DK950506
Clone id TST38A01NGRL0008_N10
Library
Length 586
Definition Adiantum capillus-veneris mRNA. clone: TST38A01NGRL0008_N10. 5' end sequence.
Accession
Tissue type prothallia
Developmental stage gametophyte
Contig ID -
Sequence
AGCTCTTGTTTGGTTTCTACATCGGTGGAAGAGCAATGTACTCGCTAGAATGCTTGCAAA
TCAGAATGTAGGAAGCGCTGAGAAGGAGCGCTTTCACGCCCTAGATAAAATCTCCTCTAT
GGGGCTCTTTATCCTTGGTGCAATGGGTGTTGCAGAGACTTTTGGCATTGCTGCTCATTC
CATTCTCACTGTTGGAGGAGTGGGAGGTGTGGCCACTGCTTTCGCTGCCAGAGATATACT
GGGGAATATGCTCAGTGGTTTTGCACTTCAATTTATGAAGCCTTTCTCCATTGGCGATAC
AATCAAAGCTGGATCTGTTGAGGGGCAAGTACTTGATATTGGGCTGACTTCAACGCAGCT
GTTGGATCTCGAAAAATTTCCTGTTGCTGTGCCAAACTCCTTCTTTTCAAGCCAGGTGAT
TGTGAACAAATCCCGTGCAACATGGCGAGCTTTTTCTGTAAAAATTCCTGTCCAGCTGAA
TGATTATGAGAAAATACCTCAAATTACGCAAGAAATCAAAAACATGTTGAAGAGTCATCC
AAGCGTAACTTTCCAGAATGGTGTGCCTCTTTGTTATGCTTCTCGT
■■Homology search results ■■ -
sp_hit_id P0AEB5
Definition sp|P0AEB5|YNAI_ECOLI MscS family inner membrane protein ynaI OS=Escherichia coli (strain K12)
Align length 151
Score (bit) 84.3
E-value 4.0e-16
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= DK950506|Adiantum capillus-veneris mRNA, clone:
TST38A01NGRL0008_N10, 5'
(586 letters)

Database: uniprot_sprot.fasta
412,525 sequences; 148,809,765 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

sp|P0AEB5|YNAI_ECOLI MscS family inner membrane protein ynaI OS=... 84 4e-16
sp|P0AEB6|YNAI_ECO57 MscS family inner membrane protein ynaI OS=... 84 4e-16
sp|O25170|Y415_HELPY Uncharacterized mscS family protein HP_0415... 68 4e-11
sp|Q9ZKG7|Y415_HELPJ Uncharacterized mscS family protein jhp_096... 67 5e-11
sp|O66994|Y812_AQUAE Uncharacterized mscS family protein aq_812 ... 65 2e-10
sp|Q58543|Y1143_METJA Uncharacterized mscS family protein MJ1143... 62 3e-09
sp|P77338|KEFA_ECOLI Potassium efflux system kefA OS=Escherichia... 59 2e-08
sp|O07594|YHDY_BACSU Uncharacterized mscS family protein yhdY OS... 58 3e-08
sp|Q57634|Y170_METJA Uncharacterized mscS family protein MJ0170 ... 57 9e-08
sp|O28726|Y1546_ARCFU Uncharacterized mscS family protein AF_154... 52 2e-06
sp|P0C0S3|MSCS_SHIFL Small-conductance mechanosensitive channel ... 51 4e-06
sp|P0C0S1|MSCS_ECOLI Small-conductance mechanosensitive channel ... 51 4e-06
sp|P0C0S2|MSCS_ECO57 Small-conductance mechanosensitive channel ... 51 4e-06
sp|P39285|YJEP_ECOLI Uncharacterized mscS family protein yjeP OS... 49 2e-05
sp|Q89AB5|Y402_BUCBP Uncharacterized mscS family protein bbp_402... 47 7e-05
sp|Q8K9B1|Y437_BUCAP Uncharacterized mscS family protein BUsg_43... 46 2e-04
sp|O52401|MSCS_EDWIC Small-conductance mechanosensitive channel ... 46 2e-04
sp|Q57362|Y195A_HAEIN Uncharacterized mscS family protein HI0195... 45 2e-04
sp|P42531|Y1270_CORGL Uncharacterized protein Cgl1270/cg1434 OS=... 45 2e-04
sp|P57527|Y452_BUCAI Uncharacterized mscS family protein BU452 O... 45 3e-04
sp|P60882|MEGF8_MOUSE Multiple epidermal growth factor-like doma... 35 0.28
sp|Q55717|Y639_SYNY3 Uncharacterized mscS family protein slr0639... 34 0.47
sp|Q9QYP0|MEGF8_RAT Multiple epidermal growth factor-like domain... 34 0.62
sp|Q6CRY2|MED14_KLULA Mediator of RNA polymerase II transcriptio... 34 0.62
sp|Q9LYG9|Y5208_ARATH Uncharacterized protein At5g12080 OS=Arabi... 33 1.4
sp|Q920M2|RNF39_RAT RING finger protein 39 OS=Rattus norvegicus ... 33 1.4
sp|Q7Z7M0|MEGF8_HUMAN Multiple epidermal growth factor-like doma... 33 1.4
sp|Q9R160|ADA24_MOUSE ADAM 24 OS=Mus musculus GN=Adam24 PE=1 SV=1 32 1.8
sp|P58463|FOXP2_MOUSE Forkhead box protein P2 OS=Mus musculus GN... 32 2.3
sp|O43006|MU178_SCHPO Meiotically up-regulated gene 178 protein ... 32 2.3

>sp|P0AEB5|YNAI_ECOLI MscS family inner membrane protein ynaI
OS=Escherichia coli (strain K12) GN=ynaI PE=1 SV=1
Length = 343

Score = 84.3 bits (207), Expect = 4e-16
Identities = 47/151 (31%), Positives = 79/151 (52%), Gaps = 2/151 (1%)
Frame = +2

Query: 101 LDKISSMGLFILGAMGVAETFGIAAHSILXXXXXXXXXXXXXXRDILGNMLSGFALQFMK 280
+ +I + + ++ + E FG++ +L +DIL N SG L F +
Sbjct: 118 MSRIIKITIIVVLVLLYGEHFGMSLSGLLTFGGIGGLAVGMAGKDILSNFFSGIMLYFDR 177

Query: 281 PFSIGDTIKAG--SVEGQVLDIGLTSTQLLDLEKFPVAVPNSFFSSQVIVNKSRATWRAF 454
PFSIGD I++ ++EG V +IG T++ + P+ VPNS FSS + N R T R
Sbjct: 178 PFSIGDWIRSPDRNIEGTVAEIGWRITKITTFDNRPLYVPNSLFSSISVENPGRMTNRRI 237

Query: 455 SVKIPVQLNDYEKIPQITQEIKNMLKSHPSV 547
+ I ++ D K+ I + ++ MLK+HP++
Sbjct: 238 TTTIGLRYEDAAKVGVIVEAVREMLKNHPAI 268


>sp|P0AEB6|YNAI_ECO57 MscS family inner membrane protein ynaI
OS=Escherichia coli O157:H7 GN=ynaI PE=3 SV=1
Length = 343

Score = 84.3 bits (207), Expect = 4e-16
Identities = 47/151 (31%), Positives = 79/151 (52%), Gaps = 2/151 (1%)
Frame = +2

Query: 101 LDKISSMGLFILGAMGVAETFGIAAHSILXXXXXXXXXXXXXXRDILGNMLSGFALQFMK 280
+ +I + + ++ + E FG++ +L +DIL N SG L F +
Sbjct: 118 MSRIIKITIIVVLVLLYGEHFGMSLSGLLTFGGIGGLAVGMAGKDILSNFFSGIMLYFDR 177

Query: 281 PFSIGDTIKAG--SVEGQVLDIGLTSTQLLDLEKFPVAVPNSFFSSQVIVNKSRATWRAF 454
PFSIGD I++ ++EG V +IG T++ + P+ VPNS FSS + N R T R
Sbjct: 178 PFSIGDWIRSPDRNIEGTVAEIGWRITKITTFDNRPLYVPNSLFSSISVENPGRMTNRRI 237

Query: 455 SVKIPVQLNDYEKIPQITQEIKNMLKSHPSV 547
+ I ++ D K+ I + ++ MLK+HP++
Sbjct: 238 TTTIGLRYEDAAKVGVIVEAVREMLKNHPAI 268


>sp|O25170|Y415_HELPY Uncharacterized mscS family protein HP_0415
OS=Helicobacter pylori GN=HP_0415 PE=3 SV=1
Length = 623

Score = 67.8 bits (164), Expect = 4e-11
Identities = 48/183 (26%), Positives = 85/183 (46%), Gaps = 2/183 (1%)
Frame = +2

Query: 5 LVWFLHRWKSNVLARMLANQNVGSAEKERFHALDKISSMGLFILGAMGVAETFGIAAHSI 184
LV L + L +A ++ + KE + + K+ +FI+ +GV + G +I
Sbjct: 333 LVIALFKGYGEALVTNMATKSTHNFRKEVINLILKVVYFLIFIVALLGVLKQLGFNVSAI 392

Query: 185 LXXXXXXXXXXXXXXRDILGNMLSGFALQFMKPFSIGDTIKAGSVEGQVLDIGLTSTQLL 364
+ +D+L N + L FS GD I G VEG V+++GL T +
Sbjct: 393 IASLGIGGLAVALAVKDVLANFFASVILLLDNSFSQGDWIVCGEVEGTVVEMGLRRTTIR 452

Query: 365 DLEKFPVAVPNSFFSSQVIVNKS-RATWRAFSVKIPVQLNDYEKIPQI-TQEIKNMLKSH 538
+ ++VPNS + + I N S R R ++I + + + Q+ ++IK ML++H
Sbjct: 453 AFDNALLSVPNSELAGKPIRNWSRRKVGRRIKMEIGLTYSSSQSALQLCVKDIKEMLENH 512

Query: 539 PSV 547
P +
Sbjct: 513 PKI 515


>sp|Q9ZKG7|Y415_HELPJ Uncharacterized mscS family protein jhp_0969
OS=Helicobacter pylori J99 GN=jhp_0969 PE=3 SV=1
Length = 623

Score = 67.4 bits (163), Expect = 5e-11
Identities = 48/183 (26%), Positives = 85/183 (46%), Gaps = 2/183 (1%)
Frame = +2

Query: 5 LVWFLHRWKSNVLARMLANQNVGSAEKERFHALDKISSMGLFILGAMGVAETFGIAAHSI 184
LV L + L +A ++ + KE + + K+ +FI+ +GV + G +I
Sbjct: 333 LVIALFKGYGEALVTNVATKSTHNFRKEVINLILKVVYFLIFIVALLGVLKQLGFNVSAI 392

Query: 185 LXXXXXXXXXXXXXXRDILGNMLSGFALQFMKPFSIGDTIKAGSVEGQVLDIGLTSTQLL 364
+ +D+L N + L FS GD I G VEG V+++GL T +
Sbjct: 393 IASLGIGGLAVALAVKDVLANFFASVILLLDNSFSQGDWIVCGEVEGTVVEMGLRRTTIR 452

Query: 365 DLEKFPVAVPNSFFSSQVIVNKS-RATWRAFSVKIPVQLNDYEKIPQI-TQEIKNMLKSH 538
+ ++VPNS + + I N S R R ++I + + + Q+ ++IK ML++H
Sbjct: 453 AFDNALLSVPNSELAGKPIRNWSRRKVGRRIKMEIGLTYSSSQSALQLCVKDIKEMLENH 512

Query: 539 PSV 547
P +
Sbjct: 513 PKI 515


>sp|O66994|Y812_AQUAE Uncharacterized mscS family protein aq_812
OS=Aquifex aeolicus GN=aq_812 PE=3 SV=1
Length = 368

Score = 65.5 bits (158), Expect = 2e-10
Identities = 48/183 (26%), Positives = 85/183 (46%), Gaps = 1/183 (0%)
Frame = +2

Query: 2 ALVWFLHRWKSNVLARMLANQNVGSAEKERFHALDKISSMGLFILGAMGVAETFGIAAHS 181
A++ FL+ + + ++ + AE+ L + + + I+GA + + +G+ +
Sbjct: 116 AIIRFLNLFHNKIVEFFVKVGGKDFAEEVGDFILKILKAFVVVIVGA-SLLQEWGVNIGA 174

Query: 182 ILXXXXXXXXXXXXXXRDILGNMLSGFALQFMKPFSIGDTIKAGSVEGQVLDIGLTSTQL 361
IL +D N+LSG + KP +G+T+K G V DIGL ST++
Sbjct: 175 ILASVGLLGLAVSLAAKDTFENILSGLIILLDKPVKVGETVKVKDFMGSVEDIGLRSTKI 234

Query: 362 LDLEKFPVAVPNSFFSSQVIVNKSRATWRAFSVKIPVQLN-DYEKIPQITQEIKNMLKSH 538
+K V +PN + + N +R R I V + E++ I +EI+ +LK H
Sbjct: 235 RTFDKSLVTIPNRDIVNNHVENFTRRNKRRVRFYIGVVYSTKREQLENILKEIRELLKEH 294

Query: 539 PSV 547
P V
Sbjct: 295 PGV 297


>sp|Q58543|Y1143_METJA Uncharacterized mscS family protein MJ1143
OS=Methanocaldococcus jannaschii GN=MJ1143 PE=3 SV=1
Length = 361

Score = 61.6 bits (148), Expect = 3e-09
Identities = 45/180 (25%), Positives = 83/180 (46%), Gaps = 2/180 (1%)
Frame = +2

Query: 14 FLHRWKSNVLARMLANQNVGSAEKERFHALDKISSMGLFILGAMGVAETFGIAAHSILXX 193
FL+ LA ++ + + + K+ + ++++G + + G ++L
Sbjct: 112 FLNELVERYLALTISKKTKKDVDDQIVVLTKKLVRLVVWVVGLLLILSNLGYDIKTLLAG 171

Query: 194 XXXXXXXXXXXXRDILGNMLSGFALQFMKPFSIGDTIKAGSVEGQVLDIGLTSTQLLDLE 373
++++ N+++G + KPF IG+ I G V DIG+ ST++ +
Sbjct: 172 LGIGGLAVALASQNLVSNLIAGLIILTDKPFKIGNWITFSGGSGIVEDIGIRSTKIRATD 231

Query: 374 KFPVAVPNSFFSSQVIVN-KSRATWRAFSVKIPVQLN-DYEKIPQITQEIKNMLKSHPSV 547
+ VPNS ++I N S+ W+ S I V N EKI + + IKN+L HP+V
Sbjct: 232 NSIIVVPNSKLIDEIIQNVPSKNKWKV-STTIGVTYNTPVEKIRKAEEIIKNILLEHPNV 290


>sp|P77338|KEFA_ECOLI Potassium efflux system kefA OS=Escherichia coli
(strain K12) GN=kefA PE=1 SV=1
Length = 1120

Score = 58.5 bits (140), Expect = 2e-08
Identities = 41/160 (25%), Positives = 76/160 (47%), Gaps = 7/160 (4%)
Frame = +2

Query: 95 HALDKISSMGLFILGAMGVAETFGIAAHSILXXXXXXXXXXXXXXRDILGNMLSGFALQF 274
+A+ I + + +GAM V + G++ + ++I GN +SG + F
Sbjct: 883 YAITTILNYIIIAVGAMTVFGSLGVSWDKLQWLAAALSVGLGFGLQEIFGNFVSGLIILF 942

Query: 275 MKPFSIGDTIKAGSVEGQVLDIGLTSTQLLDLEKFPVAVPNSFFSSQVIVNKSRA-TWRA 451
+P IGDT+ GS G V I + +T + D ++ V +PN F ++ ++N S T
Sbjct: 943 ERPVRIGDTVTIGSFSGTVSKIRIRATTITDFDRKEVIIPNKAFVTERLINWSLTDTTTR 1002

Query: 452 FSVKIPVQL-NDYEKIPQI-----TQEIKNMLKSHPSVTF 553
+++ V +D EK+ ++ T+ + M + P V F
Sbjct: 1003 LVIRLGVAYGSDLEKVRKVLLKAATEHPRVMHEPMPEVFF 1042


>sp|O07594|YHDY_BACSU Uncharacterized mscS family protein yhdY
OS=Bacillus subtilis GN=yhdY PE=3 SV=1
Length = 371

Score = 58.2 bits (139), Expect = 3e-08
Identities = 39/150 (26%), Positives = 61/150 (40%), Gaps = 1/150 (0%)
Frame = +2

Query: 101 LDKISSMGLFILGAMGVAETFGIAAHSILXXXXXXXXXXXXXXRDILGNMLSGFALQFMK 280
L K+ + L +A+ F + + +D + N G + K
Sbjct: 137 LSKLLRFVIIALSVSVIAQEFNYDVNGFVAGLGLGGLAFALAAKDTISNFFGGIIIITEK 196

Query: 281 PFSIGDTIKAGSVEGQVLDIGLTSTQLLDLEKFPVAVPNSFFSSQVIVNKSRATWRAFSV 460
PF+IGD ++ +V G V DI ST+ + V VPNS S + I N +R T R +
Sbjct: 197 PFTIGDWVETSTVTGSVEDITFRSTRFRTAQGALVTVPNSTLSMEAITNWTRMTKRQITF 256

Query: 461 KIPVQ-LNDYEKIPQITQEIKNMLKSHPSV 547
I V E + + ++ ML H V
Sbjct: 257 SIHVSYATPIENLERSIHSLRTMLLEHEGV 286


>sp|Q57634|Y170_METJA Uncharacterized mscS family protein MJ0170
OS=Methanocaldococcus jannaschii GN=MJ0170 PE=3 SV=1
Length = 350

Score = 56.6 bits (135), Expect = 9e-08
Identities = 37/149 (24%), Positives = 68/149 (45%), Gaps = 1/149 (0%)
Frame = +2

Query: 101 LDKISSMGLFILGAMGVAETFGIAAHSILXXXXXXXXXXXXXXRDILGNMLSGFALQFMK 280
L K+ + +LG + + G ++L +D + N ++G + K
Sbjct: 134 LKKVVKILTILLGILTALSSVGYDITALLAGLGVGGLALALAMQDTIKNFIAGILILIDK 193

Query: 281 PFSIGDTIKAGSVEGQVLDIGLTSTQLLDLEKFPVAVPNSFFSSQVIVNKSRATWRAFSV 460
PFS+G +K EG V +IG+ ST++ + + +PNS I N + R +
Sbjct: 194 PFSLGHWVKVKGAEGIVEEIGIRSTRIRTFDYTLITIPNSELLDSAIENLTVRDRRRVLM 253

Query: 461 KIPVQLN-DYEKIPQITQEIKNMLKSHPS 544
I + N EKI + + IK ++++HP+
Sbjct: 254 TIGLTYNTPVEKIKRAKEIIKEIVENHPA 282


>sp|O28726|Y1546_ARCFU Uncharacterized mscS family protein AF_1546
OS=Archaeoglobus fulgidus GN=AF_1546 PE=3 SV=1
Length = 283

Score = 52.0 bits (123), Expect = 2e-06
Identities = 36/159 (22%), Positives = 68/159 (42%), Gaps = 1/159 (0%)
Frame = +2

Query: 68 VGSAEKERFHALDKISSMGLFILGAMGVAETFGIAAHSILXXXXXXXXXXXXXXRDILGN 247
+ ++++ + K+ G+ I+ + V G+ +L + ++ N
Sbjct: 47 IDKMKRDQLELMLKVIYFGIIIVAFIAVLPALGLDLSGLLVAGGITGIVLGFASQSVVAN 106

Query: 248 MLSGFALQFMKPFSIGDTIKAGSVEGQVLDIGLTSTQLLDLEKFPVAVPNSFFSSQVIVN 427
++SG L KP IGD + V G V D+ + ST + + V +PN + I N
Sbjct: 107 LVSGIFLISEKPIKIGDQVNIDGVAGFVEDVNILSTIIRTYDGLYVRIPNEKVFTSNITN 166

Query: 428 KSRATWRAFSVKIPVQL-NDYEKIPQITQEIKNMLKSHP 541
R F + ++ +D EK +I IK +++ HP
Sbjct: 167 YVAHIARRFEYVVGIRYSDDAEKAIEI---IKRIIEEHP 202


tr_hit_id A7PZL9
Definition tr|A7PZL9|A7PZL9_VITVI Chromosome chr15 scaffold_40, whole genome shotgun sequence OS=Vitis vinifera
Align length 195
Score (bit) 226.0
E-value 7.0e-58
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= DK950506|Adiantum capillus-veneris mRNA, clone:
TST38A01NGRL0008_N10, 5'
(586 letters)

Database: uniprot_trembl.fasta
7,341,751 sequences; 2,391,615,440 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

tr|A7PZL9|A7PZL9_VITVI Chromosome chr15 scaffold_40, whole genom... 226 7e-58
tr|A9SDD7|A9SDD7_PHYPA MscS-Like mechanosensitive ion channel MS... 224 2e-57
tr|Q8VZL4|Q8VZL4_ARATH Putative uncharacterized protein At4g0029... 222 1e-56
tr|B4FE51|B4FE51_MAIZE Putative uncharacterized protein OS=Zea m... 217 4e-55
tr|Q0JAT1|Q0JAT1_ORYSJ Os04g0578700 protein (Fragment) OS=Oryza ... 203 7e-51
tr|Q01KI1|Q01KI1_ORYSA H0404F02.16 protein OS=Oryza sativa GN=H0... 203 7e-51
tr|B8ATA7|B8ATA7_ORYSI Putative uncharacterized protein OS=Oryza... 203 7e-51
tr|B8AGQ0|B8AGQ0_ORYSI Putative uncharacterized protein OS=Oryza... 200 4e-50
tr|Q6EPN3|Q6EPN3_ORYSJ Os02g0681000 protein OS=Oryza sativa subs... 199 1e-49
tr|A3AA49|A3AA49_ORYSJ Putative uncharacterized protein OS=Oryza... 199 1e-49
tr|Q7XQ76|Q7XQ76_ORYSJ OSJNBa0011J08.13 protein OS=Oryza sativa ... 187 5e-46
tr|A3AWP1|A3AWP1_ORYSJ Putative uncharacterized protein OS=Oryza... 187 5e-46
tr|A9TCX4|A9TCX4_PHYPA MscS-Like mechanosensitive ion channel MS... 182 1e-44
tr|A9TTG4|A9TTG4_PHYPA MscS-Like mechanosensitive ion channel MS... 173 7e-42
tr|Q56WM2|Q56WM2_ARATH Putative uncharacterized protein At4g0029... 160 6e-38
tr|A9TTG2|A9TTG2_PHYPA MscS-Like mechanosensitive ion channel MS... 124 3e-27
tr|A9TG68|A9TG68_PHYPA MscS-Like mechanosensitive ion channel MS... 115 2e-24
tr|A9XNR2|A9XNR2_9MYRT Mechanosensitive ion channel domain-conta... 111 3e-23
tr|A9XNR3|A9XNR3_9MYRT Mechanosensitive ion channel domain-conta... 109 1e-22
tr|A9XNR5|A9XNR5_9MYRT Mechanosensitive ion channel domain-conta... 109 1e-22
tr|A9XNR4|A9XNR4_9MYRT Mechanosensitive ion channel domain-conta... 109 1e-22
tr|O23073|O23073_ARATH A_IG005I10.9 protein (AT4g00290 protein) ... 107 5e-22
tr|Q1VFM4|Q1VFM4_VIBAL Putative uncharacterized protein OS=Vibri... 94 4e-18
tr|B8K4S8|B8K4S8_VIBPA Small-conductance mechanosensitive channe... 94 6e-18
tr|Q8D411|Q8D411_VIBVU Small-conductance mechanosensitive channe... 94 7e-18
tr|A7K1I3|A7K1I3_9VIBR Small-conductance mechanosensitive channe... 92 2e-17
tr|Q7MFI2|Q7MFI2_VIBVY Small-conductance mechanosensitive channe... 92 3e-17
tr|A6AJT1|A6AJT1_VIBHA Small-conductance mechanosensitive channe... 92 3e-17
tr|A7N355|A7N355_VIBHB Putative uncharacterized protein OS=Vibri... 91 4e-17
tr|A8SZG6|A8SZG6_9VIBR Putative uncharacterized protein OS=Vibri... 90 8e-17

>tr|A7PZL9|A7PZL9_VITVI Chromosome chr15 scaffold_40, whole genome
shotgun sequence OS=Vitis vinifera GN=GSVIVT00026926001
PE=4 SV=1
Length = 540

Score = 226 bits (576), Expect = 7e-58
Identities = 111/195 (56%), Positives = 143/195 (73%)
Frame = +2

Query: 2 ALVWFLHRWKSNVLARMLANQNVGSAEKERFHALDKISSMGLFILGAMGVAETFGIAAHS 181
+ VWFLHRWK+NV AR LA Q+V ++E+ ALDK+SS+GLF+LG M +AE G+A S
Sbjct: 296 SFVWFLHRWKTNVFARALAAQSVVGLDREKLLALDKLSSVGLFVLGLMALAEACGVAVQS 355

Query: 182 ILXXXXXXXXXXXXXXRDILGNMLSGFALQFMKPFSIGDTIKAGSVEGQVLDIGLTSTQL 361
IL RDILGN+LSG ++QF KPFS+GDTIKAGS+EGQV+++GLT+T L
Sbjct: 356 ILTVGGIGGVATAFASRDILGNVLSGLSMQFSKPFSLGDTIKAGSIEGQVVEMGLTTTSL 415

Query: 362 LDLEKFPVAVPNSFFSSQVIVNKSRATWRAFSVKIPVQLNDYEKIPQITQEIKNMLKSHP 541
L+ EKFPV VPNS FSSQVIVNKSRA W A + KIP+Q ++ +KIPQI+ +IKNML+S+
Sbjct: 416 LNAEKFPVIVPNSLFSSQVIVNKSRAQWHAMATKIPLQSDNLDKIPQISDDIKNMLRSNS 475

Query: 542 SVTFQNGVPLCYASR 586
+ P C+ SR
Sbjct: 476 KIFLGKEAPYCFLSR 490


>tr|A9SDD7|A9SDD7_PHYPA MscS-Like mechanosensitive ion channel MSCL2
OS=Physcomitrella patens subsp. patens GN=MSCL2 PE=4
SV=1
Length = 360

Score = 224 bits (572), Expect = 2e-57
Identities = 105/193 (54%), Positives = 141/193 (73%)
Frame = +2

Query: 8 VWFLHRWKSNVLARMLANQNVGSAEKERFHALDKISSMGLFILGAMGVAETFGIAAHSIL 187
+WFL+RWKSN RM+ + + +AE+ER+ +D++SS+GLF+LGAM AE G+A SIL
Sbjct: 118 IWFLYRWKSNAFTRMVTGKTISNAERERYLTMDRLSSVGLFVLGAMAFAEACGVAVQSIL 177

Query: 188 XXXXXXXXXXXXXXRDILGNMLSGFALQFMKPFSIGDTIKAGSVEGQVLDIGLTSTQLLD 367
RDILGNMLSG ALQF +PF++GDTI AGSV GQV+++GL +TQLL+
Sbjct: 178 TVGGIGGVATAFAARDILGNMLSGVALQFSRPFTVGDTISAGSVNGQVVEMGLHTTQLLN 237

Query: 368 LEKFPVAVPNSFFSSQVIVNKSRATWRAFSVKIPVQLNDYEKIPQITQEIKNMLKSHPSV 547
+KFP+ VPNSFFS+QVI+NKSRA +RA+S +PV + D EKIP IT EI++M++SHP V
Sbjct: 238 SDKFPIVVPNSFFSNQVIINKSRARYRAYSFNLPVHIQDLEKIPSITSEIRHMIESHPKV 297

Query: 548 TFQNGVPLCYASR 586
+ P CY S+
Sbjct: 298 FLEKEKPRCYVSQ 310


>tr|Q8VZL4|Q8VZL4_ARATH Putative uncharacterized protein At4g00290
(Putative uncharacterized protein At4g00291)
OS=Arabidopsis thaliana GN=At4g00291 PE=2 SV=1
Length = 497

Score = 222 bits (566), Expect = 1e-56
Identities = 110/195 (56%), Positives = 142/195 (72%)
Frame = +2

Query: 2 ALVWFLHRWKSNVLARMLANQNVGSAEKERFHALDKISSMGLFILGAMGVAETFGIAAHS 181
+LVWFL+RWK+NV+ RML+ ++ G ++E+ LDK+SS+GLF +G M AE G+A S
Sbjct: 250 SLVWFLYRWKTNVITRMLSAKSFGGLDREKVLTLDKVSSVGLFAIGLMASAEACGVAVQS 309

Query: 182 ILXXXXXXXXXXXXXXRDILGNMLSGFALQFMKPFSIGDTIKAGSVEGQVLDIGLTSTQL 361
IL RDILGN+LSG ++QF +PFS+GDTIKAGSVEGQV+++GLT+T L
Sbjct: 310 ILTVGGVGGVATAFAARDILGNVLSGLSMQFSRPFSMGDTIKAGSVEGQVIEMGLTTTSL 369

Query: 362 LDLEKFPVAVPNSFFSSQVIVNKSRATWRAFSVKIPVQLNDYEKIPQITQEIKNMLKSHP 541
L+ EKFPV VPNS FSSQVIVNKSRA WRA + KIP+Q++D + IPQI+ EIK ML+S+
Sbjct: 370 LNAEKFPVLVPNSLFSSQVIVNKSRAQWRAIASKIPLQIDDLDMIPQISNEIKEMLRSNT 429

Query: 542 SVTFQNGVPLCYASR 586
V P CY SR
Sbjct: 430 KVFLGKEAPHCYLSR 444


>tr|B4FE51|B4FE51_MAIZE Putative uncharacterized protein OS=Zea mays
PE=2 SV=1
Length = 531

Score = 217 bits (552), Expect = 4e-55
Identities = 104/195 (53%), Positives = 139/195 (71%)
Frame = +2

Query: 2 ALVWFLHRWKSNVLARMLANQNVGSAEKERFHALDKISSMGLFILGAMGVAETFGIAAHS 181
+ VWFL RWK+N +A+ + + S +++R A DK+SS+GL LG MG+AE GIA S
Sbjct: 286 SFVWFLQRWKTNFIAKAMTKLDASSVDRDRISAFDKVSSLGLIGLGVMGLAEACGIAVQS 345

Query: 182 ILXXXXXXXXXXXXXXRDILGNMLSGFALQFMKPFSIGDTIKAGSVEGQVLDIGLTSTQL 361
IL RD+LGN+LSGF+LQF KPFS+ D IKAGS+EG+V++IGLTST L
Sbjct: 346 ILTVGGVGGVATAFAARDVLGNILSGFSLQFSKPFSVNDYIKAGSIEGKVVEIGLTSTSL 405

Query: 362 LDLEKFPVAVPNSFFSSQVIVNKSRATWRAFSVKIPVQLNDYEKIPQITQEIKNMLKSHP 541
++ EK PV VPNS FSSQ+IVN+SRA WRA KIP+++ D EK+P ++EIK ML+S+
Sbjct: 406 INPEKLPVIVPNSLFSSQMIVNRSRANWRASVTKIPIRIEDIEKVPSASEEIKTMLRSNQ 465

Query: 542 SVTFQNGVPLCYASR 586
+V+F + VP CY SR
Sbjct: 466 NVSFDSDVPYCYLSR 480


>tr|Q0JAT1|Q0JAT1_ORYSJ Os04g0578700 protein (Fragment) OS=Oryza
sativa subsp. japonica GN=Os04g0578700 PE=4 SV=1
Length = 568

Score = 203 bits (516), Expect = 7e-51
Identities = 103/197 (52%), Positives = 136/197 (69%), Gaps = 2/197 (1%)
Frame = +2

Query: 2 ALVWFLHRWKSNVLARMLANQNVGSAEKERFHALDKISSMGLFILGAMGVAETFGIAAHS 181
+ VWFLHRWK+N + ++ A+ S ++ R A DKISS+GL LG M +AE G+AA S
Sbjct: 325 SFVWFLHRWKTNFITKVAAS----SIDQTRLSAFDKISSLGLIALGVMALAEACGVAAQS 380

Query: 182 ILXXXXXXXXXXXXXXRDILGNMLSGFALQFMKPFSIGDTIKAGSVEGQVLDIGLTSTQL 361
IL RD+LGNMLSGF+LQF PF G+ IKAGS+EG+V++IGLTST+L
Sbjct: 381 ILTVGGVGGVATAFAARDVLGNMLSGFSLQFSSPFKAGEYIKAGSIEGKVIEIGLTSTEL 440

Query: 362 LDLEKFPVAVPNSFFSSQVIVNKSRATWRAFSVKIPVQLNDYEKIPQITQEIKNMLKSHP 541
++ E+ PV VPNS FSSQVIVN+SRA WR+ KIP+++ D EK+P I++EIK ML+S+P
Sbjct: 441 MNPEQLPVTVPNSLFSSQVIVNRSRAKWRSNVTKIPIRIEDIEKVPAISEEIKVMLRSNP 500

Query: 542 SVTFQN--GVPLCYASR 586
V + P CY SR
Sbjct: 501 KVVLDSEAPAPYCYLSR 517


>tr|Q01KI1|Q01KI1_ORYSA H0404F02.16 protein OS=Oryza sativa
GN=H0404F02.16 PE=4 SV=1
Length = 524

Score = 203 bits (516), Expect = 7e-51
Identities = 103/197 (52%), Positives = 136/197 (69%), Gaps = 2/197 (1%)
Frame = +2

Query: 2 ALVWFLHRWKSNVLARMLANQNVGSAEKERFHALDKISSMGLFILGAMGVAETFGIAAHS 181
+ VWFLHRWK+N + ++ A+ S ++ R A DKISS+GL LG M +AE G+AA S
Sbjct: 281 SFVWFLHRWKTNFITKVAAS----SIDQTRLSAFDKISSLGLIALGVMALAEACGVAAQS 336

Query: 182 ILXXXXXXXXXXXXXXRDILGNMLSGFALQFMKPFSIGDTIKAGSVEGQVLDIGLTSTQL 361
IL RD+LGNMLSGF+LQF PF G+ IKAGS+EG+V++IGLTST+L
Sbjct: 337 ILTVGGVGGVATAFAARDVLGNMLSGFSLQFSSPFKAGEYIKAGSIEGKVIEIGLTSTEL 396

Query: 362 LDLEKFPVAVPNSFFSSQVIVNKSRATWRAFSVKIPVQLNDYEKIPQITQEIKNMLKSHP 541
++ E+ PV VPNS FSSQVIVN+SRA WR+ KIP+++ D EK+P I++EIK ML+S+P
Sbjct: 397 MNPEQLPVTVPNSLFSSQVIVNRSRAKWRSNVTKIPIRIEDIEKVPAISEEIKVMLRSNP 456

Query: 542 SVTFQN--GVPLCYASR 586
V + P CY SR
Sbjct: 457 KVVLDSEAPAPYCYLSR 473


>tr|B8ATA7|B8ATA7_ORYSI Putative uncharacterized protein OS=Oryza
sativa subsp. indica GN=OsI_17085 PE=4 SV=1
Length = 524

Score = 203 bits (516), Expect = 7e-51
Identities = 103/197 (52%), Positives = 136/197 (69%), Gaps = 2/197 (1%)
Frame = +2

Query: 2 ALVWFLHRWKSNVLARMLANQNVGSAEKERFHALDKISSMGLFILGAMGVAETFGIAAHS 181
+ VWFLHRWK+N + ++ A+ S ++ R A DKISS+GL LG M +AE G+AA S
Sbjct: 281 SFVWFLHRWKTNFITKVAAS----SIDQTRLSAFDKISSLGLIALGVMALAEACGVAAQS 336

Query: 182 ILXXXXXXXXXXXXXXRDILGNMLSGFALQFMKPFSIGDTIKAGSVEGQVLDIGLTSTQL 361
IL RD+LGNMLSGF+LQF PF G+ IKAGS+EG+V++IGLTST+L
Sbjct: 337 ILTVGGVGGVATAFAARDVLGNMLSGFSLQFSSPFKAGEYIKAGSIEGKVIEIGLTSTEL 396

Query: 362 LDLEKFPVAVPNSFFSSQVIVNKSRATWRAFSVKIPVQLNDYEKIPQITQEIKNMLKSHP 541
++ E+ PV VPNS FSSQVIVN+SRA WR+ KIP+++ D EK+P I++EIK ML+S+P
Sbjct: 397 MNPEQLPVTVPNSLFSSQVIVNRSRAKWRSNVTKIPIRIEDIEKVPAISEEIKVMLRSNP 456

Query: 542 SVTFQN--GVPLCYASR 586
V + P CY SR
Sbjct: 457 KVVLDSEAPAPYCYLSR 473


>tr|B8AGQ0|B8AGQ0_ORYSI Putative uncharacterized protein OS=Oryza
sativa subsp. indica GN=OsI_08477 PE=4 SV=1
Length = 510

Score = 200 bits (509), Expect = 4e-50
Identities = 99/195 (50%), Positives = 132/195 (67%)
Frame = +2

Query: 2 ALVWFLHRWKSNVLARMLANQNVGSAEKERFHALDKISSMGLFILGAMGVAETFGIAAHS 181
+L+WFL +WK+N +A ++ NQ+ +++R DK+SS+ L LG M +AE G+ S
Sbjct: 278 SLLWFLQKWKTNFIANIMTNQSAIGVDRDRLLTFDKVSSLALIALGGMALAEACGVPVQS 337

Query: 182 ILXXXXXXXXXXXXXXRDILGNMLSGFALQFMKPFSIGDTIKAGSVEGQVLDIGLTSTQL 361
IL RD+LGN+LSG +LQF KPF +GD IKAGS+EG+V++IGLTST L
Sbjct: 338 ILTVGGVGGVATAFAARDVLGNILSGLSLQFSKPFLVGDNIKAGSIEGKVIEIGLTSTSL 397

Query: 362 LDLEKFPVAVPNSFFSSQVIVNKSRATWRAFSVKIPVQLNDYEKIPQITQEIKNMLKSHP 541
++ E PV VPNS FSSQ+IVNKSRA WRA VKIPV + D EKIP I++EIK L+S+P
Sbjct: 398 INPENLPVVVPNSLFSSQIIVNKSRAVWRASVVKIPVIIEDLEKIPTISEEIKVKLRSNP 457

Query: 542 SVTFQNGVPLCYASR 586
++ P CY SR
Sbjct: 458 NI----DAPYCYLSR 468


>tr|Q6EPN3|Q6EPN3_ORYSJ Os02g0681000 protein OS=Oryza sativa subsp.
japonica GN=P0663F07.32 PE=2 SV=1
Length = 510

Score = 199 bits (505), Expect = 1e-49
Identities = 99/195 (50%), Positives = 132/195 (67%)
Frame = +2

Query: 2 ALVWFLHRWKSNVLARMLANQNVGSAEKERFHALDKISSMGLFILGAMGVAETFGIAAHS 181
+L+WFL +WK+N +A ++ NQ+ +++R DK+SS+ L LG M +AE G+ S
Sbjct: 278 SLLWFLQKWKTNFIANIMTNQSAIGMDRDRLLTFDKVSSLALIALGGMALAEACGVPVQS 337

Query: 182 ILXXXXXXXXXXXXXXRDILGNMLSGFALQFMKPFSIGDTIKAGSVEGQVLDIGLTSTQL 361
IL RD+LGN+LSG +LQF KPF +GD IKAGS+EG+V++IGLTST L
Sbjct: 338 ILTVGGVGGVATAFAARDVLGNILSGLSLQFSKPFLVGDNIKAGSIEGKVIEIGLTSTLL 397

Query: 362 LDLEKFPVAVPNSFFSSQVIVNKSRATWRAFSVKIPVQLNDYEKIPQITQEIKNMLKSHP 541
++ E PV VPNS FSSQ+IVNKSRA WRA VKIPV + D EKIP I++EIK L+S+P
Sbjct: 398 INPENLPVVVPNSLFSSQIIVNKSRAVWRARVVKIPVIIEDLEKIPTISEEIKVKLRSNP 457

Query: 542 SVTFQNGVPLCYASR 586
++ P CY SR
Sbjct: 458 NI----DAPYCYLSR 468


>tr|A3AA49|A3AA49_ORYSJ Putative uncharacterized protein OS=Oryza
sativa subsp. japonica GN=OsJ_007671 PE=4 SV=1
Length = 512

Score = 199 bits (505), Expect = 1e-49
Identities = 99/195 (50%), Positives = 132/195 (67%)
Frame = +2

Query: 2 ALVWFLHRWKSNVLARMLANQNVGSAEKERFHALDKISSMGLFILGAMGVAETFGIAAHS 181
+L+WFL +WK+N +A ++ NQ+ +++R DK+SS+ L LG M +AE G+ S
Sbjct: 278 SLLWFLQKWKTNFIANIMTNQSAIGMDRDRLLTFDKVSSLALIALGGMALAEACGVPVQS 337

Query: 182 ILXXXXXXXXXXXXXXRDILGNMLSGFALQFMKPFSIGDTIKAGSVEGQVLDIGLTSTQL 361
IL RD+LGN+LSG +LQF KPF +GD IKAGS+EG+V++IGLTST L
Sbjct: 338 ILTVGGVGGVATAFAARDVLGNILSGLSLQFSKPFLVGDNIKAGSIEGKVIEIGLTSTLL 397

Query: 362 LDLEKFPVAVPNSFFSSQVIVNKSRATWRAFSVKIPVQLNDYEKIPQITQEIKNMLKSHP 541
++ E PV VPNS FSSQ+IVNKSRA WRA VKIPV + D EKIP I++EIK L+S+P
Sbjct: 398 INPENLPVVVPNSLFSSQIIVNKSRAVWRARVVKIPVIIEDLEKIPTISEEIKVKLRSNP 457

Query: 542 SVTFQNGVPLCYASR 586
++ P CY SR
Sbjct: 458 NI----DAPYCYLSR 468