DK950574
Clone id TST38A01NGRL0009_A10
Library
Length 576
Definition Adiantum capillus-veneris mRNA. clone: TST38A01NGRL0009_A10. 5' end sequence.
Accession
Tissue type prothallia
Developmental stage gametophyte
Contig ID -
Sequence
AATGATTTTATTTTGATTGATAGTGACCTGGTTGTTGCAACCCATATATGAGCAATGCTC
CCAAATAATGCCAACTTTGTACCCCCTAAAAGGCTACTATCAGAGCTTATCAACCAACCC
CCTTGGAAGCCTTCCGGGTGAGAAACCTCCAGCAGGGTTTATGTGCCCGGAAGGCTGGCA
AGTTAATGTGGACTACTATCAGAGCTTATCAACCAACAATAATGGCAGCCTTACAACTCA
GCAACCAAAGGCAGTCGCTTCGGTCTAGTGTTGGTCCCAGTAATATTGGAGATTCCTTTG
GTGGTCAGCAACTTTGAAAGGACACTGATTTTTGTTGCCTGAGCTCACCATGGTGTAAAT
TGGTTCTTGGGGTCAACTTATGTTGTTGGCCTAGTCATCTGCATGTGTCAATTTTTTTTC
CCCTGCCACTGTTGCGGGGGGGTGGGAACCCATGAAGATTTTTTTGGGGAACTGCAGCAG
ACGGCTTATTTGCCGACATCTTGCCGTGGGCTTGTACAATGTAAATTTTGAAGAGTCCAA
GGTTCTATTTGGCCAAAAAAAAAAAAAAAAAAAAAA
■■Homology search results ■■ -
sp_hit_id O95340
Definition sp|O95340|PAPS2_HUMAN Bifunctional 3'-phosphoadenosine 5'-phosphosulfate synthetase 2 OS=Homo sapiens
Align length 27
Score (bit) 41.2
E-value 0.003
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= DK950574|Adiantum capillus-veneris mRNA, clone:
TST38A01NGRL0009_A10, 5'
(524 letters)

Database: uniprot_sprot.fasta
412,525 sequences; 148,809,765 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

sp|O95340|PAPS2_HUMAN Bifunctional 3'-phosphoadenosine 5'-phosph... 41 0.003
sp|O88428|PAPS2_MOUSE Bifunctional 3'-phosphoadenosine 5'-phosph... 41 0.004
sp|Q60967|PAPS1_MOUSE Bifunctional 3'-phosphoadenosine 5'-phosph... 40 0.009
sp|O43252|PAPS1_HUMAN Bifunctional 3'-phosphoadenosine 5'-phosph... 38 0.026
sp|O54820|PAPS1_CAVPO Bifunctional 3'-phosphoadenosine 5'-phosph... 36 0.097
sp|Q27128|PAPSS_URECA Bifunctional 3'-phosphoadenosine 5'-phosph... 36 0.13
sp|Q96SL8|FIZ1_HUMAN Flt3-interacting zinc finger protein 1 OS=H... 30 5.3
sp|P08037|B4GT1_BOVIN Beta-1,4-galactosyltransferase 1 OS=Bos ta... 30 7.0
sp|O22585|AMYB_MEDSA Beta-amylase OS=Medicago sativa GN=BMY1 PE=... 30 7.0
sp|Q0V9V7|RUN3A_XENTR RUN domain-containing protein 3A OS=Xenopu... 30 9.1

>sp|O95340|PAPS2_HUMAN Bifunctional 3'-phosphoadenosine
5'-phosphosulfate synthetase 2 OS=Homo sapiens GN=PAPSS2
PE=1 SV=2
Length = 614

Score = 41.2 bits (95), Expect = 0.003
Identities = 16/27 (59%), Positives = 19/27 (70%)
Frame = +2

Query: 107 GEKPPAGFMCPEGWQVNVDYYQSLSTN 187
GE PP GFM P+ W+V DYY+SL N
Sbjct: 588 GENPPDGFMAPKAWKVLTDYYRSLEKN 614


>sp|O88428|PAPS2_MOUSE Bifunctional 3'-phosphoadenosine
5'-phosphosulfate synthetase 2 OS=Mus musculus GN=Papss2
PE=1 SV=1
Length = 621

Score = 40.8 bits (94), Expect = 0.004
Identities = 16/28 (57%), Positives = 19/28 (67%)
Frame = +2

Query: 107 GEKPPAGFMCPEGWQVNVDYYQSLSTNN 190
GE PP GFM P+ W+V DYY+SL N
Sbjct: 594 GEDPPDGFMAPKAWKVLTDYYRSLEKTN 621


>sp|Q60967|PAPS1_MOUSE Bifunctional 3'-phosphoadenosine
5'-phosphosulfate synthetase 1 OS=Mus musculus GN=Papss1
PE=2 SV=1
Length = 624

Score = 39.7 bits (91), Expect = 0.009
Identities = 15/24 (62%), Positives = 19/24 (79%)
Frame = +2

Query: 107 GEKPPAGFMCPEGWQVNVDYYQSL 178
G+KPP GFM P+ W V V+YY+SL
Sbjct: 598 GQKPPEGFMAPKAWTVLVEYYKSL 621


>sp|O43252|PAPS1_HUMAN Bifunctional 3'-phosphoadenosine
5'-phosphosulfate synthetase 1 OS=Homo sapiens GN=PAPSS1
PE=1 SV=2
Length = 624

Score = 38.1 bits (87), Expect = 0.026
Identities = 14/24 (58%), Positives = 18/24 (75%)
Frame = +2

Query: 107 GEKPPAGFMCPEGWQVNVDYYQSL 178
G+KPP GFM P+ W V +YY+SL
Sbjct: 598 GQKPPEGFMAPKAWTVLTEYYKSL 621


>sp|O54820|PAPS1_CAVPO Bifunctional 3'-phosphoadenosine
5'-phosphosulfate synthetase 1 OS=Cavia porcellus
GN=PAPSS1 PE=2 SV=1
Length = 624

Score = 36.2 bits (82), Expect = 0.097
Identities = 13/24 (54%), Positives = 17/24 (70%)
Frame = +2

Query: 107 GEKPPAGFMCPEGWQVNVDYYQSL 178
G+KPP GFM P W V +YY++L
Sbjct: 598 GQKPPEGFMAPTAWAVLAEYYKAL 621


>sp|Q27128|PAPSS_URECA Bifunctional 3'-phosphoadenosine
5'-phosphosulfate synthetase OS=Urechis caupo PE=2 SV=1
Length = 610

Score = 35.8 bits (81), Expect = 0.13
Identities = 12/23 (52%), Positives = 17/23 (73%)
Frame = +2

Query: 107 GEKPPAGFMCPEGWQVNVDYYQS 175
GE PP GFM P W++ V+YY++
Sbjct: 583 GETPPNGFMAPSAWKIMVEYYKT 605


>sp|Q96SL8|FIZ1_HUMAN Flt3-interacting zinc finger protein 1 OS=Homo
sapiens GN=FIZ1 PE=1 SV=1
Length = 496

Score = 30.4 bits (67), Expect = 5.3
Identities = 14/37 (37%), Positives = 20/37 (54%)
Frame = -2

Query: 481 AHGKMSANKPSAAVPQKNLHGFPPPRNSGRGKKIDTC 371
+HG+ + +AA ++ PP SGRGKKI C
Sbjct: 380 SHGEGGGEEAAAAAREREPASGEPPSGSGRGKKIFGC 416


>sp|P08037|B4GT1_BOVIN Beta-1,4-galactosyltransferase 1 OS=Bos
taurus GN=B4GALT1 PE=1 SV=3
Length = 402

Score = 30.0 bits (66), Expect = 7.0
Identities = 22/85 (25%), Positives = 38/85 (44%), Gaps = 3/85 (3%)
Frame = -2

Query: 481 AHGKMSANKPSAAVPQKNLHGFPPPRNSGRGKKIDTCR*LGQQHKLT---PRTNLHHGEL 311
+HG + +PS + + + PP +NS + + H P +NL +
Sbjct: 64 SHGAAAIGQPSGELRLRGVAPPPPLQNSSKPRSRAPSNLDAYSHPGPGPGPGSNLTSAPV 123

Query: 310 RQQKSVSFQSC*PPKESPILLGPTL 236
+ S +C P+ESP+L+GP L
Sbjct: 124 PSTTTRSLTAC--PEESPLLVGPML 146


>sp|O22585|AMYB_MEDSA Beta-amylase OS=Medicago sativa GN=BMY1 PE=2
SV=1
Length = 496

Score = 30.0 bits (66), Expect = 7.0
Identities = 15/40 (37%), Positives = 23/40 (57%)
Frame = -2

Query: 514 NLGLFKIYIVQAHGKMSANKPSAAVPQKNLHGFPPPRNSG 395
N +FK ++V KM A++ + P+K HG PP + SG
Sbjct: 431 NFDIFKKFVV----KMHADQDYCSDPEKYNHGIPPLKRSG 466


>sp|Q0V9V7|RUN3A_XENTR RUN domain-containing protein 3A OS=Xenopus
tropicalis GN=rundc3a PE=2 SV=1
Length = 440

Score = 29.6 bits (65), Expect = 9.1
Identities = 21/64 (32%), Positives = 27/64 (42%)
Frame = +2

Query: 2 LLQPIYEQCSQIMPTLYPLKGYYQSLSTNPLGSLPGEKPPAGFMCPEGWQVNVDYYQSLS 181
L Q I EQ Q + + L+G L G LP E P P V+ + SLS
Sbjct: 284 LTQRISEQAEQSLQEKHQLEGVILELQEQLTGLLPSETAPIKQFTPSLGAPLVNQWPSLS 343

Query: 182 TNNN 193
T N+
Sbjct: 344 TLND 347


tr_hit_id Q9ZNZ8
Definition tr|Q9ZNZ8|Q9ZNZ8_BRAJU ATP sulfurylase OS=Brassica juncea
Align length 36
Score (bit) 49.7
E-value 9.0e-05
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= DK950574|Adiantum capillus-veneris mRNA, clone:
TST38A01NGRL0009_A10, 5'
(524 letters)

Database: uniprot_trembl.fasta
7,341,751 sequences; 2,391,615,440 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

tr|Q9ZNZ8|Q9ZNZ8_BRAJU ATP sulfurylase OS=Brassica juncea GN=atp... 50 9e-05
tr|Q96349|Q96349_BRANA ATP sulphurylase OS=Brassica napus GN=LSC... 49 1e-04
tr|B7FHX4|B7FHX4_MEDTR Putative uncharacterized protein OS=Medic... 49 1e-04
tr|Q9SE02|Q9SE02_ARATH ATP sulfurylase OS=Arabidopsis thaliana P... 49 2e-04
tr|Q9LIK9|Q9LIK9_ARATH ATP sulfurylase/APS kinase (ATP sulfuryla... 49 2e-04
tr|Q8LDJ6|Q8LDJ6_ARATH ATP sulfurylase, putative OS=Arabidopsis ... 49 2e-04
tr|Q56Z36|Q56Z36_ARATH ATP sulfurylase like protein OS=Arabidops... 49 2e-04
tr|Q42519|Q42519_ARATH ATP sulfurylase OS=Arabidopsis thaliana P... 49 2e-04
tr|Q42281|Q42281_ARATH ATP sulfurylase (Fragment) OS=Arabidopsis... 49 2e-04
tr|A5AV70|A5AV70_VITVI Putative uncharacterized protein (Chromos... 49 2e-04
tr|Q43183|Q43183_SOLTU Sulfate adenylyltransferase OS=Solanum tu... 49 2e-04
tr|Q8SAG1|Q8SAG1_SOYBN ATP sulfurylase OS=Glycine max PE=2 SV=2 48 3e-04
tr|Q1W2K0|Q1W2K0_CAMSI ATP-sulfurylase OS=Camellia sinensis PE=2... 48 3e-04
tr|A7NSX7|A7NSX7_VITVI Chromosome chr18 scaffold_1, whole genome... 48 3e-04
tr|A5C8G8|A5C8G8_VITVI Putative uncharacterized protein OS=Vitis... 48 3e-04
tr|Q96541|Q96541_BRAOL ATP-sulfurylase OS=Brassica oleracea GN=A... 47 4e-04
tr|Q96530|Q96530_ARATH ATP sulfurylase OS=Arabidopsis thaliana G... 47 6e-04
tr|Q7XQC9|Q7XQC9_ORYSJ OSJNBb0060M15.2 protein OS=Oryza sativa s... 47 6e-04
tr|Q42520|Q42520_ARATH ATP sulfurylase OS=Arabidopsis thaliana P... 47 6e-04
tr|Q0JFE2|Q0JFE2_ORYSJ Os04g0111200 protein (Fragment) OS=Oryza ... 47 6e-04
tr|Q01N37|Q01N37_ORYSA H0215A08.5 protein (OSIGBa0127D24.2 prote... 47 6e-04
tr|O23324|O23324_ARATH ATP-sulfurylase OS=Arabidopsis thaliana G... 47 6e-04
tr|A3AQ83|A3AQ83_ORYSJ Putative uncharacterized protein OS=Oryza... 47 6e-04
tr|A2XPN8|A2XPN8_ORYSI Putative uncharacterized protein OS=Oryza... 47 6e-04
tr|Q9ZNZ9|Q9ZNZ9_BRAJU ATP sulfurylase OS=Brassica juncea GN=atp... 47 8e-04
tr|Q43170|Q43170_SOLTU Sulfate adenylyltransferase OS=Solanum tu... 47 8e-04
tr|Q1HL01|Q1HL01_CAMSI ATP sulfurylase OS=Camellia sinensis GN=A... 47 8e-04
tr|Q9SBL0|Q9SBL0_BRAOB ATP sulfurylase OS=Brassica oleracea var.... 46 0.001
tr|Q9S7D8|Q9S7D8_ARATH Sulfate adenylyltransferase (Putative ATP... 46 0.001
tr|Q0WWX9|Q0WWX9_ARATH ATP sulfurylase OS=Arabidopsis thaliana G... 46 0.001

>tr|Q9ZNZ8|Q9ZNZ8_BRAJU ATP sulfurylase OS=Brassica juncea GN=atps6
PE=2 SV=1
Length = 461

Score = 49.7 bits (117), Expect = 9e-05
Identities = 22/36 (61%), Positives = 23/36 (63%)
Frame = +2

Query: 110 EKPPAGFMCPEGWQVNVDYYQSLSTNNNGSLTTQQP 217
E PP GFMCP GWQV VDYY SL+ NG L P
Sbjct: 425 ENPPDGFMCPGGWQVLVDYYDSLTPAGNGRLPEVVP 460


>tr|Q96349|Q96349_BRANA ATP sulphurylase OS=Brassica napus GN=LSC680
PE=2 SV=1
Length = 459

Score = 49.3 bits (116), Expect = 1e-04
Identities = 21/31 (67%), Positives = 22/31 (70%)
Frame = +2

Query: 110 EKPPAGFMCPEGWQVNVDYYQSLSTNNNGSL 202
E PP GFMCP GWQV VDYY SL+ NG L
Sbjct: 423 ENPPDGFMCPGGWQVLVDYYDSLTPAGNGRL 453


>tr|B7FHX4|B7FHX4_MEDTR Putative uncharacterized protein OS=Medicago
truncatula PE=2 SV=1
Length = 465

Score = 49.3 bits (116), Expect = 1e-04
Identities = 20/36 (55%), Positives = 25/36 (69%)
Frame = +2

Query: 110 EKPPAGFMCPEGWQVNVDYYQSLSTNNNGSLTTQQP 217
E PP GFMCP GW+V VDYY SL+ ++NG + P
Sbjct: 429 ESPPDGFMCPGGWKVLVDYYDSLALSSNGKVPEPVP 464


>tr|Q9SE02|Q9SE02_ARATH ATP sulfurylase OS=Arabidopsis thaliana PE=4
SV=1
Length = 463

Score = 48.9 bits (115), Expect = 2e-04
Identities = 21/36 (58%), Positives = 24/36 (66%)
Frame = +2

Query: 110 EKPPAGFMCPEGWQVNVDYYQSLSTNNNGSLTTQQP 217
E PP GFMCP GW+V VDYY+SL+ NG L P
Sbjct: 427 ENPPDGFMCPGGWKVLVDYYESLTPAGNGRLPEVVP 462


>tr|Q9LIK9|Q9LIK9_ARATH ATP sulfurylase/APS kinase (ATP sulfurylase
like protein) (Putative uncharacterized protein)
(AT3g22890/F5N5_6) OS=Arabidopsis thaliana
GN=At3g22890/F5N5.6 PE=2 SV=1
Length = 463

Score = 48.9 bits (115), Expect = 2e-04
Identities = 21/36 (58%), Positives = 24/36 (66%)
Frame = +2

Query: 110 EKPPAGFMCPEGWQVNVDYYQSLSTNNNGSLTTQQP 217
E PP GFMCP GW+V VDYY+SL+ NG L P
Sbjct: 427 ENPPDGFMCPGGWKVLVDYYESLTPAGNGRLPEVVP 462


>tr|Q8LDJ6|Q8LDJ6_ARATH ATP sulfurylase, putative OS=Arabidopsis
thaliana PE=2 SV=1
Length = 463

Score = 48.9 bits (115), Expect = 2e-04
Identities = 21/36 (58%), Positives = 24/36 (66%)
Frame = +2

Query: 110 EKPPAGFMCPEGWQVNVDYYQSLSTNNNGSLTTQQP 217
E PP GFMCP GW+V VDYY+SL+ NG L P
Sbjct: 427 ENPPDGFMCPGGWKVLVDYYESLTPAGNGRLPEVVP 462


>tr|Q56Z36|Q56Z36_ARATH ATP sulfurylase like protein OS=Arabidopsis
thaliana GN=At3g22890 PE=4 SV=1
Length = 88

Score = 48.9 bits (115), Expect = 2e-04
Identities = 21/36 (58%), Positives = 24/36 (66%)
Frame = +2

Query: 110 EKPPAGFMCPEGWQVNVDYYQSLSTNNNGSLTTQQP 217
E PP GFMCP GW+V VDYY+SL+ NG L P
Sbjct: 52 ENPPDGFMCPGGWKVLVDYYESLTPAGNGRLPEVVP 87


>tr|Q42519|Q42519_ARATH ATP sulfurylase OS=Arabidopsis thaliana PE=2
SV=1
Length = 463

Score = 48.9 bits (115), Expect = 2e-04
Identities = 21/36 (58%), Positives = 24/36 (66%)
Frame = +2

Query: 110 EKPPAGFMCPEGWQVNVDYYQSLSTNNNGSLTTQQP 217
E PP GFMCP GW+V VDYY+SL+ NG L P
Sbjct: 427 ENPPDGFMCPGGWKVLVDYYESLTPAGNGRLPEVVP 462


>tr|Q42281|Q42281_ARATH ATP sulfurylase (Fragment) OS=Arabidopsis
thaliana PE=2 SV=1
Length = 62

Score = 48.9 bits (115), Expect = 2e-04
Identities = 21/35 (60%), Positives = 24/35 (68%)
Frame = +2

Query: 113 KPPAGFMCPEGWQVNVDYYQSLSTNNNGSLTTQQP 217
KPP GFMCP GW+V VDYY+SL+ NG L P
Sbjct: 27 KPPDGFMCPGGWKVLVDYYESLTPAGNGRLPEVVP 61


>tr|A5AV70|A5AV70_VITVI Putative uncharacterized protein (Chromosome
chr5 scaffold_2, whole genome shotgun sequence) OS=Vitis
vinifera GN=GSVIVT00020070001 PE=4 SV=1
Length = 467

Score = 48.9 bits (115), Expect = 2e-04
Identities = 20/36 (55%), Positives = 24/36 (66%)
Frame = +2

Query: 110 EKPPAGFMCPEGWQVNVDYYQSLSTNNNGSLTTQQP 217
E PP GFMCP GW+V V+YY SL +NNG + P
Sbjct: 431 ENPPDGFMCPGGWEVLVEYYDSLVPSNNGKVPETVP 466