DK950606
Clone id TST38A01NGRL0009_C03
Library
Length 667
Definition Adiantum capillus-veneris mRNA. clone: TST38A01NGRL0009_C03. 5' end sequence.
Accession
Tissue type prothallia
Developmental stage gametophyte
Contig ID -
Sequence
GTTACCCACAAACACTCCCTCTCCCTAGCACTCGCGATCGAAGAGTCTCAGATGGCGGGA
GCAGCAGCAGCAGCAGCAACGCCAGCTGCGATTTCATCGACGGCATTGCTTTCCGCCCCC
AACGCGACCTGTTGCTCCTCCTTAGCATTCCGTTCCCAAGCCCAGCAGCTACAGGCCCGC
TCTCTAACCGTCTCCTGCCAGCATCATCTCCATCGTCCTTACCAGCCGACGAACCTCCAA
GCTGTTATCTGTGCGGCCTACACATCTGGTACCAATGAGTTCTCTGCAGATCCTATCGAT
GTTGTTGCTAAGGTGCAAACAGAAAAGATAGTGGTTCTTGGAGGGGGGGGGTTTGTTGGA
TCTGTTTTTTTTTCTCCCCCCCCCCGCCAAGGGATTGACGTTGTCAAAAAAAGAGGGGGG
GGGGAGGGCGTCTTATAATGATGCATGGGTGGACCAAGTTGTATGGATTGCAGGGGATGT
GTTCAATGCGGATTGGGATGGCCTTTTGAATGGTGCTACAGCTGTTGTCTCCACTATTGG
AGGCTTTGGAACGAATGAACAAATGGAGCAGCTGAATGGTGAAGCAAATGTGCTGGCAAT
TAATGCTGCAAGCAATGCAGGTGTCCGAAAGTTTGTTTATATTTCAGTACATGATTACAA
CTTTCCG
■■Homology search results ■■ -
sp_hit_id Q9FVR6
Definition sp|Q9FVR6|Y1222_ARATH Uncharacterized protein At1g32220, chloroplastic OS=Arabidopsis thaliana
Align length 94
Score (bit) 120.0
E-value 7.0e-29
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= DK950606|Adiantum capillus-veneris mRNA, clone:
TST38A01NGRL0009_C03, 5'
(667 letters)

Database: uniprot_sprot.fasta
412,525 sequences; 148,809,765 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

sp|Q9FVR6|Y1222_ARATH Uncharacterized protein At1g32220, chlorop... 120 7e-29
sp|Q05892|YL290_YEAST Uncharacterized protein YLR290C, mitochond... 36 0.21
sp|A3LSB6|FM522_PICST Protein FMP52-2, mitochondrial OS=Pichia s... 34 0.80
sp|Q5RCH4|FAD1_PONAB FAD synthetase OS=Pongo abelii GN=FLAD1 PE=... 31 5.2
sp|Q8NFF5|FAD1_HUMAN FAD synthetase OS=Homo sapiens GN=FLAD1 PE=... 31 5.2
sp|Q948R0|CML5_ORYSJ Calmodulin-like protein 5 OS=Oryza sativa s... 31 5.2
sp|Q9HC84|MUC5B_HUMAN Mucin-5B OS=Homo sapiens GN=MUC5B PE=1 SV=2 30 8.9

>sp|Q9FVR6|Y1222_ARATH Uncharacterized protein At1g32220,
chloroplastic OS=Arabidopsis thaliana GN=At1g32220 PE=1
SV=1
Length = 296

Score = 120 bits (300), Expect(2) = 7e-29
Identities = 54/94 (57%), Positives = 70/94 (74%)
Frame = +2

Query: 386 AKGLTLSKKEGGGRASYNDAWVDQVVWIAGDVFNADWDGLLNGATAVVSTIGGFGTNEQM 565
+ G+ + GR ++ D+W+DQV W+ GDVF +WD +L GATAVVSTIGGFG EQM
Sbjct: 84 SNGIEVVSVSRSGRPNFEDSWLDQVTWVTGDVFYLNWDEVLLGATAVVSTIGGFGNEEQM 143

Query: 566 EQLNGEANVLAINAASNAGVRKFVYISVHDYNFP 667
+++NGEANV A+NAA + GV KFV I+VHDYN P
Sbjct: 144 KRINGEANVTAVNAAKDFGVPKFVLITVHDYNLP 177



Score = 28.1 bits (61), Expect(2) = 7e-29
Identities = 19/66 (28%), Positives = 32/66 (48%), Gaps = 2/66 (3%)
Frame = +1

Query: 214 RPYQPTNLQAVICAAYT-SGTNEFS-ADPIDVVAKVQTEKIVVLXXXXXXXXXXXXXXXR 387
R + P ++ + Y +G + S + PID+VA V++E++VVL
Sbjct: 25 RSFSPRLFKSCVKCTYAEAGLSSASWSAPIDIVADVKSERVVVLGGNGFVGSAICKAAIS 84

Query: 388 QGIDVV 405
GI+VV
Sbjct: 85 NGIEVV 90


>sp|Q05892|YL290_YEAST Uncharacterized protein YLR290C,
mitochondrial OS=Saccharomyces cerevisiae GN=YLR290C
PE=1 SV=1
Length = 277

Score = 35.8 bits (81), Expect = 0.21
Identities = 18/43 (41%), Positives = 25/43 (58%), Gaps = 1/43 (2%)
Frame = +2

Query: 446 WVDQVVWIAGDVFNAD-WDGLLNGATAVVSTIGGFGTNEQMEQ 571
W+ +V W A D+F D + LLN AT VV ++G NE +Q
Sbjct: 49 WMQEVQWTAADIFKPDSYHELLNNATNVVHSLGILLENENYKQ 91


>sp|A3LSB6|FM522_PICST Protein FMP52-2, mitochondrial OS=Pichia
stipitis GN=FMP522 PE=3 SV=2
Length = 229

Score = 33.9 bits (76), Expect = 0.80
Identities = 18/39 (46%), Positives = 23/39 (58%)
Frame = +2

Query: 530 STIGGFGTNEQMEQLNGEANVLAINAASNAGVRKFVYIS 646
STIG G+ E E+++ N A AA AGV+ FV IS
Sbjct: 77 STIGAAGSAENFERIDYGINYAAAKAAKKAGVQTFVLIS 115


>sp|Q5RCH4|FAD1_PONAB FAD synthetase OS=Pongo abelii GN=FLAD1 PE=2
SV=1
Length = 491

Score = 31.2 bits (69), Expect = 5.2
Identities = 13/30 (43%), Positives = 17/30 (56%)
Frame = -2

Query: 627 RTPALLAALIASTFASPFSCSICSFVPKPP 538
R P L A L+ + P+SCS+C F P P
Sbjct: 381 RHPQLEAVLMGTRRTDPYSCSLCPFSPTDP 410


>sp|Q8NFF5|FAD1_HUMAN FAD synthetase OS=Homo sapiens GN=FLAD1 PE=1
SV=1
Length = 587

Score = 31.2 bits (69), Expect = 5.2
Identities = 13/30 (43%), Positives = 17/30 (56%)
Frame = -2

Query: 627 RTPALLAALIASTFASPFSCSICSFVPKPP 538
R P L A L+ + P+SCS+C F P P
Sbjct: 477 RHPQLEAVLMGTRRTDPYSCSLCPFSPTDP 506


>sp|Q948R0|CML5_ORYSJ Calmodulin-like protein 5 OS=Oryza sativa
subsp. japonica GN=CML5 PE=2 SV=1
Length = 166

Score = 31.2 bits (69), Expect = 5.2
Identities = 22/63 (34%), Positives = 37/63 (58%), Gaps = 2/63 (3%)
Frame = +2

Query: 410 KEGGGRASYNDAWVDQVVWIAGDVFNADWDGLLNGATA--VVSTIGGFGTNEQMEQLNGE 583
+ GGG DA D+ + A VF+ D DGL++ A V+ ++G T+E++EQ+ E
Sbjct: 85 ENGGGGDDSGDA-ADEELREAFKVFDKDQDGLISAAELRHVMISLGEKLTDEEVEQMIRE 143

Query: 584 ANV 592
A++
Sbjct: 144 ADL 146


>sp|Q9HC84|MUC5B_HUMAN Mucin-5B OS=Homo sapiens GN=MUC5B PE=1 SV=2
Length = 5703

Score = 30.4 bits (67), Expect = 8.9
Identities = 25/73 (34%), Positives = 34/73 (46%), Gaps = 7/73 (9%)
Frame = -2

Query: 609 AALIASTFASPFSCSICSFVPKPPIVETTAVAPFKRPS----QSALNTS---PAIHTTWS 451
A I +T ++ S P PP++ TTA P S SAL T+ P +TT +
Sbjct: 3364 ATTITATGSTTNPSSTPGTTPIPPVLTTTATTPAATSSTVTPSSALGTTHTPPVPNTTAT 3423

Query: 450 THASL*DALPPPS 412
TH +LPP S
Sbjct: 3424 THGR---SLPPSS 3433


tr_hit_id A9NN07
Definition tr|A9NN07|A9NN07_PICSI Putative uncharacterized protein OS=Picea sitchensis
Align length 94
Score (bit) 140.0
E-value 2.0e-35
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= DK950606|Adiantum capillus-veneris mRNA, clone:
TST38A01NGRL0009_C03, 5'
(667 letters)

Database: uniprot_trembl.fasta
7,341,751 sequences; 2,391,615,440 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

tr|A9NN07|A9NN07_PICSI Putative uncharacterized protein OS=Picea... 140 2e-35
tr|B6TV09|B6TV09_MAIZE 3-beta hydroxysteroid dehydrogenase/isome... 125 3e-31
tr|B4FTR5|B4FTR5_MAIZE Putative uncharacterized protein OS=Zea m... 124 5e-31
tr|B8ATG9|B8ATG9_ORYSI Putative uncharacterized protein OS=Oryza... 124 3e-30
tr|Q7XVF8|Q7XVF8_ORYSJ Os04g0403500 protein OS=Oryza sativa subs... 124 3e-30
tr|A3ATI1|A3ATI1_ORYSJ Putative uncharacterized protein OS=Oryza... 124 4e-27
tr|A9SPR0|A9SPR0_PHYPA Predicted protein OS=Physcomitrella paten... 117 5e-25
tr|A5AIL5|A5AIL5_VITVI Putative uncharacterized protein OS=Vitis... 96 3e-18
tr|A9RYH0|A9RYH0_PHYPA Predicted protein (Fragment) OS=Physcomit... 95 3e-18
tr|A9T8R9|A9T8R9_PHYPA Predicted protein (Fragment) OS=Physcomit... 94 8e-18
tr|Q949S7|Q949S7_ARATH Putative uncharacterized protein At5g1591... 88 4e-16
tr|Q8LD22|Q8LD22_ARATH Putative uncharacterized protein OS=Arabi... 88 4e-16
tr|A7QWT7|A7QWT7_VITVI Chromosome chr4 scaffold_208, whole genom... 86 3e-15
tr|B7FKN9|B7FKN9_MEDTR Putative uncharacterized protein (Fragmen... 85 5e-15
tr|Q6ZI86|Q6ZI86_ORYSJ Os02g0556100 protein OS=Oryza sativa subs... 84 8e-15
tr|B8AE02|B8AE02_ORYSI Putative uncharacterized protein OS=Oryza... 84 8e-15
tr|Q93VH5|Q93VH5_ARATH AT5g10730/MAJ23_90 (Putative uncharacteri... 84 1e-14
tr|Q1KUW8|Q1KUW8_9ROSI Putative uncharacterized protein OS=Cleom... 82 3e-14
tr|B6TVJ7|B6TVJ7_MAIZE NAD dependent epimerase/dehydratase famil... 81 7e-14
tr|B4FMZ0|B4FMZ0_MAIZE Putative uncharacterized protein OS=Zea m... 81 7e-14
tr|B4FHG5|B4FHG5_MAIZE Putative uncharacterized protein OS=Zea m... 81 7e-14
tr|Q9FT59|Q9FT59_ARATH Putative uncharacterized protein AT5g1073... 77 1e-12
tr|A5CBH6|A5CBH6_VITVI Putative uncharacterized protein OS=Vitis... 72 2e-11
tr|A8IXU1|A8IXU1_CHLRE Predicted protein (Fragment) OS=Chlamydom... 64 9e-09
tr|B4FJ83|B4FJ83_MAIZE Putative uncharacterized protein OS=Zea m... 58 6e-07
tr|B8LBW3|B8LBW3_THAPS Putative uncharacterized protein (Fragmen... 57 8e-07
tr|A3A802|A3A802_ORYSJ Putative uncharacterized protein OS=Oryza... 55 5e-06
tr|A7PC40|A7PC40_VITVI Chromosome chr2 scaffold_11, whole genome... 53 2e-05
tr|Q2S1X2|Q2S1X2_SALRD 3-beta hydroxysteroid dehydrogenase/isome... 48 6e-04
tr|A7D5W2|A7D5W2_9EURY NAD-dependent epimerase/dehydratase OS=Ha... 47 0.001

>tr|A9NN07|A9NN07_PICSI Putative uncharacterized protein OS=Picea
sitchensis PE=2 SV=1
Length = 320

Score = 140 bits (354), Expect(2) = 2e-35
Identities = 65/94 (69%), Positives = 77/94 (81%)
Frame = +2

Query: 386 AKGLTLSKKEGGGRASYNDAWVDQVVWIAGDVFNADWDGLLNGATAVVSTIGGFGTNEQM 565
A+G+ GR +Y D+WVDQV W+AGDVF ADWDGLL GATAVVST+GGFGTNEQM
Sbjct: 108 ARGIEAVSLSRLGRPTYIDSWVDQVTWVAGDVFYADWDGLLRGATAVVSTLGGFGTNEQM 167

Query: 566 EQLNGEANVLAINAASNAGVRKFVYISVHDYNFP 667
E++NGEANVLA++AAS AG+ KF+ ISVHDYN P
Sbjct: 168 EKINGEANVLAVDAASKAGIPKFILISVHDYNLP 201



Score = 33.1 bits (74), Expect(2) = 2e-35
Identities = 26/84 (30%), Positives = 37/84 (44%)
Frame = +1

Query: 154 SQAQQLQARSLTVSCQHHLHRPYQPTNLQAVICAAYTSGTNEFSADPIDVVAKVQTEKIV 333
S A L S L R + ++Q +SG ++S+ PIDVVA V+TEKI+
Sbjct: 32 SSANSLLTLGRVASHAKLLARENKRQHIQCNYSTESSSGL-DYSSAPIDVVADVKTEKII 90

Query: 334 VLXXXXXXXXXXXXXXXRQGIDVV 405
VL +GI+ V
Sbjct: 91 VLGGSGFVGSAICKAAVARGIEAV 114


>tr|B6TV09|B6TV09_MAIZE 3-beta hydroxysteroid
dehydrogenase/isomerase family protein OS=Zea mays PE=2
SV=1
Length = 306

Score = 125 bits (314), Expect(2) = 3e-31
Identities = 58/94 (61%), Positives = 72/94 (76%)
Frame = +2

Query: 386 AKGLTLSKKEGGGRASYNDAWVDQVVWIAGDVFNADWDGLLNGATAVVSTIGGFGTNEQM 565
+KG+ + GR SY+D+WVDQV W+ GDVF A WD +L GATAVVST+GGFG EQM
Sbjct: 94 SKGIEVVSFSRSGRPSYSDSWVDQVNWLPGDVFYARWDEVLVGATAVVSTLGGFGNEEQM 153

Query: 566 EQLNGEANVLAINAASNAGVRKFVYISVHDYNFP 667
+++NGEANV+A+NAA GV KF+ ISVHDYN P
Sbjct: 154 KRINGEANVIAVNAAKEYGVPKFILISVHDYNLP 187



Score = 34.3 bits (77), Expect(2) = 3e-31
Identities = 18/43 (41%), Positives = 25/43 (58%)
Frame = +1

Query: 277 EFSADPIDVVAKVQTEKIVVLXXXXXXXXXXXXXXXRQGIDVV 405
++S+ PID+VA V+TEKIVVL +GI+VV
Sbjct: 58 DYSSTPIDIVADVKTEKIVVLGGSGFVGSAICRAAVSKGIEVV 100


>tr|B4FTR5|B4FTR5_MAIZE Putative uncharacterized protein OS=Zea mays
PE=2 SV=1
Length = 306

Score = 124 bits (312), Expect(2) = 5e-31
Identities = 58/94 (61%), Positives = 71/94 (75%)
Frame = +2

Query: 386 AKGLTLSKKEGGGRASYNDAWVDQVVWIAGDVFNADWDGLLNGATAVVSTIGGFGTNEQM 565
+KG+ + GR SY+D WVDQV W+ GDVF A WD +L GATAVVST+GGFG EQM
Sbjct: 94 SKGIEVVSFSRSGRPSYSDPWVDQVNWLPGDVFYARWDEVLVGATAVVSTLGGFGNEEQM 153

Query: 566 EQLNGEANVLAINAASNAGVRKFVYISVHDYNFP 667
+++NGEANV+A+NAA GV KF+ ISVHDYN P
Sbjct: 154 KRINGEANVIAVNAAKENGVPKFILISVHDYNLP 187



Score = 34.3 bits (77), Expect(2) = 5e-31
Identities = 18/43 (41%), Positives = 25/43 (58%)
Frame = +1

Query: 277 EFSADPIDVVAKVQTEKIVVLXXXXXXXXXXXXXXXRQGIDVV 405
++S+ PID+VA V+TEKIVVL +GI+VV
Sbjct: 58 DYSSTPIDIVADVKTEKIVVLGGSGFVGSAICRAAVSKGIEVV 100


>tr|B8ATG9|B8ATG9_ORYSI Putative uncharacterized protein OS=Oryza
sativa subsp. indica GN=OsI_15758 PE=4 SV=1
Length = 326

Score = 124 bits (312), Expect(2) = 3e-30
Identities = 57/94 (60%), Positives = 71/94 (75%)
Frame = +2

Query: 386 AKGLTLSKKEGGGRASYNDAWVDQVVWIAGDVFNADWDGLLNGATAVVSTIGGFGTNEQM 565
+KG+ + GR SY+D WVDQV W+AGDVF A WD +L GATAVVST+GGFG EQM
Sbjct: 100 SKGIEVVSLSRSGRPSYSDPWVDQVTWLAGDVFYARWDEVLVGATAVVSTLGGFGNEEQM 159

Query: 566 EQLNGEANVLAINAASNAGVRKFVYISVHDYNFP 667
+++NGEANV A++AA G+ KF+ ISVHDYN P
Sbjct: 160 KRINGEANVTAVDAAKEFGIPKFILISVHDYNLP 193



Score = 32.0 bits (71), Expect(2) = 3e-30
Identities = 20/47 (42%), Positives = 24/47 (51%)
Frame = +1

Query: 265 SGTNEFSADPIDVVAKVQTEKIVVLXXXXXXXXXXXXXXXRQGIDVV 405
S E + PIDVVA V+TEKIVVL +GI+VV
Sbjct: 60 SDIREDYSTPIDVVADVKTEKIVVLGGSGFVGSAICKAAVSKGIEVV 106


>tr|Q7XVF8|Q7XVF8_ORYSJ Os04g0403500 protein OS=Oryza sativa subsp.
japonica GN=OSJNBb0118P14.7 PE=2 SV=2
Length = 312

Score = 124 bits (312), Expect(2) = 3e-30
Identities = 57/94 (60%), Positives = 71/94 (75%)
Frame = +2

Query: 386 AKGLTLSKKEGGGRASYNDAWVDQVVWIAGDVFNADWDGLLNGATAVVSTIGGFGTNEQM 565
+KG+ + GR SY+D WVDQV W+AGDVF A WD +L GATAVVST+GGFG EQM
Sbjct: 100 SKGIEVVSLSRSGRPSYSDPWVDQVTWLAGDVFYARWDEVLVGATAVVSTLGGFGNEEQM 159

Query: 566 EQLNGEANVLAINAASNAGVRKFVYISVHDYNFP 667
+++NGEANV A++AA G+ KF+ ISVHDYN P
Sbjct: 160 KRINGEANVTAVDAAKEFGIPKFILISVHDYNLP 193



Score = 32.0 bits (71), Expect(2) = 3e-30
Identities = 20/47 (42%), Positives = 24/47 (51%)
Frame = +1

Query: 265 SGTNEFSADPIDVVAKVQTEKIVVLXXXXXXXXXXXXXXXRQGIDVV 405
S E + PIDVVA V+TEKIVVL +GI+VV
Sbjct: 60 SDIREDYSTPIDVVADVKTEKIVVLGGSGFVGSAICKAAVSKGIEVV 106


>tr|A3ATI1|A3ATI1_ORYSJ Putative uncharacterized protein OS=Oryza
sativa subsp. japonica GN=OsJ_014103 PE=4 SV=1
Length = 1274

Score = 124 bits (312), Expect = 4e-27
Identities = 57/94 (60%), Positives = 71/94 (75%)
Frame = +2

Query: 386 AKGLTLSKKEGGGRASYNDAWVDQVVWIAGDVFNADWDGLLNGATAVVSTIGGFGTNEQM 565
+KG+ + GR SY+D WVDQV W+AGDVF A WD +L GATAVVST+GGFG EQM
Sbjct: 1032 SKGIEVVSLSRSGRPSYSDPWVDQVTWLAGDVFYARWDEVLVGATAVVSTLGGFGNEEQM 1091

Query: 566 EQLNGEANVLAINAASNAGVRKFVYISVHDYNFP 667
+++NGEANV A++AA G+ KF+ ISVHDYN P
Sbjct: 1092 KRINGEANVTAVDAAKEFGIPKFILISVHDYNLP 1125


>tr|A9SPR0|A9SPR0_PHYPA Predicted protein OS=Physcomitrella patens
subsp. patens GN=PHYPADRAFT_133255 PE=4 SV=1
Length = 242

Score = 117 bits (294), Expect = 5e-25
Identities = 51/94 (54%), Positives = 70/94 (74%)
Frame = +2

Query: 386 AKGLTLSKKEGGGRASYNDAWVDQVVWIAGDVFNADWDGLLNGATAVVSTIGGFGTNEQM 565
A+G+++ GR + + WVDQV W++GDVF +WD LL+G AV+ST+G G N+QM
Sbjct: 30 AQGISVVSLSRSGRPAILEPWVDQVTWVSGDVFLTEWDSLLDGVQAVISTLGLIGPNDQM 89

Query: 566 EQLNGEANVLAINAASNAGVRKFVYISVHDYNFP 667
E++N +AN++A+NAA AGV KFVYISVHDYN P
Sbjct: 90 EKINADANIIAVNAAKKAGVSKFVYISVHDYNLP 123


>tr|A5AIL5|A5AIL5_VITVI Putative uncharacterized protein OS=Vitis
vinifera GN=VITISV_002160 PE=4 SV=1
Length = 316

Score = 95.5 bits (236), Expect = 3e-18
Identities = 44/65 (67%), Positives = 54/65 (83%)
Frame = +2

Query: 473 GDVFNADWDGLLNGATAVVSTIGGFGTNEQMEQLNGEANVLAINAASNAGVRKFVYISVH 652
GDVF +WD +L GATAVVST+GGFG+ EQM+++NGEANVLA+ AA + GV KF+ ISVH
Sbjct: 133 GDVFYVNWDEVLVGATAVVSTLGGFGSEEQMKRINGEANVLAVGAAKDYGVPKFILISVH 192

Query: 653 DYNFP 667
DYN P
Sbjct: 193 DYNLP 197


>tr|A9RYH0|A9RYH0_PHYPA Predicted protein (Fragment)
OS=Physcomitrella patens subsp. patens
GN=PHYPADRAFT_25906 PE=4 SV=1
Length = 230

Score = 95.1 bits (235), Expect = 3e-18
Identities = 45/96 (46%), Positives = 67/96 (69%), Gaps = 2/96 (2%)
Frame = +2

Query: 386 AKGLTLSKKEGGGRASYNDA-WVDQVVWIAGDVFNAD-WDGLLNGATAVVSTIGGFGTNE 559
A+G+ + GR + +D+ W + VVW+ GD+F+ W+G L+ +V+S +GGFGTNE
Sbjct: 28 ARGVPVVSLNRTGRPNTSDSSWTNNVVWVRGDLFDPSRWEGSLDEVQSVISCVGGFGTNE 87

Query: 560 QMEQLNGEANVLAINAASNAGVRKFVYISVHDYNFP 667
QM ++NGEAN A+ AAS AGV+KFVY+S+ D+ P
Sbjct: 88 QMRRINGEANRSAVWAASKAGVKKFVYVSIADFGLP 123


>tr|A9T8R9|A9T8R9_PHYPA Predicted protein (Fragment)
OS=Physcomitrella patens subsp. patens
GN=PHYPADRAFT_6130 PE=4 SV=1
Length = 236

Score = 94.0 bits (232), Expect = 8e-18
Identities = 41/95 (43%), Positives = 66/95 (69%), Gaps = 1/95 (1%)
Frame = +2

Query: 386 AKGLTLSKKEGGGRASYNDAWVDQVVWIAGDVFN-ADWDGLLNGATAVVSTIGGFGTNEQ 562
+KG++++ GR + W V WI GD+F+ ++W L+ +AV+S +GGFG+N+Q
Sbjct: 34 SKGISVASLSRSGRPGVAEPWSQDVEWIKGDLFHPSNWRNELSDVSAVISCVGGFGSNQQ 93

Query: 563 MEQLNGEANVLAINAASNAGVRKFVYISVHDYNFP 667
M+++NG ANV AI AA++AGV +FV++S HD+ P
Sbjct: 94 MQKINGVANVQAIRAAADAGVERFVFVSAHDFGLP 128