DK950489
Clone id TST38A01NGRL0008_M16
Library
Length 663
Definition Adiantum capillus-veneris mRNA. clone: TST38A01NGRL0008_M16. 5' end sequence.
Accession
Tissue type prothallia
Developmental stage gametophyte
Contig ID -
Sequence
AATTGCTCCAAATTGACAAGCGTTCCCTTCACTGATCGGTAGCAGCAGCATACATGCCGC
GCAAGCGCTCTTGGAGGGACGTAGAAGAGGAGGAGCCGCAGAAGGCCATAATTATAAGCG
ATGATGATGAGGACGATGCCAACGCAGACCTCAGCATGACCATACTCGCCAAAGCATTCC
GCCGTTCCCCTCTCCTTGGCGGAGTCGTCCTCTCGGATGACGACCAGCGAGAAGCTGCAA
TATCTGTCCCTTCCTTGCCCACCAAGCTTCCTTCGCCATTCCCCTCTCCCTCCTCAGACC
TTGCCCCCCAGCAGCCACGACCTGCGAAGAAGCAGAAGAGCAAGATTAAGAAGAAAAAGA
AAAAGGCTTCTGAAACAGAAGCTGAGCAGAACCAACTTGGAAATGCTGAAAAAAACACAC
TCATCAAAATAATAGGGGATGATGAGGAAGACAATGTTGAAATGCGGCAGCTTTCGAGGG
GCCCACGTTATTTTGATCCTCCAGACACTCTTTGTTTCCGCTGCGGAAATATTGGCCATT
TTGCAGTTAATTGCACAGAGGAGGCGCGCAAGAAAGCATGTTTTGTGTGTGGCGGCCTCG
ACCATGAAGTCAAGGACTGTCCACAGAGCTCTTGTTTAATATGCCAAAGCACTGGACATT
TTT
■■Homology search results ■■ -
sp_hit_id P36627
Definition sp|P36627|BYR3_SCHPO Cellular nucleic acid-binding protein homolog OS=Schizosaccharomyces pombe
Align length 58
Score (bit) 53.5
E-value 1.0e-06
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= DK950489|Adiantum capillus-veneris mRNA, clone:
TST38A01NGRL0008_M16, 5'
(663 letters)

Database: uniprot_sprot.fasta
412,525 sequences; 148,809,765 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

sp|P36627|BYR3_SCHPO Cellular nucleic acid-binding protein homol... 54 1e-06
sp|Q8WW36|ZCH13_HUMAN Zinc finger CCHC domain-containing protein... 52 3e-06
sp|Q04832|HEXP_LEIMA DNA-binding protein HEXBP OS=Leishmania maj... 51 6e-06
sp|P62634|CNBP_RAT Cellular nucleic acid-binding protein OS=Ratt... 49 2e-05
sp|Q5R5R5|CNBP_PONAB Cellular nucleic acid-binding protein OS=Po... 49 2e-05
sp|P53996|CNBP_MOUSE Cellular nucleic acid-binding protein OS=Mu... 49 2e-05
sp|P62633|CNBP_HUMAN Cellular nucleic acid-binding protein OS=Ho... 49 2e-05
sp|O42395|CNBP_CHICK Cellular nucleic acid-binding protein OS=Ga... 49 2e-05
sp|Q3T0Q6|CNBP_BOVIN Cellular nucleic acid-binding protein OS=Bo... 49 2e-05
sp|P05959|POL_HV1RH Gag-Pol polyprotein OS=Human immunodeficienc... 48 4e-05
sp|P05890|GAG_HV1RH Gag polyprotein OS=Human immunodeficiency vi... 48 4e-05
sp|P24740|POL_HV1U4 Gag-Pol polyprotein OS=Human immunodeficienc... 48 5e-05
sp|P24736|GAG_HV1U4 Gag polyprotein OS=Human immunodeficiency vi... 48 5e-05
sp|O12158|POL_HV192 Gag-Pol polyprotein OS=Human immunodeficienc... 47 9e-05
sp|O12157|GAG_HV192 Gag polyprotein OS=Human immunodeficiency vi... 47 9e-05
sp|Q8AII1|POL_SIVTN Gag-Pol polyprotein OS=Simian immunodeficien... 47 1e-04
sp|Q8AII2|GAG_SIVTN Gag polyprotein OS=Simian immunodeficiency v... 47 1e-04
sp|P35963|POL_HV1Y2 Gag-Pol polyprotein OS=Human immunodeficienc... 46 2e-04
sp|Q9WC63|POL_HV1S9 Gag-Pol polyprotein OS=Human immunodeficienc... 46 2e-04
sp|Q9WC54|POL_HV1S2 Gag-Pol polyprotein OS=Human immunodeficienc... 46 2e-04
sp|P20892|POL_HV1OY Gag-Pol polyprotein OS=Human immunodeficienc... 46 2e-04
sp|P12497|POL_HV1N5 Gag-Pol polyprotein OS=Human immunodeficienc... 46 2e-04
sp|P05960|POL_HV1C4 Gag-Pol polyprotein (Fragment) OS=Human immu... 46 2e-04
sp|Q73368|POL_HV1B9 Gag-Pol polyprotein OS=Human immunodeficienc... 46 2e-04
sp|P04587|POL_HV1B5 Gag-Pol polyprotein OS=Human immunodeficienc... 46 2e-04
sp|O89290|POL_HV193 Gag-Pol polyprotein OS=Human immunodeficienc... 46 2e-04
sp|P35962|GAG_HV1Y2 Gag polyprotein OS=Human immunodeficiency vi... 46 2e-04
sp|Q9WC62|GAG_HV1S9 Gag polyprotein OS=Human immunodeficiency vi... 46 2e-04
sp|Q9WC53|GAG_HV1S2 Gag polyprotein OS=Human immunodeficiency vi... 46 2e-04
sp|P20889|GAG_HV1OY Gag polyprotein OS=Human immunodeficiency vi... 46 2e-04

>sp|P36627|BYR3_SCHPO Cellular nucleic acid-binding protein homolog
OS=Schizosaccharomyces pombe GN=byr3 PE=2 SV=1
Length = 179

Score = 53.5 bits (127), Expect = 1e-06
Identities = 22/58 (37%), Positives = 29/58 (50%), Gaps = 7/58 (12%)
Frame = +3

Query: 507 TLCFRCGNIGHFAVNCTEEARKKACFVCGGLDHEVKDCPQS-------SCLICQSTGH 659
++C+ C GH A CTE ++K C+ CG H V+DCP S C C GH
Sbjct: 36 SICYNCNQTGHKASECTEPQQEKTCYACGTAGHLVRDCPSSPNPRQGAECYKCGRVGH 93



Score = 43.1 bits (100), Expect = 0.001
Identities = 17/61 (27%), Positives = 26/61 (42%), Gaps = 12/61 (19%)
Frame = +3

Query: 513 CFRCGNIGHFAVNCTEEARKKA-----------CFVCGGLDHEVKDCPQS-SCLICQSTG 656
C++CG +GH A +C ++ C+ CG H+ +DC C C G
Sbjct: 85 CYKCGRVGHIARDCRTNGQQSGGRFGGHRSNMNCYACGSYGHQARDCTMGVKCYSCGKIG 144

Query: 657 H 659
H
Sbjct: 145 H 145



Score = 41.6 bits (96), Expect = 0.004
Identities = 19/53 (35%), Positives = 27/53 (50%), Gaps = 4/53 (7%)
Frame = +3

Query: 513 CFRCGNIGHFAVNCTEEARKKACFVCGGLDHEVKDCPQSS----CLICQSTGH 659
C+ CG+ GH A +CT + C+ CG + H +C Q+S C C GH
Sbjct: 118 CYACGSYGHQARDCTMGVK---CYSCGKIGHRSFECQQASDGQLCYKCNQPGH 167



Score = 32.7 bits (73), Expect = 1.8
Identities = 11/36 (30%), Positives = 18/36 (50%)
Frame = +3

Query: 513 CFRCGNIGHFAVNCTEEARKKACFVCGGLDHEVKDC 620
C+ CG IGH + C + + + C+ C H +C
Sbjct: 137 CYSCGKIGHRSFECQQASDGQLCYKCNQPGHIAVNC 172


>sp|Q8WW36|ZCH13_HUMAN Zinc finger CCHC domain-containing protein 13
OS=Homo sapiens GN=ZCCHC13 PE=2 SV=1
Length = 166

Score = 52.0 bits (123), Expect = 3e-06
Identities = 21/49 (42%), Positives = 27/49 (55%)
Frame = +3

Query: 513 CFRCGNIGHFAVNCTEEARKKACFVCGGLDHEVKDCPQSSCLICQSTGH 659
C+ CG +GH A +C + +K C+ CG L H KDC Q C C GH
Sbjct: 91 CYTCGRLGHLARDCDRQKEQK-CYSCGKLGHIQKDCAQVKCYRCGEIGH 138



Score = 46.6 bits (109), Expect = 1e-04
Identities = 19/55 (34%), Positives = 28/55 (50%), Gaps = 5/55 (9%)
Frame = +3

Query: 510 LCFRCGNIGHFAVNCTEEARKKA--CFVCGGLDHEVKDC---PQSSCLICQSTGH 659
+C+ CG GH A +C + R++ C+ CG L H +DC + C C GH
Sbjct: 66 ICYNCGRSGHIAKDCKDPKRERRQHCYTCGRLGHLARDCDRQKEQKCYSCGKLGH 120



Score = 32.7 bits (73), Expect = 1.8
Identities = 10/16 (62%), Positives = 14/16 (87%)
Frame = +3

Query: 513 CFRCGNIGHFAVNCTE 560
C+RCG IGH A+NC++
Sbjct: 130 CYRCGEIGHVAINCSK 145


>sp|Q04832|HEXP_LEIMA DNA-binding protein HEXBP OS=Leishmania major
GN=HEXBP PE=4 SV=1
Length = 271

Score = 50.8 bits (120), Expect = 6e-06
Identities = 27/69 (39%), Positives = 30/69 (43%), Gaps = 14/69 (20%)
Frame = +3

Query: 495 DPPDTLCFRCGNIGHFAVNCTEEARKKA-----CFVCGGLDHEVKDCPQSS--------- 632
D T CFRCG GH + C EAR A CF CG H +DCP S+
Sbjct: 39 DERSTTCFRCGEEGHMSRECPNEARSGAAGAMTCFRCGEAGHMSRDCPNSAKPGAAKGFE 98

Query: 633 CLICQSTGH 659
C C GH
Sbjct: 99 CYKCGQEGH 107



Score = 41.6 bits (96), Expect = 0.004
Identities = 18/44 (40%), Positives = 23/44 (52%), Gaps = 5/44 (11%)
Frame = +3

Query: 513 CFRCGNIGHFAVNCTEEARKKA-----CFVCGGLDHEVKDCPQS 629
CFRCG GH + +C A+ A C+ CG H +DCP S
Sbjct: 72 CFRCGEAGHMSRDCPNSAKPGAAKGFECYKCGQEGHLSRDCPSS 115



Score = 40.8 bits (94), Expect = 0.006
Identities = 21/65 (32%), Positives = 26/65 (40%), Gaps = 14/65 (21%)
Frame = +3

Query: 507 TLCFRCGNIGHFAVNCTE-----EARKKACFVCGGLDHEVKDCPQS---------SCLIC 644
T C CG GH+A C E + R CF CG H ++CP +C C
Sbjct: 16 TSCRNCGKEGHYARECPEADSKGDERSTTCFRCGEEGHMSRECPNEARSGAAGAMTCFRC 75

Query: 645 QSTGH 659
GH
Sbjct: 76 GEAGH 80



Score = 40.4 bits (93), Expect = 0.008
Identities = 19/68 (27%), Positives = 28/68 (41%), Gaps = 16/68 (23%)
Frame = +3

Query: 504 DTLCFRCGNIGHFAVNCT------EEARKKACFVCGGLDHEVKDCPQS----------SC 635
D C++CG+ GH + +C A + C+ CG H +DCP C
Sbjct: 139 DRTCYKCGDAGHISRDCPNGQGGYSGAGDRTCYKCGDAGHISRDCPNGQGGYSGAGDRKC 198

Query: 636 LICQSTGH 659
C +GH
Sbjct: 199 YKCGESGH 206



Score = 39.3 bits (90), Expect = 0.019
Identities = 19/71 (26%), Positives = 30/71 (42%), Gaps = 14/71 (19%)
Frame = +3

Query: 489 YFDPPDTLCFRCGNIGHFAVNCT------EEARKKACFVCGGLDHEVKDCPQS------- 629
Y D C++CG+ GH + +C A + C+ CG H ++CP +
Sbjct: 162 YSGAGDRTCYKCGDAGHISRDCPNGQGGYSGAGDRKCYKCGESGHMSRECPSAGSTGSGD 221

Query: 630 -SCLICQSTGH 659
+C C GH
Sbjct: 222 RACYKCGKPGH 232



Score = 37.7 bits (86), Expect = 0.055
Identities = 16/51 (31%), Positives = 22/51 (43%), Gaps = 9/51 (17%)
Frame = +3

Query: 504 DTLCFRCGNIGHFAVNCTEEARK---------KACFVCGGLDHEVKDCPQS 629
D C++CG GH + C E + C+ CG H +DCP S
Sbjct: 221 DRACYKCGKPGHISRECPEAGGSYGGSRGGGDRTCYKCGEAGHISRDCPSS 271


>sp|P62634|CNBP_RAT Cellular nucleic acid-binding protein OS=Rattus
norvegicus GN=Cnbp PE=2 SV=1
Length = 177

Score = 49.3 bits (116), Expect = 2e-05
Identities = 20/49 (40%), Positives = 27/49 (55%)
Frame = +3

Query: 513 CFRCGNIGHFAVNCTEEARKKACFVCGGLDHEVKDCPQSSCLICQSTGH 659
C+ CG GH A +C + A ++ C+ CG H KDC + C C TGH
Sbjct: 98 CYNCGKPGHLARDC-DHADEQKCYSCGEFGHIQKDCTKVKCYRCGETGH 145



Score = 43.9 bits (102), Expect = 8e-04
Identities = 22/59 (37%), Positives = 30/59 (50%), Gaps = 6/59 (10%)
Frame = +3

Query: 501 PDTLCFRCGNIGHFAVNCTEEARKKACFVCGGLDHEVKDCP------QSSCLICQSTGH 659
PD +C+RCG GH A +C + ++ AC+ CG H KDC + C C GH
Sbjct: 51 PD-ICYRCGESGHLAKDC--DLQEDACYNCGRGGHIAKDCKEPKREREQCCYNCGKPGH 106



Score = 43.9 bits (102), Expect = 8e-04
Identities = 20/58 (34%), Positives = 28/58 (48%), Gaps = 2/58 (3%)
Frame = +3

Query: 495 DPPDTLCFRCGNIGHFAVNCTE--EARKKACFVCGGLDHEVKDCPQSSCLICQSTGHF 662
D + C+ CG GH A +C E R++ C+ CG H +DC + C S G F
Sbjct: 68 DLQEDACYNCGRGGHIAKDCKEPKREREQCCYNCGKPGHLARDCDHADEQKCYSCGEF 125



Score = 39.7 bits (91), Expect = 0.014
Identities = 14/36 (38%), Positives = 22/36 (61%)
Frame = +3

Query: 513 CFRCGNIGHFAVNCTEEARKKACFVCGGLDHEVKDC 620
C+RCG GH A+NC++ + C+ CG H ++C
Sbjct: 137 CYRCGETGHVAINCSKTSEVN-CYRCGESGHLAREC 171


>sp|Q5R5R5|CNBP_PONAB Cellular nucleic acid-binding protein OS=Pongo
abelii GN=CNBP PE=2 SV=1
Length = 177

Score = 49.3 bits (116), Expect = 2e-05
Identities = 20/49 (40%), Positives = 27/49 (55%)
Frame = +3

Query: 513 CFRCGNIGHFAVNCTEEARKKACFVCGGLDHEVKDCPQSSCLICQSTGH 659
C+ CG GH A +C + A ++ C+ CG H KDC + C C TGH
Sbjct: 98 CYNCGKPGHLARDC-DHADEQKCYSCGEFGHIQKDCTKVKCYRCGETGH 145



Score = 43.9 bits (102), Expect = 8e-04
Identities = 22/59 (37%), Positives = 30/59 (50%), Gaps = 6/59 (10%)
Frame = +3

Query: 501 PDTLCFRCGNIGHFAVNCTEEARKKACFVCGGLDHEVKDCP------QSSCLICQSTGH 659
PD +C+RCG GH A +C + ++ AC+ CG H KDC + C C GH
Sbjct: 51 PD-ICYRCGESGHLAKDC--DLQEDACYNCGRGGHIAKDCKEPKREREQCCYNCGKPGH 106



Score = 43.9 bits (102), Expect = 8e-04
Identities = 20/58 (34%), Positives = 28/58 (48%), Gaps = 2/58 (3%)
Frame = +3

Query: 495 DPPDTLCFRCGNIGHFAVNCTE--EARKKACFVCGGLDHEVKDCPQSSCLICQSTGHF 662
D + C+ CG GH A +C E R++ C+ CG H +DC + C S G F
Sbjct: 68 DLQEDACYNCGRGGHIAKDCKEPKREREQCCYNCGKPGHLARDCDHADEQKCYSCGEF 125



Score = 39.7 bits (91), Expect = 0.014
Identities = 14/36 (38%), Positives = 22/36 (61%)
Frame = +3

Query: 513 CFRCGNIGHFAVNCTEEARKKACFVCGGLDHEVKDC 620
C+RCG GH A+NC++ + C+ CG H ++C
Sbjct: 137 CYRCGETGHVAINCSKTSEVN-CYRCGESGHLAREC 171


>sp|P53996|CNBP_MOUSE Cellular nucleic acid-binding protein OS=Mus
musculus GN=Cnbp PE=2 SV=2
Length = 178

Score = 49.3 bits (116), Expect = 2e-05
Identities = 20/49 (40%), Positives = 27/49 (55%)
Frame = +3

Query: 513 CFRCGNIGHFAVNCTEEARKKACFVCGGLDHEVKDCPQSSCLICQSTGH 659
C+ CG GH A +C + A ++ C+ CG H KDC + C C TGH
Sbjct: 99 CYNCGKPGHLARDC-DHADEQKCYSCGEFGHIQKDCTKVKCYRCGETGH 146



Score = 44.7 bits (104), Expect = 4e-04
Identities = 20/55 (36%), Positives = 27/55 (49%), Gaps = 2/55 (3%)
Frame = +3

Query: 504 DTLCFRCGNIGHFAVNCTE--EARKKACFVCGGLDHEVKDCPQSSCLICQSTGHF 662
D C+ CG GH A +C E R++ C+ CG H +DC + C S G F
Sbjct: 72 DEACYNCGRGGHIAKDCKEPKREREQCCYNCGKPGHLARDCDHADEQKCYSCGEF 126



Score = 42.7 bits (99), Expect = 0.002
Identities = 22/59 (37%), Positives = 29/59 (49%), Gaps = 6/59 (10%)
Frame = +3

Query: 501 PDTLCFRCGNIGHFAVNCTEEARKKACFVCGGLDHEVKDCP------QSSCLICQSTGH 659
PD +C+RCG GH A +C + +AC+ CG H KDC + C C GH
Sbjct: 51 PD-ICYRCGESGHLAKDC-DLQEDEACYNCGRGGHIAKDCKEPKREREQCCYNCGKPGH 107



Score = 39.7 bits (91), Expect = 0.014
Identities = 14/36 (38%), Positives = 22/36 (61%)
Frame = +3

Query: 513 CFRCGNIGHFAVNCTEEARKKACFVCGGLDHEVKDC 620
C+RCG GH A+NC++ + C+ CG H ++C
Sbjct: 138 CYRCGETGHVAINCSKTSEVN-CYRCGESGHLAREC 172


>sp|P62633|CNBP_HUMAN Cellular nucleic acid-binding protein OS=Homo
sapiens GN=CNBP PE=1 SV=1
Length = 177

Score = 49.3 bits (116), Expect = 2e-05
Identities = 20/49 (40%), Positives = 27/49 (55%)
Frame = +3

Query: 513 CFRCGNIGHFAVNCTEEARKKACFVCGGLDHEVKDCPQSSCLICQSTGH 659
C+ CG GH A +C + A ++ C+ CG H KDC + C C TGH
Sbjct: 98 CYNCGKPGHLARDC-DHADEQKCYSCGEFGHIQKDCTKVKCYRCGETGH 145



Score = 43.9 bits (102), Expect = 8e-04
Identities = 22/59 (37%), Positives = 30/59 (50%), Gaps = 6/59 (10%)
Frame = +3

Query: 501 PDTLCFRCGNIGHFAVNCTEEARKKACFVCGGLDHEVKDCP------QSSCLICQSTGH 659
PD +C+RCG GH A +C + ++ AC+ CG H KDC + C C GH
Sbjct: 51 PD-ICYRCGESGHLAKDC--DLQEDACYNCGRGGHIAKDCKEPKREREQCCYNCGKPGH 106



Score = 43.9 bits (102), Expect = 8e-04
Identities = 20/58 (34%), Positives = 28/58 (48%), Gaps = 2/58 (3%)
Frame = +3

Query: 495 DPPDTLCFRCGNIGHFAVNCTE--EARKKACFVCGGLDHEVKDCPQSSCLICQSTGHF 662
D + C+ CG GH A +C E R++ C+ CG H +DC + C S G F
Sbjct: 68 DLQEDACYNCGRGGHIAKDCKEPKREREQCCYNCGKPGHLARDCDHADEQKCYSCGEF 125



Score = 39.7 bits (91), Expect = 0.014
Identities = 14/36 (38%), Positives = 22/36 (61%)
Frame = +3

Query: 513 CFRCGNIGHFAVNCTEEARKKACFVCGGLDHEVKDC 620
C+RCG GH A+NC++ + C+ CG H ++C
Sbjct: 137 CYRCGETGHVAINCSKTSEVN-CYRCGESGHLAREC 171


>sp|O42395|CNBP_CHICK Cellular nucleic acid-binding protein
OS=Gallus gallus GN=CNBP PE=2 SV=1
Length = 172

Score = 49.3 bits (116), Expect = 2e-05
Identities = 20/49 (40%), Positives = 27/49 (55%)
Frame = +3

Query: 513 CFRCGNIGHFAVNCTEEARKKACFVCGGLDHEVKDCPQSSCLICQSTGH 659
C+ CG GH A +C + A ++ C+ CG H KDC + C C TGH
Sbjct: 93 CYNCGKPGHLARDC-DHADEQKCYSCGEFGHIQKDCTKVKCYRCGETGH 140



Score = 44.7 bits (104), Expect = 4e-04
Identities = 20/55 (36%), Positives = 27/55 (49%), Gaps = 2/55 (3%)
Frame = +3

Query: 504 DTLCFRCGNIGHFAVNCTE--EARKKACFVCGGLDHEVKDCPQSSCLICQSTGHF 662
D C+ CG GH A +C E R++ C+ CG H +DC + C S G F
Sbjct: 66 DKACYNCGRGGHIAKDCKEPKREREQCCYNCGKPGHLARDCDHADEQKCYSCGEF 120



Score = 44.3 bits (103), Expect = 6e-04
Identities = 23/59 (38%), Positives = 29/59 (49%), Gaps = 6/59 (10%)
Frame = +3

Query: 501 PDTLCFRCGNIGHFAVNCTEEARKKACFVCGGLDHEVKDCP------QSSCLICQSTGH 659
PD +C+RCG GH A +C + KAC+ CG H KDC + C C GH
Sbjct: 45 PD-ICYRCGESGHLAKDC-DLQEDKACYNCGRGGHIAKDCKEPKREREQCCYNCGKPGH 101



Score = 39.7 bits (91), Expect = 0.014
Identities = 14/36 (38%), Positives = 22/36 (61%)
Frame = +3

Query: 513 CFRCGNIGHFAVNCTEEARKKACFVCGGLDHEVKDC 620
C+RCG GH A+NC++ + C+ CG H ++C
Sbjct: 132 CYRCGETGHVAINCSKTSEVN-CYRCGESGHLAREC 166



Score = 33.5 bits (75), Expect = 1.0
Identities = 21/72 (29%), Positives = 27/72 (37%), Gaps = 23/72 (31%)
Frame = +3

Query: 513 CFRCGNIGHFAVNCTE--------EARKKA------------CFVCGGLDHEVKDC---P 623
CF+CG GH+A C +R +A C+ CG H KDC
Sbjct: 6 CFKCGRTGHWARECPTGIGRGRGMRSRGRAGFQFMSSSLPDICYRCGESGHLAKDCDLQE 65

Query: 624 QSSCLICQSTGH 659
+C C GH
Sbjct: 66 DKACYNCGRGGH 77


>sp|Q3T0Q6|CNBP_BOVIN Cellular nucleic acid-binding protein OS=Bos
taurus GN=CNBP PE=2 SV=1
Length = 170

Score = 49.3 bits (116), Expect = 2e-05
Identities = 20/49 (40%), Positives = 27/49 (55%)
Frame = +3

Query: 513 CFRCGNIGHFAVNCTEEARKKACFVCGGLDHEVKDCPQSSCLICQSTGH 659
C+ CG GH A +C + A ++ C+ CG H KDC + C C TGH
Sbjct: 91 CYNCGKPGHLARDC-DHADEQKCYSCGEFGHIQKDCTKVKCYRCGETGH 138



Score = 45.4 bits (106), Expect = 3e-04
Identities = 26/74 (35%), Positives = 36/74 (48%), Gaps = 8/74 (10%)
Frame = +3

Query: 462 MRQLSRGPRYFDP--PDTLCFRCGNIGHFAVNCTEEARKKACFVCGGLDHEVKDCP---- 623
MR RG ++ PD +C+RCG GH A +C + ++ AC+ CG H KDC
Sbjct: 29 MRSRGRGFQFVSSSLPD-ICYRCGESGHLAKDC--DLQEDACYNCGRGGHIAKDCKEPKR 85

Query: 624 --QSSCLICQSTGH 659
+ C C GH
Sbjct: 86 EREQCCYNCGKPGH 99



Score = 43.9 bits (102), Expect = 8e-04
Identities = 20/58 (34%), Positives = 28/58 (48%), Gaps = 2/58 (3%)
Frame = +3

Query: 495 DPPDTLCFRCGNIGHFAVNCTE--EARKKACFVCGGLDHEVKDCPQSSCLICQSTGHF 662
D + C+ CG GH A +C E R++ C+ CG H +DC + C S G F
Sbjct: 61 DLQEDACYNCGRGGHIAKDCKEPKREREQCCYNCGKPGHLARDCDHADEQKCYSCGEF 118



Score = 39.7 bits (91), Expect = 0.014
Identities = 14/36 (38%), Positives = 22/36 (61%)
Frame = +3

Query: 513 CFRCGNIGHFAVNCTEEARKKACFVCGGLDHEVKDC 620
C+RCG GH A+NC++ + C+ CG H ++C
Sbjct: 130 CYRCGETGHVAINCSKTSEVN-CYRCGESGHLAREC 164



Score = 34.3 bits (77), Expect = 0.60
Identities = 19/70 (27%), Positives = 25/70 (35%), Gaps = 21/70 (30%)
Frame = +3

Query: 513 CFRCGNIGHFAVNC-------------------TEEARKKACFVCGGLDHEVKDC--PQS 629
CF+CG GH+A C + C+ CG H KDC +
Sbjct: 6 CFKCGRSGHWARECPTGGGRGRGMRSRGRGFQFVSSSLPDICYRCGESGHLAKDCDLQED 65

Query: 630 SCLICQSTGH 659
+C C GH
Sbjct: 66 ACYNCGRGGH 75


>sp|P05959|POL_HV1RH Gag-Pol polyprotein OS=Human immunodeficiency
virus type 1 (isolate RF/HAT3 group M subtype B)
GN=gag-pol PE=1 SV=3
Length = 1436

Score = 48.1 bits (113), Expect = 4e-05
Identities = 19/36 (52%), Positives = 23/36 (63%)
Frame = +3

Query: 513 CFRCGNIGHFAVNCTEEARKKACFVCGGLDHEVKDC 620
CF CG +GH A NC RKK C+ CG H++KDC
Sbjct: 392 CFNCGKVGHIAKNC-RAPRKKGCWKCGKEGHQMKDC 426


tr_hit_id A5C4E0
Definition tr|A5C4E0|A5C4E0_VITVI Putative uncharacterized protein OS=Vitis vinifera
Align length 74
Score (bit) 92.0
E-value 3.0e-17
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= DK950489|Adiantum capillus-veneris mRNA, clone:
TST38A01NGRL0008_M16, 5'
(663 letters)

Database: uniprot_trembl.fasta
7,341,751 sequences; 2,391,615,440 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

tr|A5C4E0|A5C4E0_VITVI Putative uncharacterized protein OS=Vitis... 92 3e-17
tr|A7PG94|A7PG94_VITVI Chromosome chr6 scaffold_15, whole genome... 91 6e-17
tr|B8BKE4|B8BKE4_ORYSI Putative uncharacterized protein OS=Oryza... 86 3e-15
tr|B4FZY0|B4FZY0_MAIZE Putative uncharacterized protein OS=Zea m... 79 3e-13
tr|Q9FYD1|Q9FYD1_ARATH Putative uncharacterized protein F22J12_3... 78 4e-13
tr|Q0IS21|Q0IS21_ORYSJ Os11g0573200 protein (Fragment) OS=Oryza ... 76 2e-12
tr|A3CCI5|A3CCI5_ORYSJ Putative uncharacterized protein OS=Oryza... 76 2e-12
tr|B0BLB4|B0BLB4_LOTJA CM0545.270.nc protein OS=Lotus japonicus ... 73 2e-11
tr|Q012M7|Q012M7_OSTTA E3 ubiquitin ligase interacting with argi... 71 7e-11
tr|A9RU85|A9RU85_PHYPA Predicted protein (Fragment) OS=Physcomit... 65 4e-09
tr|Q75J95|Q75J95_DICDI Putative uncharacterized protein OS=Dicty... 58 5e-07
tr|Q55AJ7|Q55AJ7_DICDI Putative uncharacterized protein OS=Dicty... 58 5e-07
tr|A4S220|A4S220_OSTLU Predicted protein (Fragment) OS=Ostreococ... 58 6e-07
tr|Q6C9D6|Q6C9D6_YARLI YALI0D12056p OS=Yarrowia lipolytica GN=YA... 58 6e-07
tr|Q9M241|Q9M241_ARATH Putative uncharacterized protein T18D12_6... 57 1e-06
tr|A9ULU5|A9ULU5_XENLA LOC100036947 protein (Fragment) OS=Xenopu... 54 7e-06
tr|A1L2T6|A1L2T6_XENLA LOC100036947 protein (Fragment) OS=Xenopu... 54 7e-06
tr|Q7JQ89|Q7JQ89_TETTH CnjB protein OS=Tetrahymena thermophila G... 54 7e-06
tr|Q24BQ3|Q24BQ3_TETTH Zinc knuckle family protein OS=Tetrahymen... 54 7e-06
tr|Q7ZB29|Q7ZB29_SIVCZ Gag polyprotein OS=Simian immunodeficienc... 54 9e-06
tr|Q8T8R1|Q8T8R1_DROME CG3800 OS=Drosophila melanogaster GN=CG38... 54 1e-05
tr|A8PG68|A8PG68_COPC7 Putative uncharacterized protein OS=Copri... 54 1e-05
tr|Q998S7|Q998S7_SIVCZ Gag polyprotein (Fragment) OS=Simian immu... 53 1e-05
tr|Q3L234|Q3L234_BOMMO Zinc finger protein OS=Bombyx mori PE=2 SV=1 53 1e-05
tr|A4S4Q3|A4S4Q3_OSTLU Predicted protein OS=Ostreococcus lucimar... 52 3e-05
tr|B6QF15|B6QF15_PENMA Zinc knuckle transcription factor (CnjB),... 52 3e-05
tr|Q5B2W9|Q5B2W9_EMENI Putative uncharacterized protein OS=Emeri... 52 3e-05
tr|B6JZK3|B6JZK3_SCHJP Cellular nucleic acid-binding protein OS=... 52 3e-05
tr|B6E929|B6E929_9HIV1 Gag protein OS=Human immunodeficiency vir... 52 4e-05
tr|B7U4P9|B7U4P9_9DIPT Zinc finger protein OS=Lutzomyia shannoni... 52 4e-05

>tr|A5C4E0|A5C4E0_VITVI Putative uncharacterized protein OS=Vitis
vinifera GN=VITISV_005152 PE=4 SV=1
Length = 513

Score = 92.0 bits (227), Expect = 3e-17
Identities = 41/74 (55%), Positives = 49/74 (66%), Gaps = 4/74 (5%)
Frame = +3

Query: 450 DNVEMRQLSRGPRYFDPPDT---LCFRCGNIGHFAVNCTEEARKKACFVCGGLDHEVKDC 620
DN+ +R+L RGPRYFDPPD+ C+ CG GH AVNC RKK CFVCG L+H K C
Sbjct: 228 DNIVLRKLLRGPRYFDPPDSGWGACYNCGEEGHNAVNCASVKRKKPCFVCGSLEHNAKQC 287

Query: 621 -PQSSCLICQSTGH 659
+ C IC+S GH
Sbjct: 288 MKEIQCYICKSFGH 301


>tr|A7PG94|A7PG94_VITVI Chromosome chr6 scaffold_15, whole genome
shotgun sequence OS=Vitis vinifera GN=GSVIVT00017443001
PE=4 SV=1
Length = 482

Score = 90.9 bits (224), Expect = 6e-17
Identities = 40/74 (54%), Positives = 48/74 (64%), Gaps = 4/74 (5%)
Frame = +3

Query: 450 DNVEMRQLSRGPRYFDPPDT---LCFRCGNIGHFAVNCTEEARKKACFVCGGLDHEVKDC 620
DN+ +R+L RGPRYFDPPD+ C+ CG GH AVNC RKK CFVCG L+H K C
Sbjct: 151 DNIVLRKLLRGPRYFDPPDSGWGACYNCGEEGHNAVNCASVKRKKPCFVCGSLEHNAKQC 210

Query: 621 PQ-SSCLICQSTGH 659
+ C IC+ GH
Sbjct: 211 MKGQDCFICKKGGH 224


>tr|B8BKE4|B8BKE4_ORYSI Putative uncharacterized protein OS=Oryza
sativa subsp. indica GN=OsI_36043 PE=4 SV=1
Length = 492

Score = 85.5 bits (210), Expect = 3e-15
Identities = 46/98 (46%), Positives = 57/98 (58%), Gaps = 6/98 (6%)
Frame = +3

Query: 384 EQNQLGNAEKNTLIKIIGDDE--EDNVEMRQLSRGPRYFDPPDTL---CFRCGNIGHFAV 548
++ Q G AE +++ G D DN+ +R+L R PRYFDP +TL CF CG GH AV
Sbjct: 137 QEAQTGTAE--SVLTEDGPDAPLSDNIVLRKLLRIPRYFDPGETLLETCFNCGEEGHVAV 194

Query: 549 NCTEEARKKACFVCGGLDHEVKDCPQ-SSCLICQSTGH 659
NC E RK+ CFVCG H K C Q C IC+ GH
Sbjct: 195 NCPMEKRKRPCFVCGLFGHNSKQCTQGQDCFICKKGGH 232



Score = 35.4 bits (80), Expect = 3.2
Identities = 20/62 (32%), Positives = 27/62 (43%), Gaps = 11/62 (17%)
Frame = +3

Query: 507 TLCFRCGNIGHFAVNCT-----EEARKKACFVCGGLDH----EVKD-CPQS-SCLICQST 653
T C RCG GH C ++ ++ C+VC H + D CP+ SC C
Sbjct: 249 TFCLRCGESGHDMFGCANDYPRDDVKEIKCYVCNQKGHLCCADFSDICPKEVSCYNCAQP 308

Query: 654 GH 659
GH
Sbjct: 309 GH 310


>tr|B4FZY0|B4FZY0_MAIZE Putative uncharacterized protein OS=Zea mays
PE=2 SV=1
Length = 482

Score = 78.6 bits (192), Expect = 3e-13
Identities = 40/96 (41%), Positives = 50/96 (52%), Gaps = 4/96 (4%)
Frame = +3

Query: 384 EQNQLGNAEKNTLIKIIGDDEEDNVEMRQLSRGPRYFDPPDTL---CFRCGNIGHFAVNC 554
++ Q+G AE + ++ +R+L R PRYFDP +TL CF C GH A NC
Sbjct: 131 QEEQIGTAESVLTEDGVDAPTSHSMFLRKLLRIPRYFDPGETLLETCFNCSEEGHVAANC 190

Query: 555 TEEARKKACFVCGGLDHEVKDCPQ-SSCLICQSTGH 659
RKK CFVCG H K C Q C IC+ GH
Sbjct: 191 PMGKRKKPCFVCGLFGHNAKQCKQGQDCFICKKGGH 226



Score = 35.4 bits (80), Expect = 3.2
Identities = 13/21 (61%), Positives = 16/21 (76%)
Frame = +3

Query: 507 TLCFRCGNIGHFAVNCTEEAR 569
TLCF+CG GHFA CT+ A+
Sbjct: 309 TLCFKCGEEGHFARGCTKNAK 329


>tr|Q9FYD1|Q9FYD1_ARATH Putative uncharacterized protein F22J12_30
(Putative uncharacterized protein At3g43590)
OS=Arabidopsis thaliana GN=F22J12_30 PE=2 SV=1
Length = 551

Score = 78.2 bits (191), Expect = 4e-13
Identities = 35/79 (44%), Positives = 48/79 (60%), Gaps = 5/79 (6%)
Frame = +3

Query: 438 DDEEDNVEMRQLSRGPRYFDPPD---TLCFRCGNIGHFAVNC-TEEARKKACFVCGGLDH 605
++ N+ +++L RG RYFDPPD C+ CG GH + NC T R+K CF+CG L+H
Sbjct: 140 EETASNLVLKKLLRGARYFDPPDAGWVSCYSCGEQGHTSFNCPTPTKRRKPCFICGSLEH 199

Query: 606 EVKDCPQS-SCLICQSTGH 659
K C + C IC+ TGH
Sbjct: 200 GAKQCSKGHDCYICKKTGH 218



Score = 40.0 bits (92), Expect = 0.13
Identities = 19/49 (38%), Positives = 24/49 (48%), Gaps = 9/49 (18%)
Frame = +3

Query: 513 CFRCGNIGHFAVNC-------TEEARKK--ACFVCGGLDHEVKDCPQSS 632
C+RCG GHFA C T R+ C+ C G H ++CP SS
Sbjct: 327 CYRCGEEGHFARECPNSSSISTSHGRESQTLCYRCNGSGHFARECPNSS 375



Score = 37.4 bits (85), Expect = 0.83
Identities = 22/81 (27%), Positives = 31/81 (38%), Gaps = 31/81 (38%)
Frame = +3

Query: 513 CFRCGNIGHFAVNC---TEEARK---------------KACFVCGGLDHEVKDCPQSS-- 632
C+RCG +GH + C EE+ + C+ CG H ++CP SS
Sbjct: 287 CYRCGQLGHSGLACGRHYEESNENDSATPERLFNSREASECYRCGEEGHFARECPNSSSI 346

Query: 633 -----------CLICQSTGHF 662
C C +GHF
Sbjct: 347 STSHGRESQTLCYRCNGSGHF 367


>tr|Q0IS21|Q0IS21_ORYSJ Os11g0573200 protein (Fragment) OS=Oryza
sativa subsp. japonica GN=Os11g0573200 PE=4 SV=1
Length = 129

Score = 75.9 bits (185), Expect = 2e-12
Identities = 35/62 (56%), Positives = 40/62 (64%), Gaps = 3/62 (4%)
Frame = +3

Query: 450 DNVEMRQLSRGPRYFDPPDTL---CFRCGNIGHFAVNCTEEARKKACFVCGGLDHEVKDC 620
DN+ +R+L R PRYFDP +TL CF CG GH AVNC E RK+ CFVCG H K C
Sbjct: 36 DNIVLRKLLRIPRYFDPGETLLETCFNCGEEGHVAVNCPMEKRKRPCFVCGLFGHNSKQC 95

Query: 621 PQ 626
Q
Sbjct: 96 TQ 97


>tr|A3CCI5|A3CCI5_ORYSJ Putative uncharacterized protein OS=Oryza
sativa subsp. japonica GN=OsJ_033007 PE=4 SV=1
Length = 901

Score = 75.9 bits (185), Expect = 2e-12
Identities = 35/62 (56%), Positives = 40/62 (64%), Gaps = 3/62 (4%)
Frame = +3

Query: 450 DNVEMRQLSRGPRYFDPPDTL---CFRCGNIGHFAVNCTEEARKKACFVCGGLDHEVKDC 620
DN+ +R+L R PRYFDP +TL CF CG GH AVNC E RK+ CFVCG H K C
Sbjct: 196 DNIVLRKLLRIPRYFDPGETLLETCFNCGEEGHVAVNCPMEKRKRPCFVCGLFGHNSKQC 255

Query: 621 PQ 626
Q
Sbjct: 256 TQ 257


>tr|B0BLB4|B0BLB4_LOTJA CM0545.270.nc protein OS=Lotus japonicus
GN=CM0545.270.nc PE=4 SV=1
Length = 259

Score = 72.8 bits (177), Expect = 2e-11
Identities = 34/76 (44%), Positives = 45/76 (59%), Gaps = 6/76 (7%)
Frame = +3

Query: 450 DNVEMRQLSRGPRYFDPPD----TLCFRCGNIGHFAVNC-TEEARKKACFVCGGLDHEVK 614
DNV +R+L RGPRY+DPP C+ CG GH V C + KK C++CG L H+ K
Sbjct: 40 DNVVLRKLLRGPRYYDPPADCGWETCYNCGEEGHATVKCAAAKELKKPCYLCGSLMHQAK 99

Query: 615 DCPQS-SCLICQSTGH 659
C + C +C+S GH
Sbjct: 100 RCKKEIQCYVCKSFGH 115


>tr|Q012M7|Q012M7_OSTTA E3 ubiquitin ligase interacting with
arginine methyltransferase (ISS) OS=Ostreococcus tauri
GN=Ot08g04150 PE=4 SV=1
Length = 276

Score = 70.9 bits (172), Expect = 7e-11
Identities = 32/77 (41%), Positives = 41/77 (53%), Gaps = 4/77 (5%)
Frame = +3

Query: 441 DEEDNVEMRQLSRGPRYFDPPDTL----CFRCGNIGHFAVNCTEEARKKACFVCGGLDHE 608
D+++N E+R + R PRYFD CFRCG GH C A+KK C +CG H
Sbjct: 30 DDQENEEVRNILRQPRYFDDDYEAAALRCFRCGQGGHREAECELPAKKKPCHLCGYKSHV 89

Query: 609 VKDCPQSSCLICQSTGH 659
+DCP C C + GH
Sbjct: 90 ARDCPHGLCYNCLTPGH 106


>tr|A9RU85|A9RU85_PHYPA Predicted protein (Fragment)
OS=Physcomitrella patens subsp. patens
GN=PHYPADRAFT_27641 PE=4 SV=1
Length = 106

Score = 65.1 bits (157), Expect = 4e-09
Identities = 25/50 (50%), Positives = 34/50 (68%), Gaps = 1/50 (2%)
Frame = +3

Query: 513 CFRCGNIGHFAVNCTEEARKKACFVCGGLDHEVKDCPQS-SCLICQSTGH 659
C+ CG GH+A CT++AR+K C+VCG H DCP++ C IC+ TGH
Sbjct: 3 CYNCGQQGHWAAECTKQAREKPCYVCGNFGHFSYDCPEALRCYICKRTGH 52



Score = 34.7 bits (78), Expect = 5.4
Identities = 14/44 (31%), Positives = 22/44 (50%), Gaps = 3/44 (6%)
Frame = +3

Query: 498 PPDTLCFRCGNIGHFAVNCTEE---ARKKACFVCGGLDHEVKDC 620
P C+RCG++GH V + + AC+ CG H ++C
Sbjct: 63 PTPVSCYRCGDLGHSGVVSISQDSYENQTACYRCGNEGHFAREC 106