DK950644
Clone id TST38A01NGRL0009_D19
Library
Length 681
Definition Adiantum capillus-veneris mRNA. clone: TST38A01NGRL0009_D19. 5' end sequence.
Accession
Tissue type prothallia
Developmental stage gametophyte
Contig ID
Sequence
GGCAGCGTGAGACGTCTTCTACCCACGTGCACAGTTTCTCTCGTGGCATGACTGGCATCT
CATGCAGTCCTTTAGCGCGTGGGTGAGGGAATGGGAGACACAATAAAACAGCTATGGAGT
GTGGTGCTGGTGCCAAGCTCCCCAGAAACACCCCATCTGTCCTCTCTCTGGTCTTGGCAA
GCATGCTCGCCCTCGCAGGAATTTCAGAACCACATGGAGTTTGCGCCAATCGTCTCGAAA
GAGTCTCTGTGGATCGACAGCTCGGATTGTTTTCCTTCGGTTGGTACAGAAGCTATGGCA
GCAGAAAATTCTATGTATTTGCACACACAGGATGCAACATGTCATCAAAATCATGTGAAT
GTTTTCTCTCCTTACATTGCTCTGTTGCGGACGTGCGCGAAAAACAAAGATCTGCACGTC
GGCAAAAGAGTACATTTGGATATCTTAAAAAGGGGTTTGCTTGAGAAGTGCTCCGATGCT
TTGATCACGATGTACGCAATGTGCGACGCCCTTCCGAAGGCACGAGAGCTGCTTGACATG
CATAGAAGCAAGAACGTATTCACATGGACCTCCCTAATTTCAGGTTATGCACGGAACGGC
CAGAATCTAGATGCCTTATCTTGTTTTGAGCAGATGGAGAGTGAGGGCCTCTTCCCTGAT
GCTGTGACCTACGTTTGCATC
■■Homology search results ■■ -
sp_hit_id Q1PFQ9
Definition sp|Q1PFQ9|PPR62_ARATH Pentatricopeptide repeat-containing protein At1g28690, mitochondrial OS=Arabidopsis thaliana
Align length 123
Score (bit) 80.5
E-value 8.0e-15
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= DK950644|Adiantum capillus-veneris mRNA, clone:
TST38A01NGRL0009_D19, 5'
(681 letters)

Database: uniprot_sprot.fasta
412,525 sequences; 148,809,765 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

sp|Q1PFQ9|PPR62_ARATH Pentatricopeptide repeat-containing protei... 80 8e-15
sp|Q9FJY9|PP448_ARATH Pentatricopeptide repeat-containing protei... 77 1e-13
sp|Q9SUH6|PP341_ARATH Pentatricopeptide repeat-containing protei... 77 1e-13
sp|Q9LFI1|PP280_ARATH Pentatricopeptide repeat-containing protei... 77 1e-13
sp|A8MQA3|PP330_ARATH Pentatricopeptide repeat-containing protei... 76 1e-13
sp|Q9LYU9|PP378_ARATH Pentatricopeptide repeat-containing protei... 76 2e-13
sp|O23491|PP315_ARATH Pentatricopeptide repeat-containing protei... 76 2e-13
sp|P0C899|PP271_ARATH Putative pentatricopeptide repeat-containi... 75 2e-13
sp|Q9SS83|PP220_ARATH Pentatricopeptide repeat-containing protei... 74 6e-13
sp|P93005|PP181_ARATH Pentatricopeptide repeat-containing protei... 74 7e-13
sp|Q9FXB9|PPR84_ARATH Pentatricopeptide repeat-containing protei... 72 2e-12
sp|Q5G1T1|PP272_ARATH Pentatricopeptide repeat-containing protei... 72 2e-12
sp|Q9SY02|PP301_ARATH Pentatricopeptide repeat-containing protei... 72 4e-12
sp|Q9SII7|PP159_ARATH Pentatricopeptide repeat-containing protei... 72 4e-12
sp|Q9STF3|PP265_ARATH Pentatricopeptide repeat-containing protei... 71 5e-12
sp|O64705|PP184_ARATH Pentatricopeptide repeat-containing protei... 70 1e-11
sp|P93011|PP182_ARATH Pentatricopeptide repeat-containing protei... 70 1e-11
sp|Q9ZUT4|PP192_ARATH Pentatricopeptide repeat-containing protei... 70 1e-11
sp|Q3ECB8|PP128_ARATH Pentatricopeptide repeat-containing protei... 70 1e-11
sp|Q9LND4|PPR14_ARATH Pentatricopeptide repeat-containing protei... 69 2e-11
sp|Q9CAY1|PP223_ARATH Putative pentatricopeptide repeat-containi... 69 2e-11
sp|Q9M2Y4|PP276_ARATH Pentatricopeptide repeat-containing protei... 69 3e-11
sp|Q9SIL5|PP165_ARATH Pentatricopeptide repeat-containing protei... 69 3e-11
sp|Q9SI53|PP147_ARATH Pentatricopeptide repeat-containing protei... 69 3e-11
sp|Q9LXY5|PP284_ARATH Pentatricopeptide repeat-containing protei... 68 4e-11
sp|Q9FHF9|PP419_ARATH Pentatricopeptide repeat-containing protei... 68 5e-11
sp|Q9FLZ9|PP405_ARATH Pentatricopeptide repeat-containing protei... 68 5e-11
sp|Q9LUC2|PP231_ARATH Pentatricopeptide repeat-containing protei... 67 7e-11
sp|Q9LIC3|PP227_ARATH Putative pentatricopeptide repeat-containi... 67 7e-11
sp|Q9LW63|PP251_ARATH Putative pentatricopeptide repeat-containi... 67 9e-11

>sp|Q1PFQ9|PPR62_ARATH Pentatricopeptide repeat-containing protein
At1g28690, mitochondrial OS=Arabidopsis thaliana
GN=PCMP-E34 PE=2 SV=2
Length = 520

Score = 80.5 bits (197), Expect = 8e-15
Identities = 43/123 (34%), Positives = 68/123 (55%), Gaps = 2/123 (1%)
Frame = +1

Query: 313 MYLHTQDATCHQNHVNVFSPYIALLRTCAKNKDLHVGKRVHLDILKRGLLE--KCSDALI 486
MY+ Q A H N S + +++ C+ VG++VH I+K G+ K +L+
Sbjct: 260 MYISMQRAGFHPN----ISTFASVIGACSVLTSHEVGQQVHAQIMKSGVYTHIKMGSSLL 315

Query: 487 TMYAMCDALPKARELLDMHRSKNVFTWTSLISGYARNGQNLDALSCFEQMESEGLFPDAV 666
MYA C + AR + D + KNVF+WTS+I GY +NG +AL F +M+ + P+ V
Sbjct: 316 DMYAKCGGINDARRVFDQMQEKNVFSWTSMIDGYGKNGNPEEALELFTRMKEFRIEPNYV 375

Query: 667 TYV 675
T++
Sbjct: 376 TFL 378



Score = 40.4 bits (93), Expect = 0.009
Identities = 24/85 (28%), Positives = 40/85 (47%), Gaps = 2/85 (2%)
Frame = +1

Query: 421 GKRVHLDILKRGLLE--KCSDALITMYAMCDALPKARELLDMHRSKNVFTWTSLISGYAR 594
GK++H DI+K G S L+ ++ C L AR++ D + + +ISGY +
Sbjct: 53 GKKIHADIIKTGFQPDLNISIKLLILHLKCGCLSYARQVFDELPKPTLSAYNYMISGYLK 112

Query: 595 NGQNLDALSCFEQMESEGLFPDAVT 669
+G + L ++M G D T
Sbjct: 113 HGLVKELLLLVQRMSYSGEKADGYT 137


>sp|Q9FJY9|PP448_ARATH Pentatricopeptide repeat-containing protein
At5g66500, mitochondrial OS=Arabidopsis thaliana
GN=PCMP-E38 PE=2 SV=1
Length = 532

Score = 76.6 bits (187), Expect = 1e-13
Identities = 50/162 (30%), Positives = 82/162 (50%), Gaps = 25/162 (15%)
Frame = +1

Query: 271 FPSVG--TEAMAAENSMYLHTQDATCH---------QNHVNVF------SPYIALLRT-- 393
+ SVG EAM NS+ +HT + + +N+ F P + +L +
Sbjct: 229 YSSVGLINEAMKVYNSLNVHTDEVMLNSLISGCIRNRNYKEAFLLMSRQRPNVRVLSSSL 288

Query: 394 --CAKNKDLHVGKRVHLDILKRGLLE--KCSDALITMYAMCDALPKARELLDMHRSKNVF 561
C+ N DL +GK++H L+ G + K + L+ MY C + +AR + SK+V
Sbjct: 289 AGCSDNSDLWIGKQIHCVALRNGFVSDSKLCNGLMDMYGKCGQIVQARTIFRAIPSKSVV 348

Query: 562 TWTSLISGYARNGQNLDALSCFEQM--ESEGLFPDAVTYVCI 681
+WTS+I YA NG + AL F +M E G+ P++VT++ +
Sbjct: 349 SWTSMIDAYAVNGDGVKALEIFREMCEEGSGVLPNSVTFLVV 390



Score = 43.5 bits (101), Expect = 0.001
Identities = 26/93 (27%), Positives = 46/93 (49%), Gaps = 2/93 (2%)
Frame = +1

Query: 373 YIALLRTCAKNKDLHVGKRVHLDILKRGLLEKC--SDALITMYAMCDALPKARELLDMHR 546
+ +L C+ G++VH ++K+G ALI MY+ L + + +
Sbjct: 87 FTPVLGACSLLSYPETGRQVHALMIKQGAETGTISKTALIDMYSKYGHLVDSVRVFESVE 146

Query: 547 SKNVFTWTSLISGYARNGQNLDALSCFEQMESE 645
K++ +W +L+SG+ RNG+ +AL F M E
Sbjct: 147 EKDLVSWNALLSGFLRNGKGKEALGVFAAMYRE 179



Score = 33.5 bits (75), Expect = 1.1
Identities = 26/78 (33%), Positives = 40/78 (51%), Gaps = 5/78 (6%)
Frame = +1

Query: 379 ALLRTCAKNKDLHVGKRVHLDILKRGL-LEKCSDALITMYAMCDALPKARELLDMHRSKN 555
++++TCA K L GK+VH ++ G L A+I+ Y+ + E + ++ S N
Sbjct: 190 SVVKTCASLKILQQGKQVHAMVVVTGRDLVVLGTAMISFYSSVGLI---NEAMKVYNSLN 246

Query: 556 VFT----WTSLISGYARN 597
V T SLISG RN
Sbjct: 247 VHTDEVMLNSLISGCIRN 264


>sp|Q9SUH6|PP341_ARATH Pentatricopeptide repeat-containing protein
At4g30700 OS=Arabidopsis thaliana GN=DYW9 PE=2 SV=1
Length = 792

Score = 76.6 bits (187), Expect = 1e-13
Identities = 45/127 (35%), Positives = 70/127 (55%), Gaps = 3/127 (2%)
Frame = +1

Query: 310 SMYLHTQDATCHQNHVNVFSPYIALLRTCAKNKDLHVGKRVHLDILKRGLLEKC---SDA 480
S++ Q + N V + +L CA+ L +GK VH D+++ E S A
Sbjct: 406 SLFREMQKSEFSPNPVTI----TCILSACAQLGALSLGKWVH-DLVRSTDFESSIYVSTA 460

Query: 481 LITMYAMCDALPKARELLDMHRSKNVFTWTSLISGYARNGQNLDALSCFEQMESEGLFPD 660
LI MYA C ++ +AR L D+ KN TW ++ISGY +GQ +AL+ F +M + G+ P
Sbjct: 461 LIGMYAKCGSIAEARRLFDLMTKKNEVTWNTMISGYGLHGQGQEALNIFYEMLNSGITPT 520

Query: 661 AVTYVCI 681
VT++C+
Sbjct: 521 PVTFLCV 527



Score = 58.5 bits (140), Expect = 3e-08
Identities = 31/86 (36%), Positives = 47/86 (54%), Gaps = 2/86 (2%)
Frame = +1

Query: 430 VHLDILKRGLLEKCS--DALITMYAMCDALPKARELLDMHRSKNVFTWTSLISGYARNGQ 603
+H LK L S AL T+Y+ + + AR+L D K++ +W ++ISGY +NG
Sbjct: 341 IHGYCLKSNFLSHASVSTALTTVYSKLNEIESARKLFDESPEKSLPSWNAMISGYTQNGL 400

Query: 604 NLDALSCFEQMESEGLFPDAVTYVCI 681
DA+S F +M+ P+ VT CI
Sbjct: 401 TEDAISLFREMQKSEFSPNPVTITCI 426



Score = 37.7 bits (86), Expect = 0.057
Identities = 21/91 (23%), Positives = 43/91 (47%), Gaps = 2/91 (2%)
Frame = +1

Query: 382 LLRTCAKNKDLHVGKRVHLDILKRGLL--EKCSDALITMYAMCDALPKARELLDMHRSKN 555
+L A+ ++L +G ++H K G + I++Y+ C + L R +
Sbjct: 227 ILPAVAELQELRLGMQIHSLATKTGCYSHDYVLTGFISLYSKCGKIKMGSALFREFRKPD 286

Query: 556 VFTWTSLISGYARNGQNLDALSCFEQMESEG 648
+ + ++I GY NG+ +LS F+++ G
Sbjct: 287 IVAYNAMIHGYTSNGETELSLSLFKELMLSG 317



Score = 34.7 bits (78), Expect = 0.49
Identities = 21/99 (21%), Positives = 44/99 (44%), Gaps = 6/99 (6%)
Frame = +1

Query: 367 SPYIALLRTCAKNKDLHVGKRVHLDILKRGLLEKCSDAL------ITMYAMCDALPKARE 528
S Y + + +D G+ +H + +++ C L + MY + AR+
Sbjct: 120 STYAFAISAASGFRDDRAGRVIH----GQAVVDGCDSELLLGSNIVKMYFKFWRVEDARK 175

Query: 529 LLDMHRSKNVFTWTSLISGYARNGQNLDALSCFEQMESE 645
+ D K+ W ++ISGY +N ++++ F + +E
Sbjct: 176 VFDRMPEKDTILWNTMISGYRKNEMYVESIQVFRDLINE 214


>sp|Q9LFI1|PP280_ARATH Pentatricopeptide repeat-containing protein
At3g53360, mitochondrial OS=Arabidopsis thaliana
GN=PCMP-E86 PE=2 SV=1
Length = 768

Score = 76.6 bits (187), Expect = 1e-13
Identities = 42/114 (36%), Positives = 69/114 (60%), Gaps = 2/114 (1%)
Frame = +1

Query: 340 CHQNHVNVFSPYIALLRTCAKNKDLHVGKRVHLDILKRGLLEK--CSDALITMYAMCDAL 513
C +H+ + + LLR C + L +G +VH LK GL + + LI MYA C +L
Sbjct: 469 CEPDHITMGN----LLRGCVEISSLKLGSQVHCYSLKTGLAPEQFIKNGLIDMYAKCGSL 524

Query: 514 PKARELLDMHRSKNVFTWTSLISGYARNGQNLDALSCFEQMESEGLFPDAVTYV 675
+AR + D +++V +W++LI GYA++G +AL F++M+S G+ P+ VT+V
Sbjct: 525 GQARRIFDSMDNRDVVSWSTLIVGYAQSGFGEEALILFKEMKSAGIEPNHVTFV 578



Score = 66.6 bits (161), Expect = 1e-10
Identities = 32/102 (31%), Positives = 60/102 (58%), Gaps = 2/102 (1%)
Frame = +1

Query: 373 YIALLRTCAKNKDLHVGKRVHLDILKRGLLEKC--SDALITMYAMCDALPKARELLDMHR 546
YI+L+ C+ ++ L G+++H IL ++ +++MY C +L ARE+ D
Sbjct: 70 YISLICACSSSRSLAQGRKIHDHILNSNCKYDTILNNHILSMYGKCGSLRDAREVFDFMP 129

Query: 547 SKNVFTWTSLISGYARNGQNLDALSCFEQMESEGLFPDAVTY 672
+N+ ++TS+I+GY++NGQ +A+ + +M E L PD +
Sbjct: 130 ERNLVSYTSVITGYSQNGQGAEAIRLYLKMLQEDLVPDQFAF 171



Score = 53.9 bits (128), Expect = 8e-07
Identities = 33/99 (33%), Positives = 48/99 (48%), Gaps = 4/99 (4%)
Frame = +1

Query: 385 LRTCAKNKDLHVGKRVHLDILKRGL----LEKCSDALITMYAMCDALPKARELLDMHRSK 552
L+ C+ G ++H +K L + CS L MYA C L AR + D
Sbjct: 277 LKACSSLLRPDYGSQIHGLCIKSELAGNAIAGCS--LCDMYARCGFLNSARRVFDQIERP 334

Query: 553 NVFTWTSLISGYARNGQNLDALSCFEQMESEGLFPDAVT 669
+ +W +I+G A NG +A+S F QM S G PDA++
Sbjct: 335 DTASWNVIIAGLANNGYADEAVSVFSQMRSSGFIPDAIS 373



Score = 52.8 bits (125), Expect = 2e-06
Identities = 29/97 (29%), Positives = 57/97 (58%), Gaps = 5/97 (5%)
Frame = +1

Query: 379 ALLRTCAKNKDLHVGKRVHLDILKRGLLEKCS-----DALITMYAMCDALPKARELLDMH 543
++++ CA + D+ +GK++H ++K LE S +ALI MY + + A +
Sbjct: 173 SIIKACASSSDVGLGKQLHAQVIK---LESSSHLIAQNALIAMYVRFNQMSDASRVFYGI 229

Query: 544 RSKNVFTWTSLISGYARNGQNLDALSCFEQMESEGLF 654
K++ +W+S+I+G+++ G +ALS ++M S G+F
Sbjct: 230 PMKDLISWSSIIAGFSQLGFEFEALSHLKEMLSFGVF 266


>sp|A8MQA3|PP330_ARATH Pentatricopeptide repeat-containing protein
At4g21065 OS=Arabidopsis thaliana GN=PCMP-H28 PE=2 SV=2
Length = 595

Score = 76.3 bits (186), Expect = 1e-13
Identities = 45/105 (42%), Positives = 63/105 (60%), Gaps = 3/105 (2%)
Frame = +1

Query: 376 IALLRTCAKNKDLHVGKRVHLDILKRGLLEKC--SDALITMYAMCDALPKARELLDMHRS 549
++LL CAK L +GKRVH+ ++K GL S+ L+ +YA C + +A+ L D
Sbjct: 226 VSLLSACAKIGALTLGKRVHVYMIKVGLTRNLHSSNVLLDLYARCGRVEEAKTLFDEMVD 285

Query: 550 KNVFTWTSLISGYARNGQNLDALSCFEQMES-EGLFPDAVTYVCI 681
KN +WTSLI G A NG +A+ F+ MES EGL P +T+V I
Sbjct: 286 KNSVSWTSLIVGLAVNGFGKEAIELFKYMESTEGLLPCEITFVGI 330



Score = 61.6 bits (148), Expect = 4e-09
Identities = 30/105 (28%), Positives = 59/105 (56%), Gaps = 2/105 (1%)
Frame = +1

Query: 373 YIALLRTCAKNKDLHVGKRVHLDILKRGL--LEKCSDALITMYAMCDALPKARELLDMHR 546
Y L++ D+ +G+ +H +++ G L ++L+ +YA C + A ++ D
Sbjct: 124 YPFLIKAVTTMADVRLGETIHSVVIRSGFGSLIYVQNSLLHLYANCGDVASAYKVFDKMP 183

Query: 547 SKNVFTWTSLISGYARNGQNLDALSCFEQMESEGLFPDAVTYVCI 681
K++ W S+I+G+A NG+ +AL+ + +M S+G+ PD T V +
Sbjct: 184 EKDLVAWNSVINGFAENGKPEEALALYTEMNSKGIKPDGFTIVSL 228



Score = 39.7 bits (91), Expect = 0.015
Identities = 19/41 (46%), Positives = 24/41 (58%), Gaps = 1/41 (2%)
Frame = +1

Query: 553 NVFTWTSLISGYARNGQNLDALSCFEQMESEGLF-PDAVTY 672
NVF W +LI GYA G ++ A S + +M GL PD TY
Sbjct: 84 NVFIWNTLIRGYAEIGNSISAFSLYREMRVSGLVEPDTHTY 124


>sp|Q9LYU9|PP378_ARATH Pentatricopeptide repeat-containing protein
At5g13270, chloroplastic OS=Arabidopsis thaliana
GN=PCMP-H90 PE=2 SV=1
Length = 752

Score = 75.9 bits (185), Expect = 2e-13
Identities = 37/105 (35%), Positives = 63/105 (60%), Gaps = 2/105 (1%)
Frame = +1

Query: 373 YIALLRTCAKNKDLHVGKRVHLDILKRGLL--EKCSDALITMYAMCDALPKARELLDMHR 546
Y ++ + C+ D ++G +VH D +KR L+ + ALITMY+ C L A E+ +
Sbjct: 390 YTSIFQACSVLADCNIGGQVHADAIKRSLIGSQYGESALITMYSKCGCLDDANEVFESMD 449

Query: 547 SKNVFTWTSLISGYARNGQNLDALSCFEQMESEGLFPDAVTYVCI 681
+ ++ WT+ ISG+A G +AL FE+M S G+ P++VT++ +
Sbjct: 450 NPDIVAWTAFISGHAYYGNASEALRLFEKMVSCGMKPNSVTFIAV 494



Score = 52.4 bits (124), Expect = 2e-06
Identities = 29/104 (27%), Positives = 50/104 (48%), Gaps = 2/104 (1%)
Frame = +1

Query: 367 SPYIALLRTCAKNKDLHVGKRVHLDILKRGLLEKCS--DALITMYAMCDALPKARELLDM 540
S Y LL++ + L G+++H +++ GL S ++ MY C L A+ + D
Sbjct: 185 SMYTTLLKSLVNPRALDFGRQIHAHVIRAGLCSNTSIETGIVNMYVKCGWLVGAKRVFDQ 244

Query: 541 HRSKNVFTWTSLISGYARNGQNLDALSCFEQMESEGLFPDAVTY 672
K T L+ GY + G+ DAL F + +EG+ D+ +
Sbjct: 245 MAVKKPVACTGLMVGYTQAGRARDALKLFVDLVTEGVEWDSFVF 288



Score = 52.0 bits (123), Expect = 3e-06
Identities = 26/93 (27%), Positives = 49/93 (52%), Gaps = 2/93 (2%)
Frame = +1

Query: 373 YIALLRTCAKNKDLHVGKRVHLDILKRGLLEKCS--DALITMYAMCDALPKARELLDMHR 546
+ +L+ CA ++L++GK++H + K GL + S L+ Y C + A R
Sbjct: 288 FSVVLKACASLEELNLGKQIHACVAKLGLESEVSVGTPLVDFYIKCSSFESACRAFQEIR 347

Query: 547 SKNVFTWTSLISGYARNGQNLDALSCFEQMESE 645
N +W+++ISGY + Q +A+ F+ + S+
Sbjct: 348 EPNDVSWSAIISGYCQMSQFEEAVKTFKSLRSK 380


>sp|O23491|PP315_ARATH Pentatricopeptide repeat-containing protein
At4g16470 OS=Arabidopsis thaliana GN=PCMP-E12 PE=2 SV=2
Length = 501

Score = 75.9 bits (185), Expect = 2e-13
Identities = 37/105 (35%), Positives = 58/105 (55%), Gaps = 2/105 (1%)
Frame = +1

Query: 373 YIALLRTCAKNKDLHVGKRVHLDILKRGLLEKC--SDALITMYAMCDALPKARELLDMHR 546
+ ++ R C+ L GKR H ++KR + AL+ MY C + + D
Sbjct: 212 FASVFRACSALDRLEHGKRAHAVMIKRCIKSNIIVDSALVDMYFKCSSFSDGHRVFDQLS 271

Query: 547 SKNVFTWTSLISGYARNGQNLDALSCFEQMESEGLFPDAVTYVCI 681
++NV TWTSLISGY +G+ + L CFE+M+ EG P+ VT++ +
Sbjct: 272 TRNVITWTSLISGYGYHGKVSEVLKCFEKMKEEGCRPNPVTFLVV 316



Score = 52.4 bits (124), Expect = 2e-06
Identities = 29/105 (27%), Positives = 49/105 (46%), Gaps = 2/105 (1%)
Frame = +1

Query: 373 YIALLRTCAKNKDLHVGKRVHLDILKRG--LLEKCSDALITMYAMCDALPKARELLDMHR 546
Y LL+ C + K+ GKR+H + G L E L+ +YA+ L A L +
Sbjct: 111 YAVLLQECKQRKEYTKGKRIHAQMFVVGFALNEYLKVKLLILYALSGDLQTAGILFRSLK 170

Query: 547 SKNVFTWTSLISGYARNGQNLDALSCFEQMESEGLFPDAVTYVCI 681
+++ W ++ISGY + G + L + M + PD T+ +
Sbjct: 171 IRDLIPWNAMISGYVQKGLEQEGLFIYYDMRQNRIVPDQYTFASV 215


>sp|P0C899|PP271_ARATH Putative pentatricopeptide repeat-containing
protein At3g49140 OS=Arabidopsis thaliana GN=PCMP-H77
PE=3 SV=1
Length = 686

Score = 75.5 bits (184), Expect = 2e-13
Identities = 35/101 (34%), Positives = 63/101 (62%), Gaps = 2/101 (1%)
Frame = +1

Query: 379 ALLRTCAKNKDLHVGKRVHLDILKRGLLEKC--SDALITMYAMCDALPKARELLDMHRSK 552
++L C L +GK++H I ++ L+ +ALI MYA C L KAR++ + +S+
Sbjct: 314 SVLPACGDTSALSLGKKIHGYIERKKLIPNLLLENALIDMYAKCGCLEKARDVFENMKSR 373

Query: 553 NVFTWTSLISGYARNGQNLDALSCFEQMESEGLFPDAVTYV 675
+V +WT++IS Y +G+ DA++ F +++ GL PD++ +V
Sbjct: 374 DVVSWTAMISAYGFSGRGCDAVALFSKLQDSGLVPDSIAFV 414



Score = 58.9 bits (141), Expect = 2e-08
Identities = 33/98 (33%), Positives = 55/98 (56%), Gaps = 2/98 (2%)
Frame = +1

Query: 382 LLRTCAKNKDLHVGKRVHLDILKRGLLEKC--SDALITMYAMCDALPKARELLDMHRSKN 555
+L+ C+ + + +G+++H K GL + L++MY C L +AR +LD ++
Sbjct: 146 VLKACSCSGTIVIGRKIHGSATKVGLSSTLFVGNGLVSMYGKCGFLSEARLVLDEMSRRD 205

Query: 556 VFTWTSLISGYARNGQNLDALSCFEQMESEGLFPDAVT 669
V +W SL+ GYA+N + DAL +MES + DA T
Sbjct: 206 VVSWNSLVVGYAQNQRFDDALEVCREMESVKISHDAGT 243



Score = 35.8 bits (81), Expect = 0.22
Identities = 13/44 (29%), Positives = 27/44 (61%)
Frame = +1

Query: 550 KNVFTWTSLISGYARNGQNLDALSCFEQMESEGLFPDAVTYVCI 681
K++ +W +I Y +N ++A+ + +ME++G PDAV+ +
Sbjct: 272 KSLVSWNVMIGVYMKNAMPVEAVELYSRMEADGFEPDAVSITSV 315



Score = 32.7 bits (73), Expect = 1.8
Identities = 24/95 (25%), Positives = 41/95 (43%), Gaps = 4/95 (4%)
Frame = +1

Query: 409 DLHVGKRVHLDILKRGLLEKCSDAL----ITMYAMCDALPKARELLDMHRSKNVFTWTSL 576
D+ + VH I+ L +C+ +L + YA + AR++ D +NV +
Sbjct: 54 DIRTLRTVHSRIILEDL--RCNSSLGVKLMRAYASLKDVASARKVFDEIPERNVIIINVM 111

Query: 577 ISGYARNGQNLDALSCFEQMESEGLFPDAVTYVCI 681
I Y NG + + F M + PD T+ C+
Sbjct: 112 IRSYVNNGFYGEGVKVFGTMCGCNVRPDHYTFPCV 146


>sp|Q9SS83|PP220_ARATH Pentatricopeptide repeat-containing protein
At3g09040, mitochondrial OS=Arabidopsis thaliana
GN=PCMP-E88 PE=2 SV=1
Length = 1028

Score = 74.3 bits (181), Expect = 6e-13
Identities = 36/102 (35%), Positives = 56/102 (54%), Gaps = 2/102 (1%)
Frame = +1

Query: 382 LLRTCAKNKDLHVGKRVHLDILKRGLLEK--CSDALITMYAMCDALPKARELLDMHRSKN 555
+L TCA+ ++ G+++H ++K GL C AL+ MYA CD + AR + + N
Sbjct: 166 VLSTCARETNVEFGRQIHCSMIKMGLERNSYCGGALVDMYAKCDRISDARRVFEWIVDPN 225

Query: 556 VFTWTSLISGYARNGQNLDALSCFEQMESEGLFPDAVTYVCI 681
WT L SGY + G +A+ FE+M EG PD + +V +
Sbjct: 226 TVCWTCLFSGYVKAGLPEEAVLVFERMRDEGHRPDHLAFVTV 267



Score = 72.8 bits (177), Expect = 2e-12
Identities = 39/104 (37%), Positives = 58/104 (55%), Gaps = 3/104 (2%)
Frame = +1

Query: 373 YIALLRTCAKNKDLHVGKRVHLDI--LKRGLLEKCSDALITMYAMCDALPKARELLD-MH 543
++ +LR C+ L G+ +H I L L E S+ LI MYA C + + ++ D M
Sbjct: 735 FVTVLRVCSVLSSLREGRAIHSLIFHLAHDLDELTSNTLIDMYAKCGDMKGSSQVFDEMR 794

Query: 544 RSKNVFTWTSLISGYARNGQNLDALSCFEQMESEGLFPDAVTYV 675
R NV +W SLI+GYA+NG DAL F+ M + PD +T++
Sbjct: 795 RRSNVVSWNSLINGYAKNGYAEDALKIFDSMRQSHIMPDEITFL 838



Score = 61.6 bits (148), Expect = 4e-09
Identities = 31/98 (31%), Positives = 54/98 (55%), Gaps = 2/98 (2%)
Frame = +1

Query: 373 YIALLRTCAKNKDLHVGKRVHLDILKRGLLEKC--SDALITMYAMCDALPKARELLDMHR 546
+ +LL TCA + DL +G + H I+K+ L + +AL+ MYA C AL AR++ +
Sbjct: 431 FTSLLSTCAASHDLEMGSQFHSIIIKKKLAKNLFVGNALVDMYAKCGALEDARQIFERMC 490

Query: 547 SKNVFTWTSLISGYARNGQNLDALSCFEQMESEGLFPD 660
++ TW ++I Y ++ +A F++M G+ D
Sbjct: 491 DRDNVTWNTIIGSYVQDENESEAFDLFKRMNLCGIVSD 528



Score = 55.8 bits (133), Expect = 2e-07
Identities = 30/107 (28%), Positives = 57/107 (53%), Gaps = 4/107 (3%)
Frame = +1

Query: 373 YIALLRTCAKNKDLHVGKRVHLDILKRGLL---EKCSDALITMYAMCDALPKARELL-DM 540
+ ++ C K + L +G + H I KRG E +L+ MY + +A L ++
Sbjct: 632 FATIVEACHKPESLTLGTQFHGQITKRGFSSEGEYLGISLLGMYMNSRGMTEACALFSEL 691

Query: 541 HRSKNVFTWTSLISGYARNGQNLDALSCFEQMESEGLFPDAVTYVCI 681
K++ WT ++SG+++NG +AL +++M +G+ PD T+V +
Sbjct: 692 SSPKSIVLWTGMMSGHSQNGFYEEALKFYKEMRHDGVLPDQATFVTV 738



Score = 53.9 bits (128), Expect = 8e-07
Identities = 27/93 (29%), Positives = 48/93 (51%), Gaps = 2/93 (2%)
Frame = +1

Query: 409 DLHVGKRVHLDILKRGLLEKC--SDALITMYAMCDALPKARELLDMHRSKNVFTWTSLIS 582
+L +G VH + +K GL +L++MY+ C+ + A ++ + KN W ++I
Sbjct: 342 NLDLGLVVHAEAIKLGLASNIYVGSSLVSMYSKCEKMEAAAKVFEALEEKNDVFWNAMIR 401

Query: 583 GYARNGQNLDALSCFEQMESEGLFPDAVTYVCI 681
GYA NG++ + F M+S G D T+ +
Sbjct: 402 GYAHNGESHKVMELFMDMKSSGYNIDDFTFTSL 434



Score = 48.9 bits (115), Expect = 2e-05
Identities = 30/101 (29%), Positives = 53/101 (52%), Gaps = 2/101 (1%)
Frame = +1

Query: 385 LRTCAKNKDLHVGKRVHLDILKRGLLEKC--SDALITMYAMCDALPKARELLDMHRSKNV 558
L+ C L+ GK+VH +K GL +LI MY+ C + AR++ +V
Sbjct: 536 LKACTHVHGLYQGKQVHCLSVKCGLDRDLHTGSSLIDMYSKCGIIKDARKVFSSLPEWSV 595

Query: 559 FTWTSLISGYARNGQNLDALSCFEQMESEGLFPDAVTYVCI 681
+ +LI+GY++N +A+ F++M + G+ P +T+ I
Sbjct: 596 VSMNALIAGYSQNNLE-EAVVLFQEMLTRGVNPSEITFATI 635



Score = 40.0 bits (92), Expect = 0.012
Identities = 25/89 (28%), Positives = 43/89 (48%), Gaps = 2/89 (2%)
Frame = +1

Query: 412 LHVGKRVHLDILKRGLLE--KCSDALITMYAMCDALPKARELLDMHRSKNVFTWTSLISG 585
L +GK VH L G+ + +A++ +YA C + A + D K+V W S++S
Sbjct: 76 LRIGKAVHSKSLILGIDSEGRLGNAIVDLYAKCAQVSYAEKQFDF-LEKDVTAWNSMLSM 134

Query: 586 YARNGQNLDALSCFEQMESEGLFPDAVTY 672
Y+ G+ L F + +FP+ T+
Sbjct: 135 YSSIGKPGKVLRSFVSLFENQIFPNKFTF 163


>sp|P93005|PP181_ARATH Pentatricopeptide repeat-containing protein
At2g33680 OS=Arabidopsis thaliana GN=PCMP-E19 PE=2 SV=1
Length = 727

Score = 73.9 bits (180), Expect = 7e-13
Identities = 35/103 (33%), Positives = 66/103 (64%), Gaps = 2/103 (1%)
Frame = +1

Query: 373 YIALLRTCAKNKDLHVGKRVHLDILKRGLLE--KCSDALITMYAMCDALPKARELLDMHR 546
+ A+L + A + +G+++H +K GLL S+AL+TMY+ C++L +A ++ D
Sbjct: 224 FTAVLSSLAATIYVGLGRQIHCITIKNGLLGFVALSNALVTMYSKCESLNEACKMFDSSG 283

Query: 547 SKNVFTWTSLISGYARNGQNLDALSCFEQMESEGLFPDAVTYV 675
+N TW+++++GY++NG++L+A+ F +M S G+ P T V
Sbjct: 284 DRNSITWSAMVTGYSQNGESLEAVKLFSRMFSAGIKPSEYTIV 326



Score = 71.2 bits (173), Expect = 5e-12
Identities = 39/103 (37%), Positives = 60/103 (58%), Gaps = 2/103 (1%)
Frame = +1

Query: 379 ALLRTCAKNKDLHVGKRVHLDILKRG--LLEKCSDALITMYAMCDALPKARELLDMHRSK 552
++L+ C+ L +GK+VH +K G L AL TMY+ C +L + +K
Sbjct: 428 SVLKACSSLATLELGKQVHGHTIKHGFGLEVPIGSALSTMYSKCGSLEDGNLVFRRTPNK 487

Query: 553 NVFTWTSLISGYARNGQNLDALSCFEQMESEGLFPDAVTYVCI 681
+V +W ++ISG + NGQ +AL FE+M +EG+ PD VT+V I
Sbjct: 488 DVVSWNAMISGLSHNGQGDEALELFEEMLAEGMEPDDVTFVNI 530



Score = 63.5 bits (153), Expect = 1e-09
Identities = 35/104 (33%), Positives = 56/104 (53%), Gaps = 2/104 (1%)
Frame = +1

Query: 376 IALLRTCAKNKDLHVGKRVHLDILKRGLLEK--CSDALITMYAMCDALPKARELLDMHRS 549
+ +L C+ L GK++H +LK G + AL+ MYA L AR+ D +
Sbjct: 326 VGVLNACSDICYLEEGKQLHSFLLKLGFERHLFATTALVDMYAKAGCLADARKGFDCLQE 385

Query: 550 KNVFTWTSLISGYARNGQNLDALSCFEQMESEGLFPDAVTYVCI 681
++V WTSLISGY +N N +AL + +M++ G+ P+ T +
Sbjct: 386 RDVALWTSLISGYVQNSDNEEALILYRRMKTAGIIPNDPTMASV 429



Score = 53.9 bits (128), Expect = 8e-07
Identities = 28/96 (29%), Positives = 53/96 (55%), Gaps = 5/96 (5%)
Frame = +1

Query: 397 AKNKDLHVGKRVHLDILKRGLLE--KCSDALITMYAMCDALPKARELLDMHRSKNVFTWT 570
++ ++L G+ VH I++ G + ++ L+ YA C L KA + + K+V +W
Sbjct: 25 SQQRNLVAGRAVHGQIIRTGASTCIQHANVLVNFYAKCGKLAKAHSIFNAIICKDVVSWN 84

Query: 571 SLISGYARNG---QNLDALSCFEQMESEGLFPDAVT 669
SLI+GY++NG + + F +M ++ + P+A T
Sbjct: 85 SLITGYSQNGGISSSYTVMQLFREMRAQDILPNAYT 120



Score = 35.0 bits (79), Expect = 0.37
Identities = 17/72 (23%), Positives = 35/72 (48%), Gaps = 2/72 (2%)
Frame = +1

Query: 418 VGKRVHLDILKRGLLEKC--SDALITMYAMCDALPKARELLDMHRSKNVFTWTSLISGYA 591
VG++ H ++K +L+ MY + ++ +N +TW++++SGYA
Sbjct: 136 VGRQAHALVVKMSSFGDIYVDTSLVGMYCKAGLVEDGLKVFAYMPERNTYTWSTMVSGYA 195

Query: 592 RNGQNLDALSCF 627
G+ +A+ F
Sbjct: 196 TRGRVEEAIKVF 207


tr_hit_id B4FW77
Definition tr|B4FW77|B4FW77_MAIZE Putative uncharacterized protein OS=Zea mays
Align length 108
Score (bit) 83.6
E-value 1.0e-14
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= DK950644|Adiantum capillus-veneris mRNA, clone:
TST38A01NGRL0009_D19, 5'
(681 letters)

Database: uniprot_trembl.fasta
7,341,751 sequences; 2,391,615,440 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

tr|B4FW77|B4FW77_MAIZE Putative uncharacterized protein OS=Zea m... 84 1e-14
tr|A9T938|A9T938_PHYPA Predicted protein OS=Physcomitrella paten... 83 2e-14
tr|A9RJW2|A9RJW2_PHYPA Predicted protein OS=Physcomitrella paten... 81 7e-14
tr|Q5W963|Q5W963_PHYPA PPR1106-17 OS=Physcomitrella patens PE=2 ... 80 1e-13
tr|B8LQA8|B8LQA8_PICSI Putative uncharacterized protein OS=Picea... 80 1e-13
tr|A9RSU9|A9RSU9_PHYPA Predicted protein OS=Physcomitrella paten... 80 1e-13
tr|A2WLV2|A2WLV2_ORYSI Putative uncharacterized protein OS=Oryza... 80 1e-13
tr|A7PEA5|A7PEA5_VITVI Chromosome chr11 scaffold_13, whole genom... 80 2e-13
tr|A5C1E4|A5C1E4_VITVI Putative uncharacterized protein (Fragmen... 80 2e-13
tr|A9T5P5|A9T5P5_PHYPA Predicted protein OS=Physcomitrella paten... 79 3e-13
tr|Q5QNL7|Q5QNL7_ORYSJ Pentatricopeptide repeat protein-like OS=... 78 5e-13
tr|Q0JPS7|Q0JPS7_ORYSJ Os01g0205200 protein (Fragment) OS=Oryza ... 78 5e-13
tr|A7QT63|A7QT63_VITVI Chromosome chr1 scaffold_166, whole genom... 78 5e-13
tr|A5B9U0|A5B9U0_VITVI Putative uncharacterized protein OS=Vitis... 78 5e-13
tr|A2ZQG6|A2ZQG6_ORYSJ Putative uncharacterized protein OS=Oryza... 78 5e-13
tr|Q7F2F8|Q7F2F8_ORYSJ P0402A09.8 protein (P0455C04.2 protein) O... 78 6e-13
tr|Q655L5|Q655L5_ORYSJ Putative uncharacterized protein P0672D08... 78 6e-13
tr|B8ACR8|B8ACR8_ORYSI Putative uncharacterized protein OS=Oryza... 78 6e-13
tr|A9RLJ0|A9RLJ0_PHYPA Predicted protein OS=Physcomitrella paten... 78 6e-13
tr|A7PXY9|A7PXY9_VITVI Chromosome chr15 scaffold_37, whole genom... 78 6e-13
tr|A7PSU3|A7PSU3_VITVI Chromosome chr8 scaffold_29, whole genome... 78 6e-13
tr|A5BWE3|A5BWE3_VITVI Putative uncharacterized protein OS=Vitis... 78 6e-13
tr|A2ZN87|A2ZN87_ORYSJ Putative uncharacterized protein OS=Oryza... 78 6e-13
tr|Q0JJU9|Q0JJU9_ORYSJ Os01g0715700 protein OS=Oryza sativa subs... 77 8e-13
tr|B8A8P4|B8A8P4_ORYSI Putative uncharacterized protein OS=Oryza... 77 8e-13
tr|A9T8E9|A9T8E9_PHYPA Predicted protein OS=Physcomitrella paten... 77 8e-13
tr|A5AEL2|A5AEL2_VITVI Putative uncharacterized protein OS=Vitis... 77 8e-13
tr|A2ZX81|A2ZX81_ORYSJ Putative uncharacterized protein OS=Oryza... 77 8e-13
tr|Q5W965|Q5W965_PHYPA PPR868-14 OS=Physcomitrella patens PE=2 SV=1 77 1e-12
tr|Q10PA0|Q10PA0_ORYSJ Pentatricopeptide, putative, expressed OS... 77 1e-12

>tr|B4FW77|B4FW77_MAIZE Putative uncharacterized protein OS=Zea mays
PE=2 SV=1
Length = 700

Score = 83.6 bits (205), Expect = 1e-14
Identities = 41/108 (37%), Positives = 68/108 (62%), Gaps = 2/108 (1%)
Frame = +1

Query: 364 FSPYIALLRTCAKNKDLHVGKRVHLDILKRGLLEK--CSDALITMYAMCDALPKARELLD 537
+S Y + LR CA LHVG+++H +++ G + +ALI+ YA C + +A+++ D
Sbjct: 456 WSTYASCLRACANLAVLHVGRQLHNLLVRSGHINDSFAGNALISTYAKCGRILEAKQIFD 515

Query: 538 MHRSKNVFTWTSLISGYARNGQNLDALSCFEQMESEGLFPDAVTYVCI 681
K++ +W +LI GYA NGQ +A++ F +ME+ G+ PD VT+V I
Sbjct: 516 EMVYKDIVSWNALIDGYASNGQGTEAIAVFREMEANGVRPDEVTFVGI 563



Score = 41.6 bits (96), Expect = 0.048
Identities = 18/56 (32%), Positives = 33/56 (58%)
Frame = +1

Query: 469 CSDALITMYAMCDALPKARELLDMHRSKNVFTWTSLISGYARNGQNLDALSCFEQM 636
C + +I+ Y C L +A L +K++ +W ++I+GYA++GQ A+ F +M
Sbjct: 361 CWNTMISGYVQCGILEEAMLLFQRMPNKDMVSWNTMIAGYAQDGQMHKAIGIFRRM 416



Score = 35.4 bits (80), Expect = 3.4
Identities = 22/65 (33%), Positives = 37/65 (56%), Gaps = 1/65 (1%)
Frame = +1

Query: 481 LITMYAMCDALPKARELLD-MHRSKNVFTWTSLISGYARNGQNLDALSCFEQMESEGLFP 657
+++ YA L AR++LD M K + ++ISGYA+NG+ DA+ +M + P
Sbjct: 117 MVSCYARGGDLELARDVLDRMPGDKCTACYNAMISGYAKNGRFDDAMKLLREMPA----P 172

Query: 658 DAVTY 672
D V++
Sbjct: 173 DLVSW 177


>tr|A9T938|A9T938_PHYPA Predicted protein OS=Physcomitrella patens
subsp. patens GN=PHYPADRAFT_192787 PE=4 SV=1
Length = 804

Score = 82.8 bits (203), Expect = 2e-14
Identities = 43/105 (40%), Positives = 65/105 (61%), Gaps = 2/105 (1%)
Frame = +1

Query: 373 YIALLRTCAKNKDLHVGKRVHLDILKRGLLEKC--SDALITMYAMCDALPKARELLDMHR 546
Y+ LL++C K KDL VGK+VH IL+ G+ ++ L+ +YA C ++ +AR+L D
Sbjct: 31 YVKLLQSCVKAKDLAVGKQVHEHILRCGVKPNVYITNTLLKLYAHCGSVNEARQLFDKFS 90

Query: 547 SKNVFTWTSLISGYARNGQNLDALSCFEQMESEGLFPDAVTYVCI 681
+K+V +W +ISGYA G +A + F M+ E L PD T+V I
Sbjct: 91 NKSVVSWNVMISGYAHRGLAQEAFNLFTLMQQERLEPDKFTFVSI 135



Score = 75.9 bits (185), Expect = 2e-12
Identities = 37/103 (35%), Positives = 64/103 (62%), Gaps = 2/103 (1%)
Frame = +1

Query: 373 YIALLRTCAKNKDLHVGKRVHLDILKRGLLEKCS--DALITMYAMCDALPKARELLDMHR 546
Y+ +L+ C+ L GK +H +++K GLL + +AL++MY C ++ A + +
Sbjct: 435 YMCVLKACSNPVALKWGKEIHAEVVKAGLLADLAVTNALMSMYFKCGSVEDAIRVFEGMS 494

Query: 547 SKNVFTWTSLISGYARNGQNLDALSCFEQMESEGLFPDAVTYV 675
++V TW +LI G +NG+ L+AL +E M+SEG+ P+A T+V
Sbjct: 495 MRDVVTWNTLIGGLGQNGRGLEALQRYEVMKSEGMRPNAATFV 537



Score = 66.6 bits (161), Expect = 1e-09
Identities = 33/105 (31%), Positives = 60/105 (57%), Gaps = 2/105 (1%)
Frame = +1

Query: 373 YIALLRTCAKNKDLHVGKRVHLDILKRGLLE--KCSDALITMYAMCDALPKARELLDMHR 546
Y +L CA+ L GK +H K GL+ + +ALI MY+ ++ AR++ D
Sbjct: 334 YTTVLSACARPGGLARGKEIHARAAKDGLVSDVRFGNALINMYSKAGSMKDARQVFDRMP 393

Query: 547 SKNVFTWTSLISGYARNGQNLDALSCFEQMESEGLFPDAVTYVCI 681
++V +WT+L+ YA Q +++ + F+QM +G+ + +TY+C+
Sbjct: 394 KRDVVSWTTLLGRYADCDQVVESFTTFKQMLQQGVKANKITYMCV 438



Score = 64.7 bits (156), Expect = 5e-09
Identities = 30/103 (29%), Positives = 59/103 (57%), Gaps = 2/103 (1%)
Frame = +1

Query: 373 YIALLRTCAKNKDLHVGKRVHLDILKRGLLEKCS--DALITMYAMCDALPKARELLDMHR 546
++++L C+ L+ G+ +H+ +++ GL + +ALI+MYA C ++ AR + D
Sbjct: 132 FVSILSACSSPAVLNWGREIHVRVMEAGLANDTTVGNALISMYAKCGSVRDARRVFDAMA 191

Query: 547 SKNVFTWTSLISGYARNGQNLDALSCFEQMESEGLFPDAVTYV 675
S++ +WT+L YA +G ++L + M E + P +TY+
Sbjct: 192 SRDEVSWTTLTGAYAESGYGEESLKTYHAMLQERVRPSRITYM 234



Score = 60.8 bits (146), Expect = 8e-08
Identities = 33/105 (31%), Positives = 52/105 (49%), Gaps = 2/105 (1%)
Frame = +1

Query: 373 YIALLRTCAKNKDLHVGKRVHLDILKRGLLE--KCSDALITMYAMCDALPKARELLDMHR 546
Y+ +L C L GK++H I++ + S AL MY C A ARE+ +
Sbjct: 233 YMNVLSACGSLAALEKGKQIHAHIVESEYHSDVRVSTALTKMYMKCGAFKDAREVFECLS 292

Query: 547 SKNVFTWTSLISGYARNGQNLDALSCFEQMESEGLFPDAVTYVCI 681
++V W ++I G+ +GQ +A F +M EG+ PD TY +
Sbjct: 293 YRDVIAWNTMIRGFVDSGQLEEAHGTFHRMLEEGVAPDRATYTTV 337


>tr|A9RJW2|A9RJW2_PHYPA Predicted protein OS=Physcomitrella patens
subsp. patens GN=PHYPADRAFT_175641 PE=4 SV=1
Length = 723

Score = 80.9 bits (198), Expect = 7e-14
Identities = 38/102 (37%), Positives = 60/102 (58%), Gaps = 2/102 (1%)
Frame = +1

Query: 382 LLRTCAKNKDLHVGKRVHLDILKRGLLEK--CSDALITMYAMCDALPKARELLDMHRSKN 555
LL+ CA+ + L G+ VH ILK G+ + L++MYA C +L AR + D R +N
Sbjct: 53 LLQECARLRSLEQGREVHAAILKSGIQPNRYLENTLLSMYAKCGSLTDARRVFDSIRDRN 112

Query: 556 VFTWTSLISGYARNGQNLDALSCFEQMESEGLFPDAVTYVCI 681
+ +WT++I + +NL+A C+E M+ G PD VT+V +
Sbjct: 113 IVSWTAMIEAFVAGNKNLEAFKCYETMKLAGCKPDKVTFVSL 154



Score = 72.4 bits (176), Expect = 3e-11
Identities = 40/105 (38%), Positives = 63/105 (60%), Gaps = 2/105 (1%)
Frame = +1

Query: 373 YIALLRTCAKNKDLHVGKRVHLDILKRGL-LE-KCSDALITMYAMCDALPKARELLDMHR 546
+++LL + L +G++VH++I++ GL LE + +L+ MYA C + KAR + D
Sbjct: 151 FVSLLNAFTNPELLQLGQKVHMEIVEAGLELEPRVGTSLVGMYAKCGDISKARVIFDRLP 210

Query: 547 SKNVFTWTSLISGYARNGQNLDALSCFEQMESEGLFPDAVTYVCI 681
KNV TWT LI+GYA+ GQ AL E M+ + P+ +T+ I
Sbjct: 211 EKNVVTWTLLIAGYAQQGQVDVALELLETMQQAEVAPNKITFASI 255



Score = 69.3 bits (168), Expect = 2e-10
Identities = 34/105 (32%), Positives = 64/105 (60%), Gaps = 2/105 (1%)
Frame = +1

Query: 373 YIALLRTCAKNKDLHVGKRVHLDILKRGLLEKC--SDALITMYAMCDALPKARELLDMHR 546
+ ++L+ C L GK+VH I++ G + ++LITMY C L +AR+L
Sbjct: 252 FASILQGCTTPAALEHGKKVHRYIIQSGYGRELWVVNSLITMYCKCGGLEEARKLFSDLP 311

Query: 547 SKNVFTWTSLISGYARNGQNLDALSCFEQMESEGLFPDAVTYVCI 681
++V TWT++++GYA+ G + +A++ F +M+ +G+ PD +T+ +
Sbjct: 312 HRDVVTWTAMVTGYAQLGFHDEAINLFRRMQQQGIKPDKMTFTSV 356



Score = 65.5 bits (158), Expect = 3e-09
Identities = 34/106 (32%), Positives = 62/106 (58%), Gaps = 3/106 (2%)
Frame = +1

Query: 373 YIALLRTCAKNKDLHVGKRVHLDILKRG--LLEKCSDALITMYAMCDALPKARELLDMHR 546
+ ++L +C+ L GKR+H ++ G L AL++MYA C ++ A + +
Sbjct: 353 FTSVLTSCSSPAFLQEGKRIHQQLVHAGYNLDVYLQSALVSMYAKCGSMDDASLVFNQMS 412

Query: 547 SKNVFTWTSLISG-YARNGQNLDALSCFEQMESEGLFPDAVTYVCI 681
+NV WT++I+G A++G+ +AL F+QM+ +G+ PD VT+ +
Sbjct: 413 ERNVVAWTAIITGCCAQHGRCREALEYFDQMKKQGIKPDKVTFTSV 458


>tr|Q5W963|Q5W963_PHYPA PPR1106-17 OS=Physcomitrella patens PE=2 SV=2
Length = 1106

Score = 80.1 bits (196), Expect = 1e-13
Identities = 46/110 (41%), Positives = 65/110 (59%), Gaps = 2/110 (1%)
Frame = +1

Query: 358 NVFSPYIALLRTCAKNKDLHVGKRVHLDILKRGLLE--KCSDALITMYAMCDALPKAREL 531
N FS +++LL C+ L GKRVH +I+KR L + ALI+MYA C + +A+E+
Sbjct: 733 NKFS-FVSLLNACSSFSALEEGKRVHAEIVKRKLQGDVRVGAALISMYAKCGSQGEAQEV 791

Query: 532 LDMHRSKNVFTWTSLISGYARNGQNLDALSCFEQMESEGLFPDAVTYVCI 681
D KNV TW ++I+ YA++G AL F ME EG+ PD T+ I
Sbjct: 792 FDNIIEKNVVTWNAMINAYAQHGLASKALGFFNCMEKEGIKPDGSTFTSI 841



Score = 79.0 bits (193), Expect = 3e-13
Identities = 39/103 (37%), Positives = 64/103 (62%), Gaps = 2/103 (1%)
Frame = +1

Query: 373 YIALLRTCAKNKDLHVGKRVHLDILKRGLLE--KCSDALITMYAMCDALPKARELLDMHR 546
Y+++L C+ +K L GK +H I + G + +ALI+MYA C LPKAREL
Sbjct: 333 YLSILNACSTSKALEAGKLIHSHISEDGHSSDVQIGNALISMYARCGDLPKARELFYTMP 392

Query: 547 SKNVFTWTSLISGYARNGQNLDALSCFEQMESEGLFPDAVTYV 675
+++ +W ++I+GYAR +A+ ++QM+SEG+ P VT++
Sbjct: 393 KRDLISWNAIIAGYARREDRGEAMRLYKQMQSEGVKPGRVTFL 435



Score = 70.9 bits (172), Expect = 7e-11
Identities = 41/144 (28%), Positives = 73/144 (50%), Gaps = 2/144 (1%)
Frame = +1

Query: 250 WIDSSDCFPSVGTEAMAAENSMYLHTQDATCHQNHVNVFSPYIALLRTCAKNKDLHVGKR 429
W C+ G + A + ++ Q+A N + YI++L C +L GK+
Sbjct: 96 WNSLISCYAQQGFKKKAFQ--LFEEMQNAGFIPNKIT----YISILTACYSPAELENGKK 149

Query: 430 VHLDILKRGLLE--KCSDALITMYAMCDALPKARELLDMHRSKNVFTWTSLISGYARNGQ 603
+H I+K G + ++L++MY C LP+AR++ ++V ++ +++ YA+
Sbjct: 150 IHSQIIKAGYQRDPRVQNSLLSMYGKCGDLPRARQVFAGISPRDVVSYNTMLGLYAQKAY 209

Query: 604 NLDALSCFEQMESEGLFPDAVTYV 675
+ L F QM SEG+ PD VTY+
Sbjct: 210 VKECLGLFGQMSSEGISPDKVTYI 233



Score = 70.5 bits (171), Expect = 1e-10
Identities = 33/105 (31%), Positives = 64/105 (60%), Gaps = 2/105 (1%)
Frame = +1

Query: 373 YIALLRTCAKNKDLHVGKRVHLDILKRGLLEK--CSDALITMYAMCDALPKARELLDMHR 546
++ LL CA + GK +H DIL+ G+ ++AL+ MY C +L +A+ + + +
Sbjct: 434 FLHLLSACANSSAYADGKMIHEDILRSGIKSNGHLANALMNMYRRCGSLMEAQNVFEGTQ 493

Query: 547 SKNVFTWTSLISGYARNGQNLDALSCFEQMESEGLFPDAVTYVCI 681
+++V +W S+I+G+A++G A F++M++E L PD +T+ +
Sbjct: 494 ARDVISWNSMIAGHAQHGSYETAYKLFQEMQNEELEPDNITFASV 538



Score = 66.6 bits (161), Expect = 1e-09
Identities = 34/105 (32%), Positives = 58/105 (55%), Gaps = 2/105 (1%)
Frame = +1

Query: 373 YIALLRTCAKNKDLHVGKRVHLDILKRGLLEKC--SDALITMYAMCDALPKARELLDMHR 546
Y+ALL+ C + + L KR+H +++ + S+ LI MY C ++ A ++
Sbjct: 30 YVALLQNCTRKRLLPEAKRIHAQMVEAWVGPDIFLSNLLINMYVKCRSVLDAHQVFKEMP 89

Query: 547 SKNVFTWTSLISGYARNGQNLDALSCFEQMESEGLFPDAVTYVCI 681
++V +W SLIS YA+ G A FE+M++ G P+ +TY+ I
Sbjct: 90 RRDVISWNSLISCYAQQGFKKKAFQLFEEMQNAGFIPNKITYISI 134



Score = 63.2 bits (152), Expect = 2e-08
Identities = 34/105 (32%), Positives = 58/105 (55%), Gaps = 2/105 (1%)
Frame = +1

Query: 373 YIALLRTCAKNKDLHVGKRVHLDILKRGLL--EKCSDALITMYAMCDALPKARELLDMHR 546
+ ++L C + L +GK++H I + GL +ALI MY C +L AR + +
Sbjct: 535 FASVLSGCKNPEALELGKQIHGRITESGLQLDVNLGNALINMYIRCGSLQDARNVFHSLQ 594

Query: 547 SKNVFTWTSLISGYARNGQNLDALSCFEQMESEGLFPDAVTYVCI 681
++V +WT++I G A G+++ A+ F QM++EG P T+ I
Sbjct: 595 HRDVMSWTAMIGGCADQGEDMKAIELFWQMQNEGFRPVKSTFSSI 639



Score = 59.3 bits (142), Expect = 2e-07
Identities = 33/109 (30%), Positives = 60/109 (55%), Gaps = 2/109 (1%)
Frame = +1

Query: 361 VFSPYIALLRTCAKNKDLHVGKRVHLDILKRG--LLEKCSDALITMYAMCDALPKARELL 534
V S + ++L+ C + L GK+V IL G L +ALI+ Y+ ++ ARE+
Sbjct: 632 VKSTFSSILKVCTSSACLDEGKKVIAYILNSGYELDTGVGNALISAYSKSGSMTDAREVF 691

Query: 535 DMHRSKNVFTWTSLISGYARNGQNLDALSCFEQMESEGLFPDAVTYVCI 681
D S+++ +W +I+GYA+NG A+ QM+ + + P+ ++V +
Sbjct: 692 DKMPSRDIVSWNKIIAGYAQNGLGQTAVEFAYQMQEQDVVPNKFSFVSL 740



Score = 50.1 bits (118), Expect = 1e-04
Identities = 30/105 (28%), Positives = 53/105 (50%), Gaps = 2/105 (1%)
Frame = +1

Query: 373 YIALLRTCAKNKDLHVGKRVHLDILKRGLLE--KCSDALITMYAMCDALPKARELLDMHR 546
YI LL L GKR+H ++ GL + AL+TM C + A++
Sbjct: 232 YINLLDAFTTPSMLDEGKRIHKLTVEEGLNSDIRVGTALVTMCVRCGDVDSAKQAFKGTA 291

Query: 547 SKNVFTWTSLISGYARNGQNLDALSCFEQMESEGLFPDAVTYVCI 681
++V + +LI+ A++G N++A + +M S+G+ + TY+ I
Sbjct: 292 DRDVVVYNALIAALAQHGHNVEAFEQYYRMRSDGVALNRTTYLSI 336


>tr|B8LQA8|B8LQA8_PICSI Putative uncharacterized protein OS=Picea
sitchensis PE=2 SV=1
Length = 795

Score = 80.1 bits (196), Expect = 1e-13
Identities = 35/105 (33%), Positives = 64/105 (60%), Gaps = 2/105 (1%)
Frame = +1

Query: 373 YIALLRTCAKNKDLHVGKRVHLDILKRGLLEKC--SDALITMYAMCDALPKARELLDMHR 546
++++++ C DL G++VH DI+ RG AL +MY C +L AR++ D
Sbjct: 123 FLSVIKACGSQSDLQAGRKVHEDIIARGFESDVIVGTALASMYTKCGSLENARQVFDRMP 182

Query: 547 SKNVFTWTSLISGYARNGQNLDALSCFEQMESEGLFPDAVTYVCI 681
++V +W ++I+GY++NGQ +AL+ F +M+ G+ P++ T V +
Sbjct: 183 KRDVVSWNAIIAGYSQNGQPYEALALFSEMQVNGIKPNSSTLVSV 227



Score = 63.5 bits (153), Expect = 1e-08
Identities = 32/104 (30%), Positives = 59/104 (56%), Gaps = 2/104 (1%)
Frame = +1

Query: 376 IALLRTCAKNKDLHVGKRVHLDILKRGLLEK--CSDALITMYAMCDALPKARELLDMHRS 549
+++L CA L G+++H ++ G +AL+ MYA C + A +L +
Sbjct: 326 VSVLPACAHLFALEQGQQIHGYAIRSGFESNDVVGNALVNMYAKCGNVNSAYKLFERMPK 385

Query: 550 KNVFTWTSLISGYARNGQNLDALSCFEQMESEGLFPDAVTYVCI 681
KNV W ++ISGY+++G +AL+ F +M+++G+ PD+ V +
Sbjct: 386 KNVVAWNAIISGYSQHGHPHEALALFIEMQAQGIKPDSFAIVSV 429



Score = 61.2 bits (147), Expect = 6e-08
Identities = 30/107 (28%), Positives = 60/107 (56%), Gaps = 2/107 (1%)
Frame = +1

Query: 367 SPYIALLRTCAKNKDLHVGKRVHLDILKRGLLEKCS--DALITMYAMCDALPKARELLDM 540
S ++++ CA L GK++H ++ G+ + L+ MYA C + A +L +
Sbjct: 222 STLVSVMPVCAHLLALEQGKQIHCYAIRSGIESDVLVVNGLVNMYAKCGNVNTAHKLFER 281

Query: 541 HRSKNVFTWTSLISGYARNGQNLDALSCFEQMESEGLFPDAVTYVCI 681
++V +W ++I GY+ N Q+ +AL+ F +M+ G+ P+++T V +
Sbjct: 282 MPIRDVASWNAIIGGYSLNSQHHEALAFFNRMQVRGIKPNSITMVSV 328



Score = 52.0 bits (123), Expect = 4e-05
Identities = 28/104 (26%), Positives = 52/104 (50%), Gaps = 2/104 (1%)
Frame = +1

Query: 376 IALLRTCAKNKDLHVGKRVHLDILKRGLLEKC--SDALITMYAMCDALPKARELLDMHRS 549
+++L CA L GK++H ++ G L+ +YA C + A++L +
Sbjct: 427 VSVLPACAHFLALEQGKQIHGYTIRSGFESNVVVGTGLVDIYAKCGNVNTAQKLFERMPE 486

Query: 550 KNVFTWTSLISGYARNGQNLDALSCFEQMESEGLFPDAVTYVCI 681
++V +WT++I Y +G DAL+ F +M+ G D + + I
Sbjct: 487 QDVVSWTTMILAYGIHGHGEDALALFSKMQETGTKLDHIAFTAI 530


>tr|A9RSU9|A9RSU9_PHYPA Predicted protein OS=Physcomitrella patens
subsp. patens GN=PHYPADRAFT_177829 PE=4 SV=1
Length = 527

Score = 80.1 bits (196), Expect = 1e-13
Identities = 42/105 (40%), Positives = 63/105 (60%), Gaps = 2/105 (1%)
Frame = +1

Query: 373 YIALLRTCAKNKDLHVGKRVHLDILKRGLLEK--CSDALITMYAMCDALPKARELLDMHR 546
Y+ +L+ C K+KDL K+VH ILK G+ + ++ L+ +Y C + AR + D
Sbjct: 2 YVDVLQRCFKHKDLTSVKQVHDCILKSGMDQNPYVANKLMRVYIRCGKVQDARHVFDKLV 61

Query: 547 SKNVFTWTSLISGYARNGQNLDALSCFEQMESEGLFPDAVTYVCI 681
KNVF WT++I GYA +G+ DA+ + QM EG P+ VTY+ I
Sbjct: 62 KKNVFNWTTMIGGYAEHGRPADAIEVYNQMRQEGGRPNEVTYLSI 106



Score = 71.2 bits (173), Expect = 6e-11
Identities = 55/199 (27%), Positives = 90/199 (45%), Gaps = 5/199 (2%)
Frame = +1

Query: 100 TIKQLWSVVLVPSSPETPHLSS--LWSWQACSPSQEFQNHMEFAPIVSKESL-WIDSSDC 270
++KQ+ +L + P++++ + + C Q+ ++ F +V K W
Sbjct: 17 SVKQVHDCILKSGMDQNPYVANKLMRVYIRCGKVQDARH--VFDKLVKKNVFNWTTMIGG 74

Query: 271 FPSVGTEAMAAENSMYLHTQDATCHQNHVNVFSPYIALLRTCAKNKDLHVGKRVHLDILK 450
+ G A A E +Y + N V Y+++L+ CA L GK +H I
Sbjct: 75 YAEHGRPADAIE--VYNQMRQEGGRPNEVT----YLSILKACACPVGLKWGKEIHAHISH 128

Query: 451 RGLLEKC--SDALITMYAMCDALPKARELLDMHRSKNVFTWTSLISGYARNGQNLDALSC 624
G AL+ MYA ++ AR + D +NV TW +I G A++G +A S
Sbjct: 129 GGFRSDVPVQTALVNMYAKSGSIKDARLVFDEMAERNVITWNVMIGGLAQHGFGQEAFSL 188

Query: 625 FEQMESEGLFPDAVTYVCI 681
F QM+ EG PD+ TY+ I
Sbjct: 189 FLQMQEEGFVPDSTTYLSI 207



Score = 69.3 bits (168), Expect = 2e-10
Identities = 39/105 (37%), Positives = 59/105 (56%), Gaps = 2/105 (1%)
Frame = +1

Query: 373 YIALLRTCAKNKDLHVGKRVHLDILKRGLLE--KCSDALITMYAMCDALPKARELLDMHR 546
Y+++L A L K+VH K GL + +AL+ MYA ++ AR + D
Sbjct: 307 YVSILTASASAGALEWVKQVHNHARKAGLGSDFRVCNALVHMYAKSGSIDDARLVFDQMS 366

Query: 547 SKNVFTWTSLISGYARNGQNLDALSCFEQMESEGLFPDAVTYVCI 681
+NVFTW ++I G A++G +A S F +M EG+ PDA+TY+ I
Sbjct: 367 VRNVFTWNAMIGGLAQHGCGQEAFSLFLRMRREGVVPDAITYMSI 411



Score = 62.4 bits (150), Expect = 3e-08
Identities = 37/105 (35%), Positives = 55/105 (52%), Gaps = 2/105 (1%)
Frame = +1

Query: 373 YIALLRTCAKNKDLHVGKRVHLDILKRGLLE--KCSDALITMYAMCDALPKARELLDMHR 546
Y+++L A L K VH ++ GL + +AL+ MY ++ AR + D
Sbjct: 408 YMSILNASASTGALGWVKEVHRQAVQAGLDSDVRVGNALVHMYCKTGSISDARLMFDGMV 467

Query: 547 SKNVFTWTSLISGYARNGQNLDALSCFEQMESEGLFPDAVTYVCI 681
++V TWT++ISG A+N +A S F QM+ EG P A TY I
Sbjct: 468 ERDVITWTAMISGLAQNECGQEAFSLFLQMQREGFIPVATTYASI 512



Score = 54.7 bits (130), Expect = 5e-06
Identities = 36/128 (28%), Positives = 68/128 (53%), Gaps = 4/128 (3%)
Frame = +1

Query: 310 SMYLHTQDATCHQNHVNVFSPYIALLRTCAKNKDLHVG--KRVHLDILKRGLLE--KCSD 477
S++L Q+ + V + Y+++L A + +G K VH +K G + +
Sbjct: 187 SLFLQMQE----EGFVPDSTTYLSILTATACSSAGALGWVKEVHRHAVKAGFDSDMRVCN 242

Query: 478 ALITMYAMCDALPKARELLDMHRSKNVFTWTSLISGYARNGQNLDALSCFEQMESEGLFP 657
AL+ +Y+ ++ AR + + ++V +W+++I G A+NG +A S F +M+ EG+ P
Sbjct: 243 ALVHVYSKSGSVDDARLVFEGMLDRDVISWSAMIGGLAQNGCGHEAFSLFLKMQREGVIP 302

Query: 658 DAVTYVCI 681
+ TYV I
Sbjct: 303 NVTTYVSI 310


>tr|A2WLV2|A2WLV2_ORYSI Putative uncharacterized protein OS=Oryza
sativa subsp. indica GN=OsI_00820 PE=4 SV=1
Length = 370

Score = 80.1 bits (196), Expect = 1e-13
Identities = 41/102 (40%), Positives = 62/102 (60%), Gaps = 2/102 (1%)
Frame = +1

Query: 382 LLRTCAKNKDLHVGKRVHLDILKRGLLEK--CSDALITMYAMCDALPKARELLDMHRSKN 555
+L T A L G+ +H ++RG LE ++AL+ MY C AL AR L DM +KN
Sbjct: 4 ILPTAASLSSLERGREMHAYAVRRGYLEDNFVANALVDMYVKCGALLLARRLFDMLTNKN 63

Query: 556 VFTWTSLISGYARNGQNLDALSCFEQMESEGLFPDAVTYVCI 681
+ +WT +I+GY +G+ DA++ FEQM+ G+ PDA ++ I
Sbjct: 64 LISWTIMIAGYGMHGRGRDAIALFEQMKGSGIQPDAGSFSAI 105


>tr|A7PEA5|A7PEA5_VITVI Chromosome chr11 scaffold_13, whole genome
shotgun sequence OS=Vitis vinifera GN=GSVIVT00016590001
PE=4 SV=1
Length = 462

Score = 79.7 bits (195), Expect = 2e-13
Identities = 42/109 (38%), Positives = 62/109 (56%), Gaps = 3/109 (2%)
Frame = +1

Query: 364 FSPYIALLRTCAKNKDLHVGKRVHLDILKRGLLE---KCSDALITMYAMCDALPKARELL 534
+ + A+L +C K K L VG+RVH D+L R + ++ LI MY C ++ AR +
Sbjct: 127 YGVFCAMLSSCGKTKSLEVGRRVH-DLLARSKFGGDVELNNKLIEMYGRCGSMRDARRVF 185

Query: 535 DMHRSKNVFTWTSLISGYARNGQNLDALSCFEQMESEGLFPDAVTYVCI 681
D R +N+ +W +I+GYA NGQ D L FE+M GL P T+V +
Sbjct: 186 DRMRERNMSSWHLMINGYAANGQGRDGLLLFERMRKVGLRPVGETFVAV 234


>tr|A5C1E4|A5C1E4_VITVI Putative uncharacterized protein (Fragment)
OS=Vitis vinifera GN=VITISV_013147 PE=4 SV=1
Length = 497

Score = 79.7 bits (195), Expect = 2e-13
Identities = 42/109 (38%), Positives = 62/109 (56%), Gaps = 3/109 (2%)
Frame = +1

Query: 364 FSPYIALLRTCAKNKDLHVGKRVHLDILKRGLLE---KCSDALITMYAMCDALPKARELL 534
+ + A+L +C K K L VG+RVH D+L R + ++ LI MY C ++ AR +
Sbjct: 133 YGVFCAMLSSCGKTKSLEVGRRVH-DLLARSKFGGDVELNNKLIEMYGRCGSMRDARRVF 191

Query: 535 DMHRSKNVFTWTSLISGYARNGQNLDALSCFEQMESEGLFPDAVTYVCI 681
D R +N+ +W +I+GYA NGQ D L FE+M GL P T+V +
Sbjct: 192 DRMRERNMSSWHLMINGYAANGQGRDGLLLFERMRKVGLRPVGETFVAV 240


>tr|A9T5P5|A9T5P5_PHYPA Predicted protein OS=Physcomitrella patens
subsp. patens GN=PHYPADRAFT_191892 PE=4 SV=1
Length = 905

Score = 79.0 bits (193), Expect = 3e-13
Identities = 39/103 (37%), Positives = 64/103 (62%), Gaps = 2/103 (1%)
Frame = +1

Query: 373 YIALLRTCAKNKDLHVGKRVHLDILKRGLLE--KCSDALITMYAMCDALPKARELLDMHR 546
Y+++L C+ +K L GK +H I + G + +ALI+MYA C LPKAREL
Sbjct: 333 YLSILNACSTSKALEAGKLIHSHISEDGHSSDVQIGNALISMYARCGDLPKARELFYTMP 392

Query: 547 SKNVFTWTSLISGYARNGQNLDALSCFEQMESEGLFPDAVTYV 675
+++ +W ++I+GYAR +A+ ++QM+SEG+ P VT++
Sbjct: 393 KRDLISWNAIIAGYARREDRGEAMRLYKQMQSEGVKPGRVTFL 435



Score = 70.9 bits (172), Expect = 7e-11
Identities = 41/144 (28%), Positives = 73/144 (50%), Gaps = 2/144 (1%)
Frame = +1

Query: 250 WIDSSDCFPSVGTEAMAAENSMYLHTQDATCHQNHVNVFSPYIALLRTCAKNKDLHVGKR 429
W C+ G + A + ++ Q+A N + YI++L C +L GK+
Sbjct: 96 WNSLISCYAQQGFKKKAFQ--LFEEMQNAGFIPNKIT----YISILTACYSPAELENGKK 149

Query: 430 VHLDILKRGLLE--KCSDALITMYAMCDALPKARELLDMHRSKNVFTWTSLISGYARNGQ 603
+H I+K G + ++L++MY C LP+AR++ ++V ++ +++ YA+
Sbjct: 150 IHSQIIKAGYQRDPRVQNSLLSMYGKCGDLPRARQVFAGISPRDVVSYNTMLGLYAQKAY 209

Query: 604 NLDALSCFEQMESEGLFPDAVTYV 675
+ L F QM SEG+ PD VTY+
Sbjct: 210 VKECLGLFGQMSSEGISPDKVTYI 233



Score = 70.5 bits (171), Expect = 1e-10
Identities = 33/105 (31%), Positives = 64/105 (60%), Gaps = 2/105 (1%)
Frame = +1

Query: 373 YIALLRTCAKNKDLHVGKRVHLDILKRGLLEK--CSDALITMYAMCDALPKARELLDMHR 546
++ LL CA + GK +H DIL+ G+ ++AL+ MY C +L +A+ + + +
Sbjct: 434 FLHLLSACANSSAYADGKMIHEDILRSGIKSNGHLANALMNMYRRCGSLMEAQNVFEGTQ 493

Query: 547 SKNVFTWTSLISGYARNGQNLDALSCFEQMESEGLFPDAVTYVCI 681
+++V +W S+I+G+A++G A F++M++E L PD +T+ +
Sbjct: 494 ARDVISWNSMIAGHAQHGSYETAYKLFQEMQNEELEPDNITFASV 538



Score = 69.7 bits (169), Expect = 2e-10
Identities = 35/105 (33%), Positives = 59/105 (56%), Gaps = 2/105 (1%)
Frame = +1

Query: 373 YIALLRTCAKNKDLHVGKRVHLDILKRGLLEKC--SDALITMYAMCDALPKARELLDMHR 546
Y+ALL+ C + + L KR+H +++ G+ S+ LI MY C ++ A ++
Sbjct: 30 YVALLQNCTRKRLLPEAKRIHAQMVEAGVGPDIFLSNLLINMYVKCRSVLDAHQVFKEMP 89

Query: 547 SKNVFTWTSLISGYARNGQNLDALSCFEQMESEGLFPDAVTYVCI 681
++V +W SLIS YA+ G A FE+M++ G P+ +TY+ I
Sbjct: 90 RRDVISWNSLISCYAQQGFKKKAFQLFEEMQNAGFIPNKITYISI 134



Score = 63.2 bits (152), Expect = 2e-08
Identities = 35/106 (33%), Positives = 59/106 (55%), Gaps = 3/106 (2%)
Frame = +1

Query: 373 YIALLRTCAKNKDLHVGKRVHLDILKRGLL--EKCSDALITMYAMCDALPKARELLDMHR 546
+ ++L C + L +GK++H I + GL +ALI MY C +L AR + +
Sbjct: 535 FASVLSGCKNPEALELGKQIHGRITESGLQLDVNLGNALINMYIRCGSLQDARNVFHSLQ 594

Query: 547 SKNVFTWTSLISGYARNGQNLDALSCFEQMESEGLF-PDAVTYVCI 681
++V +WT++I G A G+++ A+ F QM++EG PD T+ I
Sbjct: 595 HRDVMSWTAMIGGCADQGEDMKAIELFWQMQNEGFRPPDGSTFTSI 640



Score = 49.7 bits (117), Expect = 2e-04
Identities = 30/105 (28%), Positives = 53/105 (50%), Gaps = 2/105 (1%)
Frame = +1

Query: 373 YIALLRTCAKNKDLHVGKRVHLDILKRGLLE--KCSDALITMYAMCDALPKARELLDMHR 546
YI LL L GKR+H ++ GL + AL+TM C + A++
Sbjct: 232 YINLLDAFTTPSMLDEGKRIHKLTVEEGLNSDIRVGTALVTMCVRCGDVDSAKQAFKGIA 291

Query: 547 SKNVFTWTSLISGYARNGQNLDALSCFEQMESEGLFPDAVTYVCI 681
++V + +LI+ A++G N++A + +M S+G+ + TY+ I
Sbjct: 292 DRDVVVYNALIAALAQHGHNVEAFEQYYRMRSDGVALNRTTYLSI 336