DK950564
Clone id TST38A01NGRL0008_P23
Library
Length 627
Definition Adiantum capillus-veneris mRNA. clone: TST38A01NGRL0008_P23. 5' end sequence.
Accession
Tissue type prothallia
Developmental stage gametophyte
Contig ID -
Sequence
ATCGCATTGATACTACAGTGCCCATCGAAGAGACGATGTATGAACTCAAAAAGATGGTGG
AAGAAGGAAAAATAAAGTATATAGGTTTATCTGAGGCAAGCCCTGATTCCCTTCGGAGAG
CTCATGCTGTTCATCCAATAAGTGCAGTACAGCTTGAGTGGTCTTTGTGGACCAGGGATG
TGGAAGAAGATATTGTTCCTTTGTGTAGAGAGCTGGGCATTGGGATTGTAGTATATAGTC
CACTGGGCCGTGGATTCTTTTCCGGAAAGGCATCAACCGAACAACTCTCTGCTGCAGATA
GAAGACAGGCTCAACATCCGCGGTTTCAGAAAGAAAACCTTGAGAAAAACAAGGTCTTCT
TTGAGCGTCTATCGAAATTGGCTGAGAAGCATGGCTGTACACCAGGGCAACTTGCTCTTG
CATGGCTGTTGCACCAGGCGGATGTAGTGCCCATTCCAGGAACATCGAAGATTACGAATC
TTGAAGAGAACTTGGGCGCTCTTAACGTGAAGCTCTCACAAGAAGATATAAAAGAAATTG
CTGCCGCTGTACCTGTTGACGAGGTTGCCGGATTGAGATACCCTGACAAACACTACCGAC
ATACATATNAGTTTGCCAATACCCCCC
■■Homology search results ■■ -
sp_hit_id P40691
Definition sp|P40691|A115_TOBAC Auxin-induced protein PCNT115 OS=Nicotiana tabacum
Align length 166
Score (bit) 218.0
E-value 2.0e-56
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= DK950564|Adiantum capillus-veneris mRNA, clone:
TST38A01NGRL0008_P23, 5'
(627 letters)

Database: uniprot_sprot.fasta
412,525 sequences; 148,809,765 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

sp|P40691|A115_TOBAC Auxin-induced protein PCNT115 OS=Nicotiana ... 218 2e-56
sp|Q09923|YAKC_SCHPO Aldo-keto reductase yakc [NADP+] OS=Schizos... 174 4e-43
sp|P49249|IN22_MAIZE IN2-2 protein OS=Zea mays GN=IN2-2 PE=2 SV=1 171 4e-42
sp|O14295|PLR1_SCHPO Pyridoxal reductase OS=Schizosaccharomyces ... 138 2e-32
sp|O94521|PLR2_SCHPO Probable pyridoxal reductase 2 OS=Schizosac... 126 8e-29
sp|Q00049|NORA_ASPFL Norsolorinic acid reductase OS=Aspergillus ... 104 3e-22
sp|P77256|YDJG_ECOLI Uncharacterized oxidoreductase ydjG OS=Esch... 104 4e-22
sp|Q00258|NORA_ASPPA Norsolorinic acid reductase OS=Aspergillus ... 104 4e-22
sp|P46905|YCCK_BACSU Uncharacterized oxidoreductase yccK OS=Baci... 97 5e-20
sp|Q9P7U2|YI7E_SCHPO Putative aryl-alcohol dehydrogenase C977.14... 95 3e-19
sp|Q00727|STCV_EMENI Putative sterigmatocystin biosynthesis dehy... 94 4e-19
sp|P77735|YAJO_ECOLI Uncharacterized oxidoreductase yajO OS=Esch... 94 6e-19
sp|O14125|YEZB_SCHPO Uncharacterized oxidoreductase C3A11.11c OS... 93 1e-18
sp|Q07747|AAD4_YEAST Probable aryl-alcohol dehydrogenase AAD4 OS... 92 3e-18
sp|P42884|AAD14_YEAST Putative aryl-alcohol dehydrogenase AAD14 ... 91 6e-18
sp|P47182|AAD10_YEAST Putative aryl-alcohol dehydrogenase AAD10 ... 91 6e-18
sp|Q06494|PLR1_YEAST Putative pyridoxal reductase OS=Saccharomyc... 89 2e-17
sp|P46336|IOLS_BACSU Protein iolS OS=Bacillus subtilis GN=iolS P... 88 4e-17
sp|P80874|GS69_BACSU General stress protein 69 OS=Bacillus subti... 88 4e-17
sp|Q94A68|Y1669_ARATH Uncharacterized oxidoreductase At1g06690, ... 86 1e-16
sp|P63485|Y2320_MYCBO Uncharacterized oxidoreductase Mb2320 OS=M... 83 1e-15
sp|P63484|Y2298_MYCTU Uncharacterized oxidoreductase Rv2298/MT23... 83 1e-15
sp|O59826|KCAB_SCHPO Putative voltage-gated potassium channel su... 82 3e-15
sp|P25612|AAD3_YEAST Putative aryl-alcohol dehydrogenase AAD3 OS... 82 3e-15
sp|O94315|YH5B_SCHPO Uncharacterized oxidoreductase C215.11c OS=... 79 1e-14
sp|Q13303|KCAB2_HUMAN Voltage-gated potassium channel subunit be... 77 9e-14
sp|Q27955|KCAB2_BOVIN Voltage-gated potassium channel subunit be... 77 9e-14
sp|P62483|KCAB2_RAT Voltage-gated potassium channel subunit beta... 76 1e-13
sp|P62482|KCAB2_MOUSE Voltage-gated potassium channel subunit be... 76 1e-13
sp|O05408|YRPG_BACSU Uncharacterized oxidoreductase yrpG OS=Baci... 76 2e-13

>sp|P40691|A115_TOBAC Auxin-induced protein PCNT115 OS=Nicotiana
tabacum PE=2 SV=1
Length = 307

Score = 218 bits (556), Expect = 2e-56
Identities = 111/166 (66%), Positives = 132/166 (79%), Gaps = 2/166 (1%)
Frame = +3

Query: 3 RIDTTVPIEETMYELKKMVEEGKIKYIGLSEASPDSLRRAHAVHPISAVQLEWSLWTRDV 182
R+DT VPIE T+ ELKK+VEEGK+KYIGLSEAS ++RRAHAVHPI+AVQLEWSLW+RDV
Sbjct: 137 RVDTRVPIEITVGELKKLVEEGKLKYIGLSEASASTIRRAHAVHPITAVQLEWSLWSRDV 196

Query: 183 EEDIVPLCRELGIGIVVYSPLGRGFF-SGKASTEQLSAADRRQAQHPRFQKENLEKNKVF 359
EE+I+P CRELGIGIV YSPLGRGF SG E +S D R+ PRFQ ENLE NK
Sbjct: 197 EEEIIPTCRELGIGIVAYSPLGRGFLSSGPKLLEDMSNEDYRK-YLPRFQAENLENNKNL 255

Query: 360 FERLSKLAEKHGCTPGQLALAWLLHQA-DVVPIPGTSKITNLEENL 494
+ER+ ++A + GCTP QLALAW+ HQ DV PIPGT+KI NL +N+
Sbjct: 256 YERICEMAVRKGCTPSQLALAWVHHQGNDVCPIPGTTKIENLNQNM 301


>sp|Q09923|YAKC_SCHPO Aldo-keto reductase yakc [NADP+]
OS=Schizosaccharomyces pombe GN=yakc PE=1 SV=1
Length = 340

Score = 174 bits (440), Expect = 4e-43
Identities = 98/199 (49%), Positives = 129/199 (64%), Gaps = 5/199 (2%)
Frame = +3

Query: 3 RIDTTVPIEETMYELKKMVEEGKIKYIGLSEASPDSLRRAHAVHPISAVQLEWSLWTRDV 182
R PIE+ M LKK VE GKI+YIGLSE S +++RRA AV+P+SAVQ+E+S ++ ++
Sbjct: 127 RFSGETPIEKIMGALKKCVEAGKIRYIGLSECSANTIRRAAAVYPVSAVQVEYSPFSLEI 186

Query: 183 EE---DIVPLCRELGIGIVVYSPLGRGFFSGK-ASTEQLSAADRRQAQHPRFQKENLEKN 350
E ++ CRE I IV Y+PLGRGF +G S + D R+ + PR+QKEN KN
Sbjct: 187 ERPEIGVMKACRENNITIVCYAPLGRGFLTGAYKSPDDFPEGDFRR-KAPRYQKENFYKN 245

Query: 351 KVFFERLSKLAEKHGCTPGQLALAWLLHQA-DVVPIPGTSKITNLEENLGALNVKLSQED 527
++ K+A + TPGQL+LAWLL Q D++PIPGT ++ LEEN GAL VKLS
Sbjct: 246 LELVTKIEKIATANNITPGQLSLAWLLAQGDDILPIPGTKRVKYLEENFGALKVKLSDAT 305

Query: 528 IKEIAAAVPVDEVAGLRYP 584
+KEI A EV G RYP
Sbjct: 306 VKEIREACDNAEVIGARYP 324


>sp|P49249|IN22_MAIZE IN2-2 protein OS=Zea mays GN=IN2-2 PE=2 SV=1
Length = 306

Score = 171 bits (432), Expect = 4e-42
Identities = 88/126 (69%), Positives = 100/126 (79%), Gaps = 1/126 (0%)
Frame = +3

Query: 3 RIDTTVPIEETMYELKKMVEEGKIKYIGLSEASPDSLRRAHAVHPISAVQLEWSLWTRDV 182
RID VPIE T+ ELKK+VEEGKIKYIGLSEAS ++RRAHAVHPI+AVQLEWSLW+RD
Sbjct: 132 RIDKRVPIEVTIGELKKLVEEGKIKYIGLSEASASTIRRAHAVHPITAVQLEWSLWSRDA 191

Query: 183 EEDIVPLCRELGIGIVVYSPLGRGFF-SGKASTEQLSAADRRQAQHPRFQKENLEKNKVF 359
EEDI+P CRELGIGIV YSPLGRGFF SG + LS D R+ PRFQ ENL+KN
Sbjct: 192 EEDIIPTCRELGIGIVAYSPLGRGFFSSGAKLVDSLSEQDFRK-HMPRFQPENLDKNAQI 250

Query: 360 FERLSK 377
FER+ +
Sbjct: 251 FERVRR 256


>sp|O14295|PLR1_SCHPO Pyridoxal reductase OS=Schizosaccharomyces
pombe GN=plr1 PE=1 SV=1
Length = 333

Score = 138 bits (348), Expect = 2e-32
Identities = 77/203 (37%), Positives = 123/203 (60%), Gaps = 7/203 (3%)
Frame = +3

Query: 3 RIDTTVPIEETMYELKKMVEEGKIKYIGLSEASPDSLRRAHAVHPISAVQLEWSLWTRDV 182
R+D VPIE TM LK V+ GKI +GLSE S ++++RAHAV PI+AV++E+SL++RD+
Sbjct: 124 RVDPNVPIETTMKTLKGFVDSGKISCVGLSEVSAETIKRAHAVVPIAAVEVEYSLFSRDI 183

Query: 183 EED-IVPLCRELGIGIVVYSPLGRGFFSGKAST----EQLSAADRRQAQHPRFQKENLEK 347
E + I+ +CR+L I I+ YSP RG +G+ T ++ + + RF + K
Sbjct: 184 ETNGIMDICRKLSIPIIAYSPFCRGLLTGRIKTVEDLKEFAKSFPFLEYLDRFSPDVFAK 243

Query: 348 NKVFFERLSKLAEKHGCTPGQLALAWLLHQAD--VVPIPGTSKITNLEENLGALNVKLSQ 521
N F + + +LA+K G T + +L +++ + V+PIPG++ ++ + NL ALN LS
Sbjct: 244 NLPFLQAVEQLAKKFGMTMPEFSLLFIMASGNGLVIPIPGSTSVSRTKSNLNALNKSLSP 303

Query: 522 EDIKEIAAAVPVDEVAGLRYPDK 590
E KE + + GLRY ++
Sbjct: 304 EQFKEAKEVLSKYPIYGLRYNEQ 326


>sp|O94521|PLR2_SCHPO Probable pyridoxal reductase 2
OS=Schizosaccharomyces pombe GN=SPCC1281.04 PE=2 SV=1
Length = 333

Score = 126 bits (317), Expect = 8e-29
Identities = 72/200 (36%), Positives = 116/200 (58%), Gaps = 7/200 (3%)
Frame = +3

Query: 3 RIDTTVPIEETMYELKKMVEEGKIKYIGLSEASPDSLRRAHAVHPISAVQLEWSLWTRDV 182
R+D VPIE TM LK V+ G+I +GLSEAS +S++RA A+ PI+AV+ E+SL++RD+
Sbjct: 124 RVDHKVPIETTMKALKAFVDSGEISCVGLSEASAESIKRALAIVPIAAVETEYSLFSRDI 183

Query: 183 EED-IVPLCRELGIGIVVYSPLGRGFFSGKAST----EQLSAADRRQAQHPRFQKENLEK 347
E++ I+ C +L I I+ Y+P G +G+ T + A +F + EK
Sbjct: 184 EKNGILDTCTQLSIPIIAYAPFCHGLLTGRVKTAEDLKDFIKAFPFLRNMDKFNPKVFEK 243

Query: 348 NKVFFERLSKLAEKHGCTPGQLALAWLLHQAD--VVPIPGTSKITNLEENLGALNVKLSQ 521
N F + + +LA+K G + + AL +++ ++PIPG++ + E NL AL LS
Sbjct: 244 NIPFLKAVEQLAQKFGMSMPEFALNFIIANGKGMIIPIPGSTTVQRAESNLSALKKSLSS 303

Query: 522 EDIKEIAAAVPVDEVAGLRY 581
E ++E + ++ GLRY
Sbjct: 304 EQLEEAKKVLDKHQIFGLRY 323


>sp|Q00049|NORA_ASPFL Norsolorinic acid reductase OS=Aspergillus
flavus GN=norA PE=3 SV=1
Length = 388

Score = 104 bits (260), Expect = 3e-22
Identities = 64/191 (33%), Positives = 102/191 (53%), Gaps = 7/191 (3%)
Frame = +3

Query: 9 DTTVPIEETMYELKKMVEEGKIKYIGLSEASP------DSLRRAHAVHPISAVQLEWSLW 170
D T +EE M L +V GK+ Y+G+S+ ++ RA+ + P S Q WS
Sbjct: 151 DFTTSVEEVMRSLNHLVANGKVLYLGVSDTPAWLVVKCNAFARANGLTPFSVYQGHWSCA 210

Query: 171 TRDVEEDIVPLCRELGIGIVVYSPLGRGFFSGKASTEQLSAADRRQAQHPRFQKENLEKN 350
RD E DI+P+C G+G+ + LGRG F S E+ S R+ EK+
Sbjct: 211 FRDFERDILPMCESEGMGLAPWGVLGRGQF---RSAEEFSREGRKMGPQD-------EKH 260

Query: 351 KVFFERLSKLAEKHGCTPGQLALAWLLHQAD-VVPIPGTSKITNLEENLGALNVKLSQED 527
+ E+L ++A++ +A A+++H+A V P+ G K+ +L+EN+ AL + LS+E+
Sbjct: 261 RRLGEKLDQMAQQKNTKATSIAQAYVMHKAPYVFPVIGGRKVEHLKENIEALGLVLSEEE 320

Query: 528 IKEIAAAVPVD 560
I+EI A P D
Sbjct: 321 IREIDDAEPFD 331


>sp|P77256|YDJG_ECOLI Uncharacterized oxidoreductase ydjG
OS=Escherichia coli (strain K12) GN=ydjG PE=3 SV=1
Length = 326

Score = 104 bits (259), Expect = 4e-22
Identities = 62/181 (34%), Positives = 101/181 (55%), Gaps = 4/181 (2%)
Frame = +3

Query: 21 PIEETMYELKKMVEEGKIKYIGLSEASPDSLRRAHAVHPISAVQLEWSLWTRDVEEDIVP 200
PI ET+ L ++ EGKI+ IG + D +R + +Q ++S+ R +E +++P
Sbjct: 146 PIAETVAVLNELKSEGKIRAIGAANVDADHIREYLQYGELDIIQAKYSILDRAMENELLP 205

Query: 201 LCRELGIGIVVYSPLGRGFFSGKASTEQLSAADRRQAQHPRFQKENLEKNKVFFERLSKL 380
LCR+ GI + VYSPL +G +G + + + R A FQ+EN+ K E+ L
Sbjct: 206 LCRDNGIVVQVYSPLEQGLLTGTITRDYVPGGAR--ANKVWFQRENMLKVIDMLEQWQPL 263

Query: 381 AEKHGCTPGQLALAWLLHQADVVPI-PGTSKITNLEENLGALNVKLSQED---IKEIAAA 548
++ CT LALAW+L Q+D++ I G + + EN+ ALN+ LS D ++E+A A
Sbjct: 264 CARYQCTIPTLALAWILKQSDLISILSGATAPEQVRENVAALNINLSDADATLMREMAEA 323

Query: 549 V 551
+
Sbjct: 324 L 324


>sp|Q00258|NORA_ASPPA Norsolorinic acid reductase OS=Aspergillus
parasiticus GN=norA PE=3 SV=1
Length = 388

Score = 104 bits (259), Expect = 4e-22
Identities = 64/191 (33%), Positives = 102/191 (53%), Gaps = 7/191 (3%)
Frame = +3

Query: 9 DTTVPIEETMYELKKMVEEGKIKYIGLSEASP------DSLRRAHAVHPISAVQLEWSLW 170
D T +EE M L +V GK+ Y+G+S+ ++ RA+ + P S Q WS
Sbjct: 151 DFTTSVEEVMRSLNHLVANGKVLYLGVSDTPAWLVVKCNAFARANGLTPFSVYQGHWSSA 210

Query: 171 TRDVEEDIVPLCRELGIGIVVYSPLGRGFFSGKASTEQLSAADRRQAQHPRFQKENLEKN 350
RD E DI+P+C G+G+ + LGRG F S E+ S R+ EK+
Sbjct: 211 FRDFERDILPMCESEGMGLAPWGVLGRGQF---RSAEEFSREGRKMGPQD-------EKH 260

Query: 351 KVFFERLSKLAEKHGCTPGQLALAWLLHQAD-VVPIPGTSKITNLEENLGALNVKLSQED 527
+ E+L ++A++ +A A+++H+A V P+ G K+ +L+EN+ AL + LS+E+
Sbjct: 261 RRLGEKLDQMAQQKNTKATSIAQAYVMHKAPYVFPVIGGRKVEHLKENIEALGLVLSEEE 320

Query: 528 IKEIAAAVPVD 560
I+EI A P D
Sbjct: 321 IREIDDAEPFD 331


>sp|P46905|YCCK_BACSU Uncharacterized oxidoreductase yccK
OS=Bacillus subtilis GN=yccK PE=3 SV=2
Length = 310

Score = 97.4 bits (241), Expect = 5e-20
Identities = 58/179 (32%), Positives = 95/179 (53%), Gaps = 1/179 (0%)
Frame = +3

Query: 9 DTTVPIEETMYELKKMVEEGKIKYIGLSEASPDSLRRAHAVHPISAVQLEWSLWTRDVEE 188
D P+ E LK++ +EGKIK IG S L+ +A + Q E+SL RD E+
Sbjct: 130 DGKTPLAEVAGTLKELKDEGKIKAIGASNLDYQQLQDFNADGYLEVFQAEYSLIQRDAEK 189

Query: 189 DIVPLCRELGIGIVVYSPLGRGFFSGKASTEQLSAADRRQAQHPRFQKENLEKNKVFFER 368
+++P C + GI + Y PL G +GK + Q + D + P+FQ E N ++
Sbjct: 190 ELLPYCEKQGISFIPYFPLASGLLTGKFT--QDTVFDDFRKDKPQFQGETFIHNLKKVDK 247

Query: 369 LSKLAEKHGCTPGQLALAWLLHQADV-VPIPGTSKITNLEENLGALNVKLSQEDIKEIA 542
L +AE+ +ALAWLL + + IPG + L++NL LN++L+++++ I+
Sbjct: 248 LKAVAEEKQADTAHVALAWLLTRPAIDAIIPGAKRPEQLQDNLKTLNIELTEDEVNFIS 306


>sp|Q9P7U2|YI7E_SCHPO Putative aryl-alcohol dehydrogenase C977.14c
OS=Schizosaccharomyces pombe GN=SPAC977.14c PE=1 SV=1
Length = 351

Score = 95.1 bits (235), Expect = 3e-19
Identities = 61/186 (32%), Positives = 92/186 (49%), Gaps = 9/186 (4%)
Frame = +3

Query: 3 RIDTTVPIEETMYELKKMVEEGKIKYIGLSEA------SPDSLRRAHAVHPISAVQLEWS 164
R D V EE M L +VE GK++YIG S + H H ++Q +
Sbjct: 157 RYDPHVSAEEVMRALNDVVESGKVRYIGASTMRCYQFIELQNTAEKHGWHKFISMQNYHN 216

Query: 165 LWTRDVEEDIVPLCRELGIGIVVYSPLGRGFFSGKASTEQLSAADRRQAQHPRFQKENLE 344
L R+ E +++P C++ G+G++ +SPL RG T + A + LE
Sbjct: 217 LLYREEEREMIPYCQKTGVGLIPWSPLARGLL-----TRSIDANEETIRSKTDLYTRALE 271

Query: 345 KN---KVFFERLSKLAEKHGCTPGQLALAWLLHQADVVPIPGTSKITNLEENLGALNVKL 515
K R+ +LA+K+ + LA AW LH+ D PI G SK+ L++ L A+ +KL
Sbjct: 272 FGAGYKAILSRVEELAKKYNVSMATLATAWSLHKGD-YPIVGISKVERLKDALAAVELKL 330

Query: 516 SQEDIK 533
S+EDIK
Sbjct: 331 SEEDIK 336


tr_hit_id A9NNQ6
Definition tr|A9NNQ6|A9NNQ6_PICSI Putative uncharacterized protein OS=Picea sitchensis
Align length 209
Score (bit) 300.0
E-value 5.0e-80
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= DK950564|Adiantum capillus-veneris mRNA, clone:
TST38A01NGRL0008_P23, 5'
(627 letters)

Database: uniprot_trembl.fasta
7,341,751 sequences; 2,391,615,440 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

tr|A9NNQ6|A9NNQ6_PICSI Putative uncharacterized protein OS=Picea... 300 5e-80
tr|B8LS22|B8LS22_PICSI Putative uncharacterized protein OS=Picea... 293 6e-78
tr|A9TSS9|A9TSS9_PHYPA Predicted protein OS=Physcomitrella paten... 293 6e-78
tr|A7Q602|A7Q602_VITVI Chromosome chr14 scaffold_54, whole genom... 279 1e-73
tr|A5BYS5|A5BYS5_VITVI Putative uncharacterized protein OS=Vitis... 279 1e-73
tr|Q338B1|Q338B1_ORYSJ Os10g0419100 protein OS=Oryza sativa subs... 278 1e-73
tr|B8BGV3|B8BGV3_ORYSI Putative uncharacterized protein OS=Oryza... 278 1e-73
tr|A3C4T0|A3C4T0_ORYSJ Putative uncharacterized protein OS=Oryza... 278 1e-73
tr|A7Q5Z6|A7Q5Z6_VITVI Chromosome chr14 scaffold_54, whole genom... 277 3e-73
tr|B4FLT9|B4FLT9_MAIZE Putative uncharacterized protein OS=Zea m... 276 6e-73
tr|B4FHA1|B4FHA1_MAIZE Putative uncharacterized protein OS=Zea m... 276 6e-73
tr|B8LKC0|B8LKC0_PICSI Putative uncharacterized protein OS=Picea... 276 9e-73
tr|Q3L181|Q3L181_RAUSE Perakine reductase OS=Rauvolfia serpentin... 274 3e-72
tr|A9T3A1|A9T3A1_PHYPA Predicted protein OS=Physcomitrella paten... 272 1e-71
tr|A7Q601|A7Q601_VITVI Chromosome chr14 scaffold_54, whole genom... 271 2e-71
tr|A5BUQ7|A5BUQ7_VITVI Putative uncharacterized protein OS=Vitis... 271 2e-71
tr|A7Q5Z1|A7Q5Z1_VITVI Chromosome chr14 scaffold_54, whole genom... 271 2e-71
tr|A7Q5Z9|A7Q5Z9_VITVI Chromosome chr14 scaffold_54, whole genom... 270 4e-71
tr|A7Q5Z4|A7Q5Z4_VITVI Chromosome chr14 scaffold_54, whole genom... 270 4e-71
tr|A7NWU2|A7NWU2_VITVI Chromosome chr5 scaffold_2, whole genome ... 270 7e-71
tr|Q5ZBH8|Q5ZBH8_ORYSJ Putative auxin-induced protein (Os01g0618... 269 1e-70
tr|B8ABW4|B8ABW4_ORYSI Putative uncharacterized protein OS=Oryza... 269 1e-70
tr|A2ZVG1|A2ZVG1_ORYSJ Putative uncharacterized protein OS=Oryza... 269 1e-70
tr|B6TJT2|B6TJT2_MAIZE Auxin-induced protein PCNT115 OS=Zea mays... 267 4e-70
tr|B6T5H6|B6T5H6_MAIZE Auxin-induced protein PCNT115 OS=Zea mays... 265 1e-69
tr|A7Q5Z3|A7Q5Z3_VITVI Chromosome chr14 scaffold_54, whole genom... 265 1e-69
tr|A5B174|A5B174_VITVI Putative uncharacterized protein OS=Vitis... 265 1e-69
tr|B4FNF9|B4FNF9_MAIZE Putative uncharacterized protein OS=Zea m... 260 5e-68
tr|B4F840|B4F840_MAIZE Putative uncharacterized protein OS=Zea m... 260 5e-68
tr|Q7XT99|Q7XT99_ORYSJ Os04g0338000 protein OS=Oryza sativa subs... 255 1e-66

>tr|A9NNQ6|A9NNQ6_PICSI Putative uncharacterized protein OS=Picea
sitchensis PE=2 SV=1
Length = 339

Score = 300 bits (768), Expect = 5e-80
Identities = 145/209 (69%), Positives = 177/209 (84%), Gaps = 1/209 (0%)
Frame = +3

Query: 3 RIDTTVPIEETMYELKKMVEEGKIKYIGLSEASPDSLRRAHAVHPISAVQLEWSLWTRDV 182
R+DTTVPIEET+ ELKK+VEEGKIKYIGLSEAS D++RRAHAVHPI+AVQLEWSLWTRD+
Sbjct: 130 RVDTTVPIEETIGELKKLVEEGKIKYIGLSEASVDTIRRAHAVHPITAVQLEWSLWTRDI 189

Query: 183 EEDIVPLCRELGIGIVVYSPLGRGFFSGKASTEQLSAADRRQAQHPRFQKENLEKNKVFF 362
EE IVP+CRELGIGIV YSPLGRGFFSGKA E L + HPRF+ ENLEKNK+F+
Sbjct: 190 EESIVPVCRELGIGIVPYSPLGRGFFSGKAVVESL-PENSSLVSHPRFKGENLEKNKIFY 248

Query: 363 ERLSKLAEKHGCTPGQLALAWLLHQA-DVVPIPGTSKITNLEENLGALNVKLSQEDIKEI 539
++ LA+KHGCTPGQLALAW+LHQ DV+PIPGT+K NL+EN+G+LNV+LSQ+D++EI
Sbjct: 249 THIANLAKKHGCTPGQLALAWVLHQGDDVIPIPGTTKAKNLDENIGSLNVELSQQDLEEI 308

Query: 540 AAAVPVDEVAGLRYPDKHYRHTYXFANTP 626
++PVDEVAGLR + Y ++ F++TP
Sbjct: 309 VGSLPVDEVAGLRTYESMYHKSWIFSDTP 337


>tr|B8LS22|B8LS22_PICSI Putative uncharacterized protein OS=Picea
sitchensis PE=2 SV=1
Length = 339

Score = 293 bits (750), Expect = 6e-78
Identities = 143/209 (68%), Positives = 175/209 (83%), Gaps = 1/209 (0%)
Frame = +3

Query: 3 RIDTTVPIEETMYELKKMVEEGKIKYIGLSEASPDSLRRAHAVHPISAVQLEWSLWTRDV 182
R+DTTVPIEET+ ELKK+VEEGKIKYIGLSEAS D++RRAHAVHPI+AVQLEWSLWTRD+
Sbjct: 130 RVDTTVPIEETIGELKKLVEEGKIKYIGLSEASVDTIRRAHAVHPITAVQLEWSLWTRDI 189

Query: 183 EEDIVPLCRELGIGIVVYSPLGRGFFSGKASTEQLSAADRRQAQHPRFQKENLEKNKVFF 362
EE IVP+CRELGIGIV Y PLG GFFSGKA E L + PRF+ ENLEKNK+F+
Sbjct: 190 EESIVPVCRELGIGIVPYGPLGGGFFSGKAVVESL-PENSSLVSLPRFKGENLEKNKIFY 248

Query: 363 ERLSKLAEKHGCTPGQLALAWLLHQA-DVVPIPGTSKITNLEENLGALNVKLSQEDIKEI 539
+++ LA+KHGCTPGQLALAW+LHQ DV+PIPGT+K NL+EN+G+LNV+LSQ+D++EI
Sbjct: 249 TQVANLAKKHGCTPGQLALAWVLHQGDDVIPIPGTTKAKNLDENIGSLNVELSQQDLEEI 308

Query: 540 AAAVPVDEVAGLRYPDKHYRHTYXFANTP 626
++PVDEVAGLR + Y ++ FA+TP
Sbjct: 309 VGSLPVDEVAGLRIYESMYHKSWIFADTP 337


>tr|A9TSS9|A9TSS9_PHYPA Predicted protein OS=Physcomitrella patens
subsp. patens GN=PHYPADRAFT_197877 PE=4 SV=1
Length = 351

Score = 293 bits (750), Expect = 6e-78
Identities = 142/209 (67%), Positives = 175/209 (83%), Gaps = 1/209 (0%)
Frame = +3

Query: 3 RIDTTVPIEETMYELKKMVEEGKIKYIGLSEASPDSLRRAHAVHPISAVQLEWSLWTRDV 182
R+DT VPIE T+ ELKK+VEEGKIKYIGLSEAS D++RRAHAVHPI+AVQ+EWSLW+RD+
Sbjct: 134 RVDTKVPIEVTVGELKKLVEEGKIKYIGLSEASADTIRRAHAVHPITAVQIEWSLWSRDI 193

Query: 183 EEDIVPLCRELGIGIVVYSPLGRGFFSGKASTEQLSAADRRQAQHPRFQKENLEKNKVFF 362
EE+I+PLCRELGIGIV YSPLGRGFFSGKA E+L D R ++PRFQ EN+EKNKV +
Sbjct: 194 EEEIIPLCRELGIGIVSYSPLGRGFFSGKAVLEKLEETDLRPQRYPRFQGENVEKNKVLY 253

Query: 363 ERLSKLAEKHGCTPGQLALAWLLHQA-DVVPIPGTSKITNLEENLGALNVKLSQEDIKEI 539
ER++ LA+KH CTPGQLALAW+LHQ DVVPIPGT+KI NL EN+GA++V+L+ E++KE+
Sbjct: 254 ERVAALAKKHKCTPGQLALAWVLHQGEDVVPIPGTTKIPNLNENIGAISVELTPEELKEV 313

Query: 540 AAAVPVDEVAGLRYPDKHYRHTYXFANTP 626
AAAVP E+AG RY + + T+ TP
Sbjct: 314 AAAVPEHEIAGDRYNEALAKQTWKSVTTP 342


>tr|A7Q602|A7Q602_VITVI Chromosome chr14 scaffold_54, whole genome
shotgun sequence OS=Vitis vinifera GN=GSVIVT00031167001
PE=4 SV=1
Length = 351

Score = 279 bits (713), Expect = 1e-73
Identities = 136/209 (65%), Positives = 171/209 (81%), Gaps = 1/209 (0%)
Frame = +3

Query: 3 RIDTTVPIEETMYELKKMVEEGKIKYIGLSEASPDSLRRAHAVHPISAVQLEWSLWTRDV 182
RIDT++PIEETM ELKK+VEEGKIKYIGL EAS D++RRAHAVHPI+A+++EWSLWTR++
Sbjct: 135 RIDTSIPIEETMGELKKLVEEGKIKYIGLCEASSDTIRRAHAVHPITAIEMEWSLWTREI 194

Query: 183 EEDIVPLCRELGIGIVVYSPLGRGFFSGKASTEQLSAADRRQAQHPRFQKENLEKNKVFF 362
EE+I+PLCRELGIGIV YSPLGRGFF GKA+ E L A ++ +PRFQ EN EKNK+ +
Sbjct: 195 EEEILPLCRELGIGIVPYSPLGRGFFGGKAAGENLPANSFLRS-NPRFQGENFEKNKLLY 253

Query: 363 ERLSKLAEKHGCTPGQLALAWLLHQAD-VVPIPGTSKITNLEENLGALNVKLSQEDIKEI 539
++ LAEKH CTP QLALAWL HQ D VVPIPGT+KI N++ N+G+L +K +QE+++EI
Sbjct: 254 AKIEMLAEKHRCTPAQLALAWLFHQGDYVVPIPGTTKIKNIDNNIGSLRLKFTQEELEEI 313

Query: 540 AAAVPVDEVAGLRYPDKHYRHTYXFANTP 626
+AAV +EVAG R D R ++ FANTP
Sbjct: 314 SAAVTPEEVAGARVADNLIRCSWRFANTP 342


>tr|A5BYS5|A5BYS5_VITVI Putative uncharacterized protein OS=Vitis
vinifera GN=VITISV_000848 PE=4 SV=1
Length = 374

Score = 279 bits (713), Expect = 1e-73
Identities = 136/209 (65%), Positives = 171/209 (81%), Gaps = 1/209 (0%)
Frame = +3

Query: 3 RIDTTVPIEETMYELKKMVEEGKIKYIGLSEASPDSLRRAHAVHPISAVQLEWSLWTRDV 182
RIDT++PIEETM ELKK+VEEGKIKYIGL EAS D++RRAHAVHPI+A+++EWSLWTR++
Sbjct: 158 RIDTSIPIEETMGELKKLVEEGKIKYIGLCEASSDTIRRAHAVHPITAIEMEWSLWTREI 217

Query: 183 EEDIVPLCRELGIGIVVYSPLGRGFFSGKASTEQLSAADRRQAQHPRFQKENLEKNKVFF 362
EE+I+PLCRELGIGIV YSPLGRGFF GKA+ E L A ++ +PRFQ EN EKNK+ +
Sbjct: 218 EEEILPLCRELGIGIVPYSPLGRGFFGGKAAGENLPANSFLRS-NPRFQGENFEKNKLLY 276

Query: 363 ERLSKLAEKHGCTPGQLALAWLLHQAD-VVPIPGTSKITNLEENLGALNVKLSQEDIKEI 539
++ LAEKH CTP QLALAWL HQ D VVPIPGT+KI N++ N+G+L +K +QE+++EI
Sbjct: 277 AKIETLAEKHRCTPAQLALAWLFHQGDYVVPIPGTTKIKNIDNNIGSLRLKFTQEELEEI 336

Query: 540 AAAVPVDEVAGLRYPDKHYRHTYXFANTP 626
+AAV +EVAG R D R ++ FANTP
Sbjct: 337 SAAVTPEEVAGARVADNLIRCSWRFANTP 365


>tr|Q338B1|Q338B1_ORYSJ Os10g0419100 protein OS=Oryza sativa subsp.
japonica GN=Os10g0419100 PE=2 SV=1
Length = 343

Score = 278 bits (712), Expect = 1e-73
Identities = 133/209 (63%), Positives = 175/209 (83%), Gaps = 1/209 (0%)
Frame = +3

Query: 3 RIDTTVPIEETMYELKKMVEEGKIKYIGLSEASPDSLRRAHAVHPISAVQLEWSLWTRDV 182
RID +VPIEETM ELKK+VEEGK+K++GLSEAS D++RRAHAV+PI+AVQ+EWSLWTRD+
Sbjct: 131 RIDQSVPIEETMGELKKLVEEGKVKFVGLSEASADTIRRAHAVYPITAVQMEWSLWTRDI 190

Query: 183 EEDIVPLCRELGIGIVVYSPLGRGFFSGKASTEQLSAADRRQAQHPRFQKENLEKNKVFF 362
EE+I+PLCRELGIGIV YSP+GRGFF+G+A+ + + ++ +HPR+ ENLEKNKVF+
Sbjct: 191 EEEIIPLCRELGIGIVPYSPIGRGFFAGRAAVQSI-PSESWLTRHPRYNGENLEKNKVFY 249

Query: 363 ERLSKLAEKHGCTPGQLALAWLLHQA-DVVPIPGTSKITNLEENLGALNVKLSQEDIKEI 539
R+ +LA K+GC+P QLAL+W+LHQ DVVPIPGT+K+ NL++N+GA+ VKLS+ED+KEI
Sbjct: 250 TRIEELATKYGCSPAQLALSWVLHQGDDVVPIPGTTKVKNLDDNIGAVKVKLSKEDLKEI 309

Query: 540 AAAVPVDEVAGLRYPDKHYRHTYXFANTP 626
+AAVP EVAG R +++ ANTP
Sbjct: 310 SAAVPAGEVAGSRLIGVLEPYSWRVANTP 338


>tr|B8BGV3|B8BGV3_ORYSI Putative uncharacterized protein OS=Oryza
sativa subsp. indica GN=OsI_33599 PE=4 SV=1
Length = 343

Score = 278 bits (712), Expect = 1e-73
Identities = 133/209 (63%), Positives = 175/209 (83%), Gaps = 1/209 (0%)
Frame = +3

Query: 3 RIDTTVPIEETMYELKKMVEEGKIKYIGLSEASPDSLRRAHAVHPISAVQLEWSLWTRDV 182
RID +VPIEETM ELKK+VEEGK+K++GLSEAS D++RRAHAV+PI+AVQ+EWSLWTRD+
Sbjct: 131 RIDQSVPIEETMGELKKLVEEGKVKFVGLSEASADTIRRAHAVYPITAVQMEWSLWTRDI 190

Query: 183 EEDIVPLCRELGIGIVVYSPLGRGFFSGKASTEQLSAADRRQAQHPRFQKENLEKNKVFF 362
EE+I+PLCRELGIGIV YSP+GRGFF+G+A+ + + ++ +HPR+ ENLEKNKVF+
Sbjct: 191 EEEIIPLCRELGIGIVPYSPIGRGFFAGRAAVQSI-PSESWLTRHPRYNGENLEKNKVFY 249

Query: 363 ERLSKLAEKHGCTPGQLALAWLLHQA-DVVPIPGTSKITNLEENLGALNVKLSQEDIKEI 539
R+ +LA K+GC+P QLAL+W+LHQ DVVPIPGT+K+ NL++N+GA+ VKLS+ED+KEI
Sbjct: 250 TRIEELATKYGCSPAQLALSWVLHQGDDVVPIPGTTKVKNLDDNIGAVKVKLSKEDLKEI 309

Query: 540 AAAVPVDEVAGLRYPDKHYRHTYXFANTP 626
+AAVP EVAG R +++ ANTP
Sbjct: 310 SAAVPAGEVAGSRLIGVLEPYSWRVANTP 338


>tr|A3C4T0|A3C4T0_ORYSJ Putative uncharacterized protein OS=Oryza
sativa subsp. japonica GN=OsJ_030302 PE=4 SV=1
Length = 434

Score = 278 bits (712), Expect = 1e-73
Identities = 133/209 (63%), Positives = 175/209 (83%), Gaps = 1/209 (0%)
Frame = +3

Query: 3 RIDTTVPIEETMYELKKMVEEGKIKYIGLSEASPDSLRRAHAVHPISAVQLEWSLWTRDV 182
RID +VPIEETM ELKK+VEEGK+K++GLSEAS D++RRAHAV+PI+AVQ+EWSLWTRD+
Sbjct: 131 RIDQSVPIEETMGELKKLVEEGKVKFVGLSEASADTIRRAHAVYPITAVQMEWSLWTRDI 190

Query: 183 EEDIVPLCRELGIGIVVYSPLGRGFFSGKASTEQLSAADRRQAQHPRFQKENLEKNKVFF 362
EE+I+PLCRELGIGIV YSP+GRGFF+G+A+ + + ++ +HPR+ ENLEKNKVF+
Sbjct: 191 EEEIIPLCRELGIGIVPYSPIGRGFFAGRAAVQSI-PSESWLTRHPRYNGENLEKNKVFY 249

Query: 363 ERLSKLAEKHGCTPGQLALAWLLHQA-DVVPIPGTSKITNLEENLGALNVKLSQEDIKEI 539
R+ +LA K+GC+P QLAL+W+LHQ DVVPIPGT+K+ NL++N+GA+ VKLS+ED+KEI
Sbjct: 250 TRIEELATKYGCSPAQLALSWVLHQGDDVVPIPGTTKVKNLDDNIGAVKVKLSKEDLKEI 309

Query: 540 AAAVPVDEVAGLRYPDKHYRHTYXFANTP 626
+AAVP EVAG R +++ ANTP
Sbjct: 310 SAAVPAGEVAGSRLIGVLEPYSWRVANTP 338


>tr|A7Q5Z6|A7Q5Z6_VITVI Chromosome chr14 scaffold_54, whole genome
shotgun sequence OS=Vitis vinifera GN=GSVIVT00031159001
PE=4 SV=1
Length = 351

Score = 277 bits (709), Expect = 3e-73
Identities = 135/209 (64%), Positives = 170/209 (81%), Gaps = 1/209 (0%)
Frame = +3

Query: 3 RIDTTVPIEETMYELKKMVEEGKIKYIGLSEASPDSLRRAHAVHPISAVQLEWSLWTRDV 182
RIDT++PIEETM ELKK+VEEGKIKYIGL EAS D++RRAHAVHPI+A+++EWSLWTR++
Sbjct: 135 RIDTSIPIEETMGELKKLVEEGKIKYIGLCEASSDTIRRAHAVHPITAIEMEWSLWTREI 194

Query: 183 EEDIVPLCRELGIGIVVYSPLGRGFFSGKASTEQLSAADRRQAQHPRFQKENLEKNKVFF 362
EE+I+PLCRELGIGIV YSPLGRGFF GKA+ E L A ++ +PRFQ EN EKNK+ +
Sbjct: 195 EEEILPLCRELGIGIVPYSPLGRGFFGGKAAGENLPANSFLRS-NPRFQGENFEKNKLLY 253

Query: 363 ERLSKLAEKHGCTPGQLALAWLLHQAD-VVPIPGTSKITNLEENLGALNVKLSQEDIKEI 539
++ LAEKH CTP QLALAWL HQ D VVPIPGT+KI N++ N+G+L +K +QE+++EI
Sbjct: 254 AKIEMLAEKHRCTPAQLALAWLFHQGDYVVPIPGTTKIKNIDNNIGSLRLKFTQEELEEI 313

Query: 540 AAAVPVDEVAGLRYPDKHYRHTYXFANTP 626
+A V +EVAG R D R ++ FANTP
Sbjct: 314 SAGVTPEEVAGARVADNLIRCSWRFANTP 342


>tr|B4FLT9|B4FLT9_MAIZE Putative uncharacterized protein OS=Zea mays
PE=2 SV=1
Length = 332

Score = 276 bits (707), Expect = 6e-73
Identities = 134/209 (64%), Positives = 172/209 (82%), Gaps = 1/209 (0%)
Frame = +3

Query: 3 RIDTTVPIEETMYELKKMVEEGKIKYIGLSEASPDSLRRAHAVHPISAVQLEWSLWTRDV 182
RID +VPIEETM ELKK+VEEGK++Y+GLSEAS D++RRAHAVHPI+AVQLEWSLWTRD+
Sbjct: 122 RIDQSVPIEETMGELKKLVEEGKVRYVGLSEASADTIRRAHAVHPITAVQLEWSLWTRDI 181

Query: 183 EEDIVPLCRELGIGIVVYSPLGRGFFSGKASTEQLSAADRRQAQHPRFQKENLEKNKVFF 362
EEDI+P+CRELGIGIV YSPLGRGFF+G+A+ E++ ++ ++HPR+ ENLEKNKV +
Sbjct: 182 EEDIIPVCRELGIGIVPYSPLGRGFFAGRAAVERV-PSESLLSKHPRYSGENLEKNKVLY 240

Query: 363 ERLSKLAEKHGCTPGQLALAWLLHQA-DVVPIPGTSKITNLEENLGALNVKLSQEDIKEI 539
RL L++K+GCTP QLAL+W+LHQ DVVPIPGT+K NL+EN+GA+ V+LS+ED++EI
Sbjct: 241 TRLEMLSKKYGCTPAQLALSWVLHQGEDVVPIPGTTKAKNLDENIGAVKVRLSKEDLEEI 300

Query: 540 AAAVPVDEVAGLRYPDKHYRHTYXFANTP 626
+ A P EVAG R ++ ANTP
Sbjct: 301 SGAFPAGEVAGSRLLGVLEPFSWRLANTP 329