Frame = +3

Query: 51 KERESHVYMAKLAEQAERYDEMVESMKKVAKLDVELTVEERNLLSVGYKNVIGARRASWR 230
KERE+ VY+AKLAEQAERYDEMVE+MK VA +DVELTVEERNLLSVGYKNV+G+RRASWR
Sbjct: 5 KERENFVYVAKLAEQAERYDEMVEAMKNVANMDVELTVEERNLLSVGYKNVVGSRRASWR 64

Query: 231 ILSSIEQKEEAKGNEHNVKRIKEYRNKVEEELSKICNDILMIIDEHLIPSSGTGESTVFY 410
ILSSIEQKEE++GNE NVKRIKEY KVE EL+ ICNDI+++ID+HLIPS GESTVFY
Sbjct: 65 ILSSIEQKEESRGNEQNVKRIKEYLQKVESELTNICNDIMVVIDQHLIPSCSAGESTVFY 124

Query: 411 YKMKGDYFRYLAEFKTSSERKEAADQSLKAYQAASNTAGTDLPPTHPIRLGLALNFSVFY 590
+KMKGDY+RYLAEFK +++KE A+ SLKAYQAA+ A +L PTHPIRLGLALNFSVFY
Sbjct: 125 HKMKGDYYRYLAEFKAGNDKKEVAELSLKAYQAATTAAEAELAPTHPIRLGLALNFSVFY 184

Query: 591 YEIMNSPERACH 626
YEIMNSPERACH
Sbjct: 185 YEIMNSPERACH 196


>sp|Q96452|1433C_SOYBN 14-3-3-like protein C OS=Glycine max GN=GF14C
PE=2 SV=1
Length = 258

Score = 309 bits (792), Expect = 7e-84
Identities = 153/192 (79%), Positives = 173/192 (90%)
Frame = +3

Query: 51 KERESHVYMAKLAEQAERYDEMVESMKKVAKLDVELTVEERNLLSVGYKNVIGARRASWR 230
KERE+ VY+AKLAEQAERY+EMVE+MK VA L+VELTVEERNLLSVGYKNV+GARRASWR
Sbjct: 5 KERENFVYVAKLAEQAERYEEMVEAMKNVANLNVELTVEERNLLSVGYKNVVGARRASWR 64

Query: 231 ILSSIEQKEEAKGNEHNVKRIKEYRNKVEEELSKICNDILMIIDEHLIPSSGTGESTVFY 410
ILSSIEQKEEAKGN+ +VKRIKEYR KVE ELS IC+DI+ +IDE+LIPSS +GE +VF+
Sbjct: 65 ILSSIEQKEEAKGNDVSVKRIKEYRLKVESELSNICSDIMTVIDEYLIPSSSSGEPSVFF 124

Query: 411 YKMKGDYFRYLAEFKTSSERKEAADQSLKAYQAASNTAGTDLPPTHPIRLGLALNFSVFY 590
YKMKGDY+RYLAEFK+ ERKEAAD S+KAYQ AS TA +L THPIRLGLALNFSVFY
Sbjct: 125 YKMKGDYYRYLAEFKSGDERKEAADHSMKAYQLASTTAEAELASTHPIRLGLALNFSVFY 184

Query: 591 YEIMNSPERACH 626
YEI+NSPERACH
Sbjct: 185 YEILNSPERACH 196


>sp|P93213|14338_SOLLC 14-3-3 protein 8 OS=Solanum lycopersicum
GN=TFT8 PE=2 SV=2
Length = 261

Score = 307 bits (787), Expect = 3e-83
Identities = 151/191 (79%), Positives = 170/191 (89%)
Frame = +3

Query: 51 KERESHVYMAKLAEQAERYDEMVESMKKVAKLDVELTVEERNLLSVGYKNVIGARRASWR 230
KERES VY+A+LAEQAERYDEMV++MK VA LDVELTVEERNLLSVGYKNV+G+RRASWR
Sbjct: 5 KERESLVYIARLAEQAERYDEMVDAMKNVANLDVELTVEERNLLSVGYKNVVGSRRASWR 64

Query: 231 ILSSIEQKEEAKGNEHNVKRIKEYRNKVEEELSKICNDILMIIDEHLIPSSGTGESTVFY 410
ILSSIEQKE+A+GNE NVKRI+ YR KVE EL+ ICN+I+ +IDEHLIPS GESTVFY
Sbjct: 65 ILSSIEQKEDARGNEQNVKRIQGYRQKVESELTDICNNIMTVIDEHLIPSCTAGESTVFY 124

Query: 411 YKMKGDYFRYLAEFKTSSERKEAADQSLKAYQAASNTAGTDLPPTHPIRLGLALNFSVFY 590
YKMKGDY+RYLAEFKT ++KE +D SLKAYQ A+ TA +LP THPIRLGLALNFSVFY
Sbjct: 125 YKMKGDYYRYLAEFKTGDDKKEVSDLSLKAYQTATTTAEAELPITHPIRLGLALNFSVFY 184

Query: 591 YEIMNSPERAC 623
YEIMNSPERAC
Sbjct: 185 YEIMNSPERAC 195


>sp|P48347|14310_ARATH 14-3-3-like protein GF14 epsilon
OS=Arabidopsis thaliana GN=GRF10 PE=2 SV=1
Length = 254

Score = 306 bits (785), Expect = 4e-83
Identities = 149/192 (77%), Positives = 171/192 (89%)
Frame = +3

Query: 48 EKERESHVYMAKLAEQAERYDEMVESMKKVAKLDVELTVEERNLLSVGYKNVIGARRASW 227
E ERE VY+AKL+EQ ERYDEMVE+MKKVA+LDVELTVEERNL+SVGYKNVIGARRASW
Sbjct: 2 ENEREKQVYLAKLSEQTERYDEMVEAMKKVAQLDVELTVEERNLVSVGYKNVIGARRASW 61

Query: 228 RILSSIEQKEEAKGNEHNVKRIKEYRNKVEEELSKICNDILMIIDEHLIPSSGTGESTVF 407
RILSSIEQKEE+KGN+ NVKR+K YR +VE+EL+K+CNDIL +ID+HLIPSS ESTVF
Sbjct: 62 RILSSIEQKEESKGNDENVKRLKNYRKRVEDELAKVCNDILSVIDKHLIPSSNAVESTVF 121

Query: 408 YYKMKGDYFRYLAEFKTSSERKEAADQSLKAYQAASNTAGTDLPPTHPIRLGLALNFSVF 587
+YKMKGDY+RYLAEF + +ERKEAADQSL+AY+AA A L PTHP+RLGLALNFSVF
Sbjct: 122 FYKMKGDYYRYLAEFSSGAERKEAADQSLEAYKAAVAAAENGLAPTHPVRLGLALNFSVF 181

Query: 588 YYEIMNSPERAC 623
YYEI+NSPE AC
Sbjct: 182 YYEILNSPESAC 193


>sp|Q41246|1433_TOBAC 14-3-3-like protein OS=Nicotiana tabacum PE=2
SV=1
Length = 251

Score = 306 bits (784), Expect = 6e-83
Identities = 151/193 (78%), Positives = 174/193 (90%)
Frame = +3

Query: 48 EKERESHVYMAKLAEQAERYDEMVESMKKVAKLDVELTVEERNLLSVGYKNVIGARRASW 227
+KERE VY+A+LAEQAERYDEMVE+MK VAK+DVELTVEERNL+SVGYKNVIGARRASW
Sbjct: 2 DKEREKQVYLARLAEQAERYDEMVEAMKTVAKMDVELTVEERNLVSVGYKNVIGARRASW 61

Query: 228 RILSSIEQKEEAKGNEHNVKRIKEYRNKVEEELSKICNDILMIIDEHLIPSSGTGESTVF 407
RILSSIEQKEE+KG++ NVKRIK Y+ +VE+EL+K L +IDEH++PSS +GESTVF
Sbjct: 62 RILSSIEQKEESKGHDQNVKRIKTYQQRVEDELTKYALT-LSVIDEHVVPSSTSGESTVF 120

Query: 408 YYKMKGDYFRYLAEFKTSSERKEAADQSLKAYQAASNTAGTDLPPTHPIRLGLALNFSVF 587
YYKMKGDY+RYLAEFK+ +RKEAADQSLKAY+AA+ TA DL PTHPIRLGLALNFSVF
Sbjct: 121 YYKMKGDYYRYLAEFKSGDDRKEAADQSLKAYEAATATASADLAPTHPIRLGLALNFSVF 180

Query: 588 YYEIMNSPERACH 626
YYEI+NSPERACH
Sbjct: 181 YYEILNSPERACH 193


tr_hit_id A9NUG8
Definition tr|A9NUG8|A9NUG8_PICSI Putative uncharacterized protein OS=Picea sitchensis
Align length 193
Score (bit) 357.0
E-value 4.0e-97
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= DK950483|Adiantum capillus-veneris mRNA, clone:
TST38A01NGRL0008_M10, 5'
(627 letters)

Database: uniprot_trembl.fasta
7,341,751 sequences; 2,391,615,440 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

tr|A9NUG8|A9NUG8_PICSI Putative uncharacterized protein OS=Picea... 357 4e-97
tr|A9TWK5|A9TWK5_PHYPA Predicted protein OS=Physcomitrella paten... 355 1e-96
tr|A9SDA7|A9SDA7_PHYPA Predicted protein OS=Physcomitrella paten... 353 4e-96
tr|A9S3W0|A9S3W0_PHYPA Predicted protein (Fragment) OS=Physcomit... 353 6e-96
tr|A9TBY0|A9TBY0_PHYPA Predicted protein OS=Physcomitrella paten... 351 2e-95
tr|A9NRV7|A9NRV7_PICSI Putative uncharacterized protein OS=Picea... 349 7e-95
tr|A9TWK3|A9TWK3_PHYPA Predicted protein OS=Physcomitrella paten... 347 3e-94
tr|A3RG90|A3RG90_LILLO 14-3-3 protein Lil 1433-3 OS=Lilium longi... 343 5e-93
tr|A1XJ43|A1XJ43_GOSHI 14-3-3-like protein OS=Gossypium hirsutum... 343 5e-93
tr|A3RG89|A3RG89_LILLO 14-3-3 protein Lil 1433-2 OS=Lilium longi... 342 1e-92
tr|A9NKD6|A9NKD6_PICSI Putative uncharacterized protein OS=Picea... 339 9e-92
tr|A9NU69|A9NU69_PICSI Putative uncharacterized protein OS=Picea... 335 1e-90
tr|A7NUY2|A7NUY2_VITVI Chromosome chr18 scaffold_1, whole genome... 335 1e-90
tr|A9PCE5|A9PCE5_POPTR Putative uncharacterized protein OS=Popul... 335 2e-90
tr|Q9M5W3|Q9M5W3_EUPES 14-3-3-like protein OS=Euphorbia esula PE... 334 3e-90
tr|B6REZ8|B6REZ8_GOSHI 14-3-3a protein OS=Gossypium hirsutum PE=... 334 3e-90
tr|A9PBC6|A9PBC6_POPTR Putative uncharacterized protein OS=Popul... 331 2e-89
tr|A7QDK8|A7QDK8_VITVI Chromosome chr10 scaffold_81, whole genom... 328 1e-88
tr|Q9XEW5|Q9XEW5_9ROSI 14-3-3 protein OS=Populus tremula x Popul... 328 2e-88
tr|Q9LKK9|Q9LKK9_9ROSI 14-3-3 protein OS=Populus tremula x Popul... 328 2e-88
tr|A7P1Z4|A7P1Z4_VITVI Chromosome chr19 scaffold_4, whole genome... 327 3e-88
tr|Q762F4|Q762F4_TOBAC 14-3-3 protein OS=Nicotiana tabacum GN=Nt... 324 2e-87
tr|O49152|O49152_9FABA 14-3-3 protein homolog OS=Maackia amurens... 323 5e-87
tr|B7FJS1|B7FJS1_MEDTR Putative uncharacterized protein OS=Medic... 320 4e-86
tr|Q944P2|Q944P2_9LILI 14-3-3 protein OS=Fritillaria cirrhosa GN... 319 7e-86
tr|Q541X6|Q541X6_ARATH Putative 14-3-3 protein epsilon OS=Arabid... 318 2e-85
tr|A0JQ87|A0JQ87_ARATH At1g34760 OS=Arabidopsis thaliana PE=2 SV=1 316 6e-85
tr|B7FIF7|B7FIF7_MEDTR Putative uncharacterized protein OS=Medic... 316 8e-85
tr|Q9M5K7|Q9M5K7_SOYBN 14-3-3-like protein OS=Glycine max PE=2 SV=1 315 1e-84
tr|Q948K3|Q948K3_TOBAC 14-3-3 protein OS=Nicotiana tabacum GN=D7... 313 4e-84

>tr|A9NUG8|A9NUG8_PICSI Putative uncharacterized protein OS=Picea
sitchensis PE=2 SV=1
Length = 258

Score = 357 bits (915), Expect = 4e-97
Identities = 178/193 (92%), Positives = 187/193 (96%)
Frame = +3

Query: 48 EKERESHVYMAKLAEQAERYDEMVESMKKVAKLDVELTVEERNLLSVGYKNVIGARRASW 227
EKERE+HVYMAKLAEQAERYDEMV+SMKKVAKLDVELTVEERNLLSVGYKNVIGARRASW
Sbjct: 3 EKERENHVYMAKLAEQAERYDEMVDSMKKVAKLDVELTVEERNLLSVGYKNVIGARRASW 62

Query: 228 RILSSIEQKEEAKGNEHNVKRIKEYRNKVEEELSKICNDILMIIDEHLIPSSGTGESTVF 407
RI+SSIEQKEEAKGNE NVKRIKEYR+KVE+ELS+ICNDIL IIDEHLIPSS TGESTVF
Sbjct: 63 RIMSSIEQKEEAKGNELNVKRIKEYRHKVEDELSRICNDILTIIDEHLIPSSSTGESTVF 122

Query: 408 YYKMKGDYFRYLAEFKTSSERKEAADQSLKAYQAASNTAGTDLPPTHPIRLGLALNFSVF 587
YYKMKGDY+RYLAEFKT +ERKEAADQSLKAYQAASNTA TDL PTHPIRLGLALNFSVF
Sbjct: 123 YYKMKGDYYRYLAEFKTGNERKEAADQSLKAYQAASNTATTDLAPTHPIRLGLALNFSVF 182

Query: 588 YYEIMNSPERACH 626
YYEI+NSPERACH
Sbjct: 183 YYEILNSPERACH 195


>tr|A9TWK5|A9TWK5_PHYPA Predicted protein OS=Physcomitrella patens
subsp. patens GN=PHYPADRAFT_108926 PE=4 SV=1
Length = 258

Score = 355 bits (911), Expect = 1e-96
Identities = 178/193 (92%), Positives = 186/193 (96%)
Frame = +3

Query: 48 EKERESHVYMAKLAEQAERYDEMVESMKKVAKLDVELTVEERNLLSVGYKNVIGARRASW 227
EKERES+VYMAKLAEQAERYDEMVESMKKVAKLDVELTVEERNLLSVGYKNVIGARRASW
Sbjct: 4 EKERESYVYMAKLAEQAERYDEMVESMKKVAKLDVELTVEERNLLSVGYKNVIGARRASW 63

Query: 228 RILSSIEQKEEAKGNEHNVKRIKEYRNKVEEELSKICNDILMIIDEHLIPSSGTGESTVF 407
RI+SSIEQKEE+KGNE NVKRIKEYR+KVEEELSKIC DIL IIDEHLIPSS TGESTVF
Sbjct: 64 RIMSSIEQKEESKGNEQNVKRIKEYRHKVEEELSKICQDILTIIDEHLIPSSSTGESTVF 123

Query: 408 YYKMKGDYFRYLAEFKTSSERKEAADQSLKAYQAASNTAGTDLPPTHPIRLGLALNFSVF 587
Y+KMKGDY+RYLAEFKT +ERKEAADQSLKAYQAASNTA TDL PTHPIRLGLALNFSVF
Sbjct: 124 YFKMKGDYYRYLAEFKTGNERKEAADQSLKAYQAASNTATTDLAPTHPIRLGLALNFSVF 183

Query: 588 YYEIMNSPERACH 626
YYEI+NSPERACH
Sbjct: 184 YYEILNSPERACH 196


>tr|A9SDA7|A9SDA7_PHYPA Predicted protein OS=Physcomitrella patens
subsp. patens GN=PHYPADRAFT_211050 PE=3 SV=1
Length = 258

Score = 353 bits (907), Expect = 4e-96
Identities = 177/193 (91%), Positives = 185/193 (95%)
Frame = +3

Query: 48 EKERESHVYMAKLAEQAERYDEMVESMKKVAKLDVELTVEERNLLSVGYKNVIGARRASW 227
EKERES VYMAKLAEQAERYDEMVESMKKVAKLDVELTVEERNLLSVGYKNVIGARRASW
Sbjct: 4 EKERESQVYMAKLAEQAERYDEMVESMKKVAKLDVELTVEERNLLSVGYKNVIGARRASW 63

Query: 228 RILSSIEQKEEAKGNEHNVKRIKEYRNKVEEELSKICNDILMIIDEHLIPSSGTGESTVF 407
RI+SSIEQKEE+KGNE NVKRIK+YR+KVEEELSKIC DIL IIDEHLIPSS TGESTVF
Sbjct: 64 RIMSSIEQKEESKGNEQNVKRIKDYRHKVEEELSKICQDILTIIDEHLIPSSSTGESTVF 123

Query: 408 YYKMKGDYFRYLAEFKTSSERKEAADQSLKAYQAASNTAGTDLPPTHPIRLGLALNFSVF 587
YYKMKGDY+RYLAEFKT ++RKEAADQSLKAYQAASNTA TDL PTHPIRLGLALNFSVF
Sbjct: 124 YYKMKGDYYRYLAEFKTGNDRKEAADQSLKAYQAASNTATTDLAPTHPIRLGLALNFSVF 183

Query: 588 YYEIMNSPERACH 626
YYEI+NSPERACH
Sbjct: 184 YYEILNSPERACH 196


>tr|A9S3W0|A9S3W0_PHYPA Predicted protein (Fragment)
OS=Physcomitrella patens subsp. patens
GN=PHYPADRAFT_5967 PE=3 SV=1
Length = 246

Score = 353 bits (905), Expect = 6e-96
Identities = 177/193 (91%), Positives = 186/193 (96%)
Frame = +3

Query: 48 EKERESHVYMAKLAEQAERYDEMVESMKKVAKLDVELTVEERNLLSVGYKNVIGARRASW 227
EKERES+VYMAKLAEQAERYDEMVESMKKVAKLDVELTVEERNLLSVGYKNVIGARRASW
Sbjct: 4 EKERESYVYMAKLAEQAERYDEMVESMKKVAKLDVELTVEERNLLSVGYKNVIGARRASW 63

Query: 228 RILSSIEQKEEAKGNEHNVKRIKEYRNKVEEELSKICNDILMIIDEHLIPSSGTGESTVF 407
RI+SSIEQKEE+KGNE NVKRIK+YR+KVEEELSKICNDIL IID HLIPSS TGESTVF
Sbjct: 64 RIMSSIEQKEESKGNEQNVKRIKDYRHKVEEELSKICNDILSIIDGHLIPSSSTGESTVF 123

Query: 408 YYKMKGDYFRYLAEFKTSSERKEAADQSLKAYQAASNTAGTDLPPTHPIRLGLALNFSVF 587
YYKMKGDY+RYLAEFKT +ERKEAADQSLKAYQAAS+TA TDL PTHPIRLGLALNFSVF
Sbjct: 124 YYKMKGDYYRYLAEFKTGNERKEAADQSLKAYQAASSTAVTDLAPTHPIRLGLALNFSVF 183

Query: 588 YYEIMNSPERACH 626
YYEI+NSPERACH
Sbjct: 184 YYEILNSPERACH 196


>tr|A9TBY0|A9TBY0_PHYPA Predicted protein OS=Physcomitrella patens
subsp. patens GN=PHYPADRAFT_220863 PE=3 SV=1
Length = 258

Score = 351 bits (900), Expect = 2e-95
Identities = 176/193 (91%), Positives = 185/193 (95%)
Frame = +3

Query: 48 EKERESHVYMAKLAEQAERYDEMVESMKKVAKLDVELTVEERNLLSVGYKNVIGARRASW 227
EKERES+VYMAKLAEQAERYDEMVESMKKVAKLDVELTVEERNLLSVGYKNVIGARRASW
Sbjct: 4 EKERESYVYMAKLAEQAERYDEMVESMKKVAKLDVELTVEERNLLSVGYKNVIGARRASW 63

Query: 228 RILSSIEQKEEAKGNEHNVKRIKEYRNKVEEELSKICNDILMIIDEHLIPSSGTGESTVF 407
RI+SSIEQKE++KGN NVKRIK+YR+KVEEELSKICNDIL IID HLIPSS TGESTVF
Sbjct: 64 RIMSSIEQKEDSKGNYQNVKRIKDYRHKVEEELSKICNDILSIIDGHLIPSSSTGESTVF 123

Query: 408 YYKMKGDYFRYLAEFKTSSERKEAADQSLKAYQAASNTAGTDLPPTHPIRLGLALNFSVF 587
YYKMKGDY+RYLAEFKT +ERKEAADQSLKAYQAASNTA TDL PTHPIRLGLALNFSVF
Sbjct: 124 YYKMKGDYYRYLAEFKTGAERKEAADQSLKAYQAASNTAVTDLAPTHPIRLGLALNFSVF 183

Query: 588 YYEIMNSPERACH 626
YYEI+NSPERACH
Sbjct: 184 YYEILNSPERACH 196


>tr|A9NRV7|A9NRV7_PICSI Putative uncharacterized protein OS=Picea
sitchensis PE=2 SV=1
Length = 260

Score = 349 bits (896), Expect = 7e-95
Identities = 173/193 (89%), Positives = 184/193 (95%)
Frame = +3

Query: 48 EKERESHVYMAKLAEQAERYDEMVESMKKVAKLDVELTVEERNLLSVGYKNVIGARRASW 227
+KERE+HVYMAKLAEQAERYDEMVE+MK+VAKLDVELTVEERNLLSVGYKNVIGARRASW
Sbjct: 4 DKERENHVYMAKLAEQAERYDEMVEAMKRVAKLDVELTVEERNLLSVGYKNVIGARRASW 63

Query: 228 RILSSIEQKEEAKGNEHNVKRIKEYRNKVEEELSKICNDILMIIDEHLIPSSGTGESTVF 407
RI+SSIEQKEEAKGNEHNVKRI+EYR KVE ELSKIC+DI+ IIDEHLIPSS GESTVF
Sbjct: 64 RIMSSIEQKEEAKGNEHNVKRIREYRQKVEAELSKICHDIMTIIDEHLIPSSNIGESTVF 123

Query: 408 YYKMKGDYFRYLAEFKTSSERKEAADQSLKAYQAASNTAGTDLPPTHPIRLGLALNFSVF 587
YYKMKGDYFRYLAEFKT +ERKEAADQSLKAYQ AS+TA +DL PTHPIRLGLALNFSVF
Sbjct: 124 YYKMKGDYFRYLAEFKTGNERKEAADQSLKAYQTASSTAESDLAPTHPIRLGLALNFSVF 183

Query: 588 YYEIMNSPERACH 626
YYEIMNSPERACH
Sbjct: 184 YYEIMNSPERACH 196


>tr|A9TWK3|A9TWK3_PHYPA Predicted protein OS=Physcomitrella patens
subsp. patens GN=PHYPADRAFT_151885 PE=4 SV=1
Length = 193

Score = 347 bits (890), Expect = 3e-94
Identities = 175/190 (92%), Positives = 183/190 (96%)
Frame = +3

Query: 48 EKERESHVYMAKLAEQAERYDEMVESMKKVAKLDVELTVEERNLLSVGYKNVIGARRASW 227
EKERES+VYMAKLAEQAERYDEMVESMKKVAKLDVELTVEERNLLSVGYKNVIGARRASW
Sbjct: 4 EKERESYVYMAKLAEQAERYDEMVESMKKVAKLDVELTVEERNLLSVGYKNVIGARRASW 63

Query: 228 RILSSIEQKEEAKGNEHNVKRIKEYRNKVEEELSKICNDILMIIDEHLIPSSGTGESTVF 407
RI+SSIEQKEE+KGNE NVKRIKEYR+KVEEELSKIC DIL IIDEHLIPSS TGESTVF
Sbjct: 64 RIMSSIEQKEESKGNEQNVKRIKEYRHKVEEELSKICQDILTIIDEHLIPSSSTGESTVF 123

Query: 408 YYKMKGDYFRYLAEFKTSSERKEAADQSLKAYQAASNTAGTDLPPTHPIRLGLALNFSVF 587
Y+KMKGDY+RYLAEFKT +ERKEAADQSLKAYQAASNTA TDL PTHPIRLGLALNFSVF
Sbjct: 124 YFKMKGDYYRYLAEFKTGNERKEAADQSLKAYQAASNTATTDLAPTHPIRLGLALNFSVF 183

Query: 588 YYEIMNSPER 617
YYEI+NSPER
Sbjct: 184 YYEILNSPER 193


>tr|A3RG90|A3RG90_LILLO 14-3-3 protein Lil 1433-3 OS=Lilium
longiflorum PE=2 SV=1
Length = 260

Score = 343 bits (880), Expect = 5e-93
Identities = 168/193 (87%), Positives = 183/193 (94%)
Frame = +3

Query: 48 EKERESHVYMAKLAEQAERYDEMVESMKKVAKLDVELTVEERNLLSVGYKNVIGARRASW 227
EKERE+HVY+AKLAEQAERYDEMVESMK VA+LD++LTVEERNLLSVGYKNVIGARRASW
Sbjct: 4 EKERENHVYLAKLAEQAERYDEMVESMKNVARLDLDLTVEERNLLSVGYKNVIGARRASW 63

Query: 228 RILSSIEQKEEAKGNEHNVKRIKEYRNKVEEELSKICNDILMIIDEHLIPSSGTGESTVF 407
RI+SSIEQKEE+KGN+ NVK IK YR+KVEEELSKICNDIL +ID+HLIPSSG+GE+TVF
Sbjct: 64 RIMSSIEQKEESKGNDQNVKLIKGYRHKVEEELSKICNDILTVIDKHLIPSSGSGEATVF 123

Query: 408 YYKMKGDYFRYLAEFKTSSERKEAADQSLKAYQAASNTAGTDLPPTHPIRLGLALNFSVF 587
YYKMKGDY+RYLAEFK ERKEAADQS+KAYQAASNTA TDLP THPIRLGLALNFSVF
Sbjct: 124 YYKMKGDYYRYLAEFKNEHERKEAADQSMKAYQAASNTANTDLPSTHPIRLGLALNFSVF 183

Query: 588 YYEIMNSPERACH 626
YYEIMNSPERACH
Sbjct: 184 YYEIMNSPERACH 196


>tr|A1XJ43|A1XJ43_GOSHI 14-3-3-like protein OS=Gossypium hirsutum
PE=2 SV=1
Length = 253

Score = 343 bits (880), Expect = 5e-93
Identities = 168/193 (87%), Positives = 182/193 (94%)
Frame = +3

Query: 48 EKERESHVYMAKLAEQAERYDEMVESMKKVAKLDVELTVEERNLLSVGYKNVIGARRASW 227
EKERE VY+A+LAEQAERYDEMVE+MK VAKLDVELTVEERNLLSVGYKNVIGARRASW
Sbjct: 2 EKEREQQVYLARLAEQAERYDEMVEAMKSVAKLDVELTVEERNLLSVGYKNVIGARRASW 61

Query: 228 RILSSIEQKEEAKGNEHNVKRIKEYRNKVEEELSKICNDILMIIDEHLIPSSGTGESTVF 407
RILSSIEQKEEAKGNE NVKRIK+YR +VE+ELSKICNDIL +ID+HLIPSS TGESTVF
Sbjct: 62 RILSSIEQKEEAKGNEQNVKRIKDYRQRVEDELSKICNDILSVIDKHLIPSSSTGESTVF 121

Query: 408 YYKMKGDYFRYLAEFKTSSERKEAADQSLKAYQAASNTAGTDLPPTHPIRLGLALNFSVF 587
YYKMKGDYFRYLAEFK +RKEAADQSLKAY+AA++TA +DLPPTHPIRLGLALNFSVF
Sbjct: 122 YYKMKGDYFRYLAEFKAGDDRKEAADQSLKAYEAATSTASSDLPPTHPIRLGLALNFSVF 181

Query: 588 YYEIMNSPERACH 626
YYEI+NSPERACH
Sbjct: 182 YYEILNSPERACH 194


>tr|A3RG89|A3RG89_LILLO 14-3-3 protein Lil 1433-2 OS=Lilium
longiflorum PE=2 SV=1
Length = 260

Score = 342 bits (877), Expect = 1e-92
Identities = 170/193 (88%), Positives = 181/193 (93%)
Frame = +3

Query: 48 EKERESHVYMAKLAEQAERYDEMVESMKKVAKLDVELTVEERNLLSVGYKNVIGARRASW 227
EKERE+HVY+AKLAEQAERYDEMVE MK VAKLD+ELTVEERNLLSVGYKNVIGARRASW
Sbjct: 4 EKERENHVYLAKLAEQAERYDEMVEYMKYVAKLDMELTVEERNLLSVGYKNVIGARRASW 63

Query: 228 RILSSIEQKEEAKGNEHNVKRIKEYRNKVEEELSKICNDILMIIDEHLIPSSGTGESTVF 407
RI+SSIEQKEE+KGNE NVK IK YR KVE+EL+KICNDIL IID+HLIPSSG+GESTVF
Sbjct: 64 RIMSSIEQKEESKGNEQNVKLIKGYRQKVEDELAKICNDILTIIDQHLIPSSGSGESTVF 123

Query: 408 YYKMKGDYFRYLAEFKTSSERKEAADQSLKAYQAASNTAGTDLPPTHPIRLGLALNFSVF 587
YYKMKGDY+RYLAEFK ERK+AADQSLKAYQAASNTA TDLP THPIRLGLALNFSVF
Sbjct: 124 YYKMKGDYYRYLAEFKNELERKDAADQSLKAYQAASNTANTDLPSTHPIRLGLALNFSVF 183

Query: 588 YYEIMNSPERACH 626
YYEIMNSPERACH
Sbjct: 184 YYEIMNSPERACH 196