DK950690
Clone id TST38A01NGRL0009_F18
Library
Length 702
Definition Adiantum capillus-veneris mRNA. clone: TST38A01NGRL0009_F18. 5' end sequence.
Accession
Tissue type prothallia
Developmental stage gametophyte
Contig ID
Sequence
ATTTTTCAAGACAAGATGCATCAGGAGCAGGTGGCGTAACGTGTTGCGGAGCTGAAGATG
TCGAATCTGCTGCTGGGGCCTGTGCTGAATGTGCACTCTCTTTCCAACTACAGCTTTGGA
ACCAAAGATGTCAAGATGGAGAAGGACACCTCCGTTGCAGACCGCCTTGCCCGAATGAAG
CAGAACTATATGAAGGAAGGAATGCGAAAGTGTGTCGAAGGGATCCTCTTGGTACAAGAA
CACAACCACCCACATGTTCTCATGCTCCAGATTGGGAATACGTTTTGCAAATTGCCAGGT
GGACGTTTGAAGCCTGGTGAAGATGAAATTGAGGGCTTGAAACGTAAACTTACTAGCAAG
CTTGCACCTGCATCTGCCTCTGTTCCACCGGATTGGCAGATTGGAGAATGTGTTGCTGTT
TGGTGGAGGCCCAATTTTGAGACTTTAATGTATCCTTATTGCCCACCTCATATAACAAAA
CCAAAGGAATGTAAGAAAATGTTTGTGGTGCATTTGGCGGAAAGACAACACTTTGCAGTA
CCAAAGAATTACAAGTTATTGGCAGTTCCTCTTTTTGAGTTGTATGACAATGTTCAGAGA
TACGGTCCAGTCATTTCGTCCATTCCGCAGCAGCTTTCAAGATTTTCAATCAACAGTATC
AATTAGCCGGGAAAACTGGGTTTGAGTTTCTTTTTGTCTCGC
■■Homology search results ■■ -
sp_hit_id Q7T3C6
Definition sp|Q7T3C6|CPSF5_DANRE Cleavage and polyadenylation specificity factor subunit 5 OS=Danio rerio
Align length 194
Score (bit) 241.0
E-value 2.0e-63
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= DK950690|Adiantum capillus-veneris mRNA, clone:
TST38A01NGRL0009_F18, 5'
(702 letters)

Database: uniprot_sprot.fasta
412,525 sequences; 148,809,765 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

sp|Q7T3C6|CPSF5_DANRE Cleavage and polyadenylation specificity f... 241 2e-63
sp|Q6DJE4|CPSF5_XENLA Cleavage and polyadenylation specificity f... 241 3e-63
sp|Q4KM65|CPSF5_RAT Cleavage and polyadenylation specificity fac... 240 5e-63
sp|Q5RAI8|CPSF5_PONAB Cleavage and polyadenylation specificity f... 240 5e-63
sp|Q9CQF3|CPSF5_MOUSE Cleavage and polyadenylation specificity f... 240 5e-63
sp|O43809|CPSF5_HUMAN Cleavage and polyadenylation specificity f... 240 5e-63
sp|Q3ZCA2|CPSF5_BOVIN Cleavage and polyadenylation specificity f... 240 5e-63
sp|Q55E68|CPSF5_DICDI Cleavage and polyadenylation specificity f... 221 2e-57
sp|P52385|PRTP_HHV7J Probable processing and transport protein O... 32 3.3
sp|Q9FMA5|C85A1_ARATH Cytochrome P450 85A1 OS=Arabidopsis thalia... 32 4.3
sp|Q641Y7|NUD18_RAT Nucleoside diphosphate-linked moiety X motif... 32 4.4
sp|Q3U2V3|NUD18_MOUSE Nucleoside diphosphate-linked moiety X mot... 32 4.4
sp|O60656|UD19_HUMAN UDP-glucuronosyltransferase 1-9 OS=Homo sap... 31 5.7
sp|Q64634|UD18_RAT UDP-glucuronosyltransferase 1-8 OS=Rattus nor... 31 5.7
sp|Q9HAW9|UD18_HUMAN UDP-glucuronosyltransferase 1-8 OS=Homo sap... 31 5.7
sp|Q64633|UD17_RAT UDP-glucuronosyltransferase 1-7 OS=Rattus nor... 31 5.7
sp|Q9HAW7|UD17_HUMAN UDP-glucuronosyltransferase 1-7 OS=Homo sap... 31 5.7
sp|Q6ZQM8|UD17C_MOUSE UDP-glucuronosyltransferase 1-7C OS=Mus mu... 31 5.7
sp|P08430|UD16_RAT UDP-glucuronosyltransferase 1-6 OS=Rattus nor... 31 5.7
sp|Q28611|UD16_RABIT UDP-glucuronosyltransferase 1-6 OS=Oryctola... 31 5.7
sp|Q64435|UD16_MOUSE UDP-glucuronosyltransferase 1-6 OS=Mus musc... 31 5.7
sp|P19224|UD16_HUMAN UDP-glucuronosyltransferase 1-6 OS=Homo sap... 31 5.7
sp|Q64638|UD15_RAT UDP-glucuronosyltransferase 1-5 OS=Rattus nor... 31 5.7
sp|P35504|UD15_HUMAN UDP-glucuronosyltransferase 1-5 OS=Homo sap... 31 5.7
sp|Q28612|UD14_RABIT UDP-glucuronosyltransferase 1-4 OS=Oryctola... 31 5.7
sp|P22310|UD14_HUMAN UDP-glucuronosyltransferase 1-4 OS=Homo sap... 31 5.7
sp|Q64637|UD13_RAT UDP-glucuronosyltransferase 1-3 OS=Rattus nor... 31 5.7
sp|P35503|UD13_HUMAN UDP-glucuronosyltransferase 1-3 OS=Homo sap... 31 5.7
sp|P20720|UD12_RAT UDP-glucuronosyltransferase 1-2 OS=Rattus nor... 31 5.7
sp|P70691|UD12_MOUSE UDP-glucuronosyltransferase 1-2 OS=Mus musc... 31 5.7

>sp|Q7T3C6|CPSF5_DANRE Cleavage and polyadenylation specificity
factor subunit 5 OS=Danio rerio GN=cpsf5 PE=2 SV=1
Length = 228

Score = 241 bits (616), Expect = 2e-63
Identities = 116/194 (59%), Positives = 142/194 (73%)
Frame = +1

Query: 67 LLLGPVLNVHSLSNYSFGTKDVKMEKDTSVADRLARMKQNYMKEGMRKCVEGILLVQEHN 246
L L +N++ L+NY+FGTK+ EKD+SVA R RM++ + K GMR+ VEG+L+V EH
Sbjct: 32 LTLERTINLYPLTNYTFGTKEPLYEKDSSVAARFQRMREEFEKIGMRRTVEGVLIVHEHR 91

Query: 247 HPHVLMLQIGNTFCKLPGGRLKPGEDEIEGLKRKLTSKLAPASASVPPDWQIGECVAVWW 426
PHVL+LQ+G TF KLPGG L PGEDE+EGLKR +T L V DW I +C+ WW
Sbjct: 92 LPHVLLLQLGTTFFKLPGGELNPGEDEVEGLKRLMTEILGRQDG-VKQDWVIDDCIGNWW 150

Query: 427 RPNFETLMYPYCPPHITKPKECKKMFVVHLAERQHFAVPKNYKLLAVPLFELYDNVQRYG 606
RPNFE YPY P HITKPKE KK+F+V L E+ FAVPKNYKL+A PLFELYDN YG
Sbjct: 151 RPNFEPPQYPYIPAHITKPKEHKKLFLVQLQEKALFAVPKNYKLVAAPLFELYDNAPGYG 210

Query: 607 PVISSIPQQLSRFS 648
P+ISS+PQ LSRF+
Sbjct: 211 PIISSLPQLLSRFN 224


>sp|Q6DJE4|CPSF5_XENLA Cleavage and polyadenylation specificity
factor subunit 5 OS=Xenopus laevis GN=cpsf5 PE=2 SV=1
Length = 227

Score = 241 bits (615), Expect = 3e-63
Identities = 116/194 (59%), Positives = 142/194 (73%)
Frame = +1

Query: 67 LLLGPVLNVHSLSNYSFGTKDVKMEKDTSVADRLARMKQNYMKEGMRKCVEGILLVQEHN 246
L L +N++ L+NY+FGTK+ EKD+SVA R RM++ + K GMR+ VEG+L+V EH
Sbjct: 31 LTLERTINLYPLTNYTFGTKEPLYEKDSSVAARFQRMREEFDKIGMRRTVEGVLIVHEHR 90

Query: 247 HPHVLMLQIGNTFCKLPGGRLKPGEDEIEGLKRKLTSKLAPASASVPPDWQIGECVAVWW 426
PHVL+LQ+G TF KLPGG L PGEDE+EGLKR +T L V DW I +C+ WW
Sbjct: 91 LPHVLLLQLGTTFFKLPGGELNPGEDEVEGLKRLMTEILGRQDG-VQQDWVIDDCIGNWW 149

Query: 427 RPNFETLMYPYCPPHITKPKECKKMFVVHLAERQHFAVPKNYKLLAVPLFELYDNVQRYG 606
RPNFE YPY P HITKPKE KK+F+V L E+ FAVPKNYKL+A PLFELYDN YG
Sbjct: 150 RPNFEPPQYPYIPAHITKPKEHKKLFLVQLQEKALFAVPKNYKLVAAPLFELYDNAPGYG 209

Query: 607 PVISSIPQQLSRFS 648
P+ISS+PQ LSRF+
Sbjct: 210 PIISSLPQLLSRFN 223


>sp|Q4KM65|CPSF5_RAT Cleavage and polyadenylation specificity factor
subunit 5 OS=Rattus norvegicus GN=Nudt21 PE=2 SV=1
Length = 227

Score = 240 bits (613), Expect = 5e-63
Identities = 116/194 (59%), Positives = 142/194 (73%)
Frame = +1

Query: 67 LLLGPVLNVHSLSNYSFGTKDVKMEKDTSVADRLARMKQNYMKEGMRKCVEGILLVQEHN 246
L L +N++ L+NY+FGTK+ EKD+SVA R RM++ + K GMR+ VEG+L+V EH
Sbjct: 31 LTLERTINLYPLTNYTFGTKEPLYEKDSSVAARFQRMREEFDKIGMRRTVEGVLIVHEHR 90

Query: 247 HPHVLMLQIGNTFCKLPGGRLKPGEDEIEGLKRKLTSKLAPASASVPPDWQIGECVAVWW 426
PHVL+LQ+G TF KLPGG L PGEDE+EGLKR +T L V DW I +C+ WW
Sbjct: 91 LPHVLLLQLGTTFFKLPGGELNPGEDEVEGLKRLMTEILGRQDG-VLQDWVIDDCIGNWW 149

Query: 427 RPNFETLMYPYCPPHITKPKECKKMFVVHLAERQHFAVPKNYKLLAVPLFELYDNVQRYG 606
RPNFE YPY P HITKPKE KK+F+V L E+ FAVPKNYKL+A PLFELYDN YG
Sbjct: 150 RPNFEPPQYPYIPAHITKPKEHKKLFLVQLQEKALFAVPKNYKLVAAPLFELYDNAPGYG 209

Query: 607 PVISSIPQQLSRFS 648
P+ISS+PQ LSRF+
Sbjct: 210 PIISSLPQLLSRFN 223


>sp|Q5RAI8|CPSF5_PONAB Cleavage and polyadenylation specificity
factor subunit 5 OS=Pongo abelii GN=NUDT21 PE=2 SV=1
Length = 227

Score = 240 bits (613), Expect = 5e-63
Identities = 116/194 (59%), Positives = 142/194 (73%)
Frame = +1

Query: 67 LLLGPVLNVHSLSNYSFGTKDVKMEKDTSVADRLARMKQNYMKEGMRKCVEGILLVQEHN 246
L L +N++ L+NY+FGTK+ EKD+SVA R RM++ + K GMR+ VEG+L+V EH
Sbjct: 31 LTLERTINLYPLTNYTFGTKEPLYEKDSSVAARFQRMREEFDKIGMRRTVEGVLIVHEHR 90

Query: 247 HPHVLMLQIGNTFCKLPGGRLKPGEDEIEGLKRKLTSKLAPASASVPPDWQIGECVAVWW 426
PHVL+LQ+G TF KLPGG L PGEDE+EGLKR +T L V DW I +C+ WW
Sbjct: 91 LPHVLLLQLGTTFFKLPGGELNPGEDEVEGLKRLMTEILGRQDG-VLQDWVIDDCIGNWW 149

Query: 427 RPNFETLMYPYCPPHITKPKECKKMFVVHLAERQHFAVPKNYKLLAVPLFELYDNVQRYG 606
RPNFE YPY P HITKPKE KK+F+V L E+ FAVPKNYKL+A PLFELYDN YG
Sbjct: 150 RPNFEPPQYPYIPAHITKPKEHKKLFLVQLQEKALFAVPKNYKLVAAPLFELYDNAPGYG 209

Query: 607 PVISSIPQQLSRFS 648
P+ISS+PQ LSRF+
Sbjct: 210 PIISSLPQLLSRFN 223


>sp|Q9CQF3|CPSF5_MOUSE Cleavage and polyadenylation specificity
factor subunit 5 OS=Mus musculus GN=Nudt21 PE=2 SV=1
Length = 227

Score = 240 bits (613), Expect = 5e-63
Identities = 116/194 (59%), Positives = 142/194 (73%)
Frame = +1

Query: 67 LLLGPVLNVHSLSNYSFGTKDVKMEKDTSVADRLARMKQNYMKEGMRKCVEGILLVQEHN 246
L L +N++ L+NY+FGTK+ EKD+SVA R RM++ + K GMR+ VEG+L+V EH
Sbjct: 31 LTLERTINLYPLTNYTFGTKEPLYEKDSSVAARFQRMREEFDKIGMRRTVEGVLIVHEHR 90

Query: 247 HPHVLMLQIGNTFCKLPGGRLKPGEDEIEGLKRKLTSKLAPASASVPPDWQIGECVAVWW 426
PHVL+LQ+G TF KLPGG L PGEDE+EGLKR +T L V DW I +C+ WW
Sbjct: 91 LPHVLLLQLGTTFFKLPGGELNPGEDEVEGLKRLMTEILGRQDG-VLQDWVIDDCIGNWW 149

Query: 427 RPNFETLMYPYCPPHITKPKECKKMFVVHLAERQHFAVPKNYKLLAVPLFELYDNVQRYG 606
RPNFE YPY P HITKPKE KK+F+V L E+ FAVPKNYKL+A PLFELYDN YG
Sbjct: 150 RPNFEPPQYPYIPAHITKPKEHKKLFLVQLQEKALFAVPKNYKLVAAPLFELYDNAPGYG 209

Query: 607 PVISSIPQQLSRFS 648
P+ISS+PQ LSRF+
Sbjct: 210 PIISSLPQLLSRFN 223


>sp|O43809|CPSF5_HUMAN Cleavage and polyadenylation specificity
factor subunit 5 OS=Homo sapiens GN=NUDT21 PE=1 SV=1
Length = 227

Score = 240 bits (613), Expect = 5e-63
Identities = 116/194 (59%), Positives = 142/194 (73%)
Frame = +1

Query: 67 LLLGPVLNVHSLSNYSFGTKDVKMEKDTSVADRLARMKQNYMKEGMRKCVEGILLVQEHN 246
L L +N++ L+NY+FGTK+ EKD+SVA R RM++ + K GMR+ VEG+L+V EH
Sbjct: 31 LTLERTINLYPLTNYTFGTKEPLYEKDSSVAARFQRMREEFDKIGMRRTVEGVLIVHEHR 90

Query: 247 HPHVLMLQIGNTFCKLPGGRLKPGEDEIEGLKRKLTSKLAPASASVPPDWQIGECVAVWW 426
PHVL+LQ+G TF KLPGG L PGEDE+EGLKR +T L V DW I +C+ WW
Sbjct: 91 LPHVLLLQLGTTFFKLPGGELNPGEDEVEGLKRLMTEILGRQDG-VLQDWVIDDCIGNWW 149

Query: 427 RPNFETLMYPYCPPHITKPKECKKMFVVHLAERQHFAVPKNYKLLAVPLFELYDNVQRYG 606
RPNFE YPY P HITKPKE KK+F+V L E+ FAVPKNYKL+A PLFELYDN YG
Sbjct: 150 RPNFEPPQYPYIPAHITKPKEHKKLFLVQLQEKALFAVPKNYKLVAAPLFELYDNAPGYG 209

Query: 607 PVISSIPQQLSRFS 648
P+ISS+PQ LSRF+
Sbjct: 210 PIISSLPQLLSRFN 223


>sp|Q3ZCA2|CPSF5_BOVIN Cleavage and polyadenylation specificity
factor subunit 5 OS=Bos taurus GN=NUDT21 PE=2 SV=1
Length = 227

Score = 240 bits (613), Expect = 5e-63
Identities = 116/194 (59%), Positives = 142/194 (73%)
Frame = +1

Query: 67 LLLGPVLNVHSLSNYSFGTKDVKMEKDTSVADRLARMKQNYMKEGMRKCVEGILLVQEHN 246
L L +N++ L+NY+FGTK+ EKD+SVA R RM++ + K GMR+ VEG+L+V EH
Sbjct: 31 LTLERTINLYPLTNYTFGTKEPLYEKDSSVAARFQRMREEFDKIGMRRTVEGVLIVHEHR 90

Query: 247 HPHVLMLQIGNTFCKLPGGRLKPGEDEIEGLKRKLTSKLAPASASVPPDWQIGECVAVWW 426
PHVL+LQ+G TF KLPGG L PGEDE+EGLKR +T L V DW I +C+ WW
Sbjct: 91 LPHVLLLQLGTTFFKLPGGELNPGEDEVEGLKRLMTEILGRQDG-VLQDWVIDDCIGNWW 149

Query: 427 RPNFETLMYPYCPPHITKPKECKKMFVVHLAERQHFAVPKNYKLLAVPLFELYDNVQRYG 606
RPNFE YPY P HITKPKE KK+F+V L E+ FAVPKNYKL+A PLFELYDN YG
Sbjct: 150 RPNFEPPQYPYIPAHITKPKEHKKLFLVQLQEKALFAVPKNYKLVAAPLFELYDNAPGYG 209

Query: 607 PVISSIPQQLSRFS 648
P+ISS+PQ LSRF+
Sbjct: 210 PIISSLPQLLSRFN 223


>sp|Q55E68|CPSF5_DICDI Cleavage and polyadenylation specificity
factor subunit 5 OS=Dictyostelium discoideum GN=cpsf5
PE=3 SV=1
Length = 200

Score = 221 bits (564), Expect = 2e-57
Identities = 107/188 (56%), Positives = 141/188 (75%), Gaps = 1/188 (0%)
Frame = +1

Query: 103 SNYSFGTKDVKMEKDTSVADRLARMKQNYMKEGMRKCVEGILLVQEHNHPHVLMLQIGNT 282
++YSFG K+ K EK+ S+ +LAR+K +Y KEG+RK VEGI+++ +H HPH+L+LQ N
Sbjct: 13 TSYSFG-KEEKKEKEQSLTSKLARLKDSYEKEGLRKAVEGIIIIHDHGHPHILLLQDNNY 71

Query: 283 FCKLPGGRLKPGEDEIEGLKRKLTSKLAPASASVPP-DWQIGECVAVWWRPNFETLMYPY 459
F KLPGG+LKPGE+EI+GL RKLT KL+P V W+IG+ V+ WWRPNFE ++PY
Sbjct: 72 F-KLPGGKLKPGENEIDGLIRKLTKKLSPTGTPVSDAPWEIGDHVSTWWRPNFEPSLFPY 130

Query: 460 CPPHITKPKECKKMFVVHLAERQHFAVPKNYKLLAVPLFELYDNVQRYGPVISSIPQQLS 639
P HITKPKECKK+FVV L E+ FAV N L+AV L+E+Y+N QRYG VISSIP +S
Sbjct: 131 IPSHITKPKECKKLFVVTLPEKCKFAVSNNLSLIAVSLYEIYNNSQRYGAVISSIPALIS 190

Query: 640 RFSINSIN 663
R++ +N
Sbjct: 191 RYTFVYLN 198


>sp|P52385|PRTP_HHV7J Probable processing and transport protein
OS=Human herpesvirus 7 (strain JI) GN=U40 PE=3 SV=1
Length = 721

Score = 32.0 bits (71), Expect = 3.3
Identities = 27/82 (32%), Positives = 37/82 (45%)
Frame = +1

Query: 55 KMSNLLLGPVLNVHSLSNYSFGTKDVKMEKDTSVADRLARMKQNYMKEGMRKCVEGILLV 234
+M LL GP+ N H+ S + ++ M VAD L +MKE + KCVEG +
Sbjct: 532 EMYRLLTGPLSNYHTASFPL--SSNISMAYACDVADFLP-----HMKEDLAKCVEGTI-- 582

Query: 235 QEHNHPHVLMLQIGNTFCKLPG 300
+P ML N F G
Sbjct: 583 ----YPENWMLCTYNKFFNFDG 600


>sp|Q9FMA5|C85A1_ARATH Cytochrome P450 85A1 OS=Arabidopsis thaliana
GN=CYP85A1 PE=2 SV=1
Length = 465

Score = 31.6 bits (70), Expect = 4.3
Identities = 14/27 (51%), Positives = 17/27 (62%)
Frame = +3

Query: 495 ENVCGAFGGKTTLCSTKELQVIGSSSF 575
+N C FGG T LC KEL ++ SSF
Sbjct: 402 QNSCFVFGGGTRLCPGKELGIVEISSF 428


tr_hit_id B8ARS3
Definition tr|B8ARS3|B8ARS3_ORYSI Putative uncharacterized protein OS=Oryza sativa subsp. indica
Align length 195
Score (bit) 347.0
E-value 3.0e-94
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= DK950690|Adiantum capillus-veneris mRNA, clone:
TST38A01NGRL0009_F18, 5'
(702 letters)

Database: uniprot_trembl.fasta
7,341,751 sequences; 2,391,615,440 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

tr|B8ARS3|B8ARS3_ORYSI Putative uncharacterized protein OS=Oryza... 347 3e-94
tr|B4FXL2|B4FXL2_MAIZE Putative uncharacterized protein OS=Zea m... 347 3e-94
tr|A9RY95|A9RY95_PHYPA Predicted protein OS=Physcomitrella paten... 347 6e-94
tr|Q259F9|Q259F9_ORYSA H0124B04.17 protein OS=Oryza sativa GN=H0... 346 7e-94
tr|B6T7P5|B6T7P5_MAIZE Cleavage and polyadenylation specificity ... 346 7e-94
tr|A3AYR9|A3AYR9_ORYSJ Putative uncharacterized protein OS=Oryza... 346 7e-94
tr|Q7XPV9|Q7XPV9_ORYSJ OSJNBa0032F06.22 protein OS=Oryza sativa ... 346 1e-93
tr|Q0J8X2|Q0J8X2_ORYSJ Os04g0683100 protein (Fragment) OS=Oryza ... 346 1e-93
tr|A7PZ92|A7PZ92_VITVI Chromosome chr15 scaffold_40, whole genom... 346 1e-93
tr|B6T6P2|B6T6P2_MAIZE Cleavage and polyadenylation specificity ... 344 3e-93
tr|A9PGR8|A9PGR8_POPTR Putative uncharacterized protein OS=Popul... 340 5e-92
tr|Q8GXS3|Q8GXS3_ARATH Putative uncharacterized protein At4g2555... 339 1e-91
tr|A5B6Q5|A5B6Q5_VITVI Putative uncharacterized protein (Chromos... 338 2e-91
tr|A9NKW4|A9NKW4_PICSI Putative uncharacterized protein OS=Picea... 325 2e-87
tr|A5BP00|A5BP00_VITVI Putative uncharacterized protein OS=Vitis... 298 2e-79
tr|O65606|O65606_ARATH Putative uncharacterized protein M7J2.80 ... 289 1e-76
tr|Q9M0K5|Q9M0K5_ARATH Putative uncharacterized protein AT4g2555... 286 9e-76
tr|A8I1C7|A8I1C7_CHLRE Predicted protein (Fragment) OS=Chlamydom... 253 1e-65
tr|A8P258|A8P258_COPC7 Putative uncharacterized protein OS=Copri... 248 3e-64
tr|B0DT86|B0DT86_LACBS Predicted protein OS=Laccaria bicolor (st... 246 1e-63
tr|B8PFN7|B8PFN7_9APHY Predicted protein OS=Postia placenta Mad-... 244 3e-63
tr|B2AWI2|B2AWI2_PODAN Predicted CDS Pa_7_7250 OS=Podospora anse... 243 7e-63
tr|Q4SIH0|Q4SIH0_TETNG Chromosome 5 SCAF14581, whole genome shot... 241 3e-62
tr|Q28J89|Q28J89_XENTR Cleavage and polyadenylation specific fac... 241 3e-62
tr|B5G2F4|B5G2F4_TAEGU Putative cleavage and polyadenylation spe... 241 3e-62
tr|B4F764|B4F764_RAT Cleavage and polyadenylation specific facto... 240 6e-62
tr|B5G2F7|B5G2F7_TAEGU Putative cleavage and polyadenylation spe... 239 1e-61
tr|B2R6U8|B2R6U8_HUMAN cDNA, FLJ93125, highly similar to Homo sa... 238 2e-61
tr|Q2H9A2|Q2H9A2_CHAGB Putative uncharacterized protein OS=Chaet... 238 2e-61
tr|Q1HQ96|Q1HQ96_BOMMO Cleavage and polyadenylation specific fac... 236 8e-61

>tr|B8ARS3|B8ARS3_ORYSI Putative uncharacterized protein OS=Oryza
sativa subsp. indica GN=OsI_17973 PE=4 SV=1
Length = 202

Score = 347 bits (891), Expect = 3e-94
Identities = 160/195 (82%), Positives = 180/195 (92%)
Frame = +1

Query: 79 PVLNVHSLSNYSFGTKDVKMEKDTSVADRLARMKQNYMKEGMRKCVEGILLVQEHNHPHV 258
PV+NV+ L+NY+FGTK+ KMEKDTSVADRLARMK NYMKEGMR VE ILLVQEHNHPH+
Sbjct: 7 PVVNVYPLANYTFGTKEPKMEKDTSVADRLARMKVNYMKEGMRTSVEAILLVQEHNHPHI 66

Query: 259 LMLQIGNTFCKLPGGRLKPGEDEIEGLKRKLTSKLAPASASVPPDWQIGECVAVWWRPNF 438
L+LQIGNTFCKLPGGRLKPGE+EIEGLKRKL SKLA S S PP+WQ+GECVAVWWRPNF
Sbjct: 67 LLLQIGNTFCKLPGGRLKPGENEIEGLKRKLCSKLAVNSPSFPPNWQVGECVAVWWRPNF 126

Query: 439 ETLMYPYCPPHITKPKECKKMFVVHLAERQHFAVPKNYKLLAVPLFELYDNVQRYGPVIS 618
ET+MYPYCPPHITKPKECKK+F+VHL+ER++FAVP+N KLLAVPLFELYDNVQRYGPVIS
Sbjct: 127 ETVMYPYCPPHITKPKECKKLFIVHLSEREYFAVPRNLKLLAVPLFELYDNVQRYGPVIS 186

Query: 619 SIPQQLSRFSINSIN 663
+IPQQLSRF N ++
Sbjct: 187 TIPQQLSRFQFNMVS 201


>tr|B4FXL2|B4FXL2_MAIZE Putative uncharacterized protein OS=Zea mays
PE=2 SV=1
Length = 202

Score = 347 bits (891), Expect = 3e-94
Identities = 160/195 (82%), Positives = 180/195 (92%)
Frame = +1

Query: 79 PVLNVHSLSNYSFGTKDVKMEKDTSVADRLARMKQNYMKEGMRKCVEGILLVQEHNHPHV 258
PV+NV+ L+NY+FGTK+ KMEKDTSVADRLARMK NYMKEGMR VE ILLVQEHNHPH+
Sbjct: 7 PVVNVYPLANYTFGTKEPKMEKDTSVADRLARMKVNYMKEGMRTSVEAILLVQEHNHPHI 66

Query: 259 LMLQIGNTFCKLPGGRLKPGEDEIEGLKRKLTSKLAPASASVPPDWQIGECVAVWWRPNF 438
L+LQIGNTFCKLPGGRLKPGE+EIEGLKRKL SKLA S S PP+WQ+GECVAVWWRPNF
Sbjct: 67 LLLQIGNTFCKLPGGRLKPGENEIEGLKRKLCSKLAVNSPSFPPNWQVGECVAVWWRPNF 126

Query: 439 ETLMYPYCPPHITKPKECKKMFVVHLAERQHFAVPKNYKLLAVPLFELYDNVQRYGPVIS 618
ET+MYPYCPPHITKPKECKK+F+VHL+ER++FAVP+N KLLAVPLFELYDNVQRYGPVIS
Sbjct: 127 ETVMYPYCPPHITKPKECKKLFIVHLSEREYFAVPRNLKLLAVPLFELYDNVQRYGPVIS 186

Query: 619 SIPQQLSRFSINSIN 663
+IPQQLSRF N ++
Sbjct: 187 TIPQQLSRFQFNMVS 201


>tr|A9RY95|A9RY95_PHYPA Predicted protein OS=Physcomitrella patens
subsp. patens GN=PHYPADRAFT_121377 PE=4 SV=1
Length = 200

Score = 347 bits (889), Expect = 6e-94
Identities = 163/199 (81%), Positives = 185/199 (92%)
Frame = +1

Query: 67 LLLGPVLNVHSLSNYSFGTKDVKMEKDTSVADRLARMKQNYMKEGMRKCVEGILLVQEHN 246
++ GPV+NV+ LS+Y+FG+K+ KMEKDTSVADRLARMKQNYMKEGMR VEGILLVQEHN
Sbjct: 1 MVSGPVVNVYPLSSYTFGSKEAKMEKDTSVADRLARMKQNYMKEGMRTSVEGILLVQEHN 60

Query: 247 HPHVLMLQIGNTFCKLPGGRLKPGEDEIEGLKRKLTSKLAPASASVPPDWQIGECVAVWW 426
HPHVL+LQIGNTF KLPGGRLK GE+EIEGLKRKLTSKLAP ++S+ P+WQIGEC A+WW
Sbjct: 61 HPHVLLLQIGNTFFKLPGGRLKTGENEIEGLKRKLTSKLAPTASSIQPEWQIGECAAMWW 120

Query: 427 RPNFETLMYPYCPPHITKPKECKKMFVVHLAERQHFAVPKNYKLLAVPLFELYDNVQRYG 606
RPNFETL+YPY PPHITKPKECKK+FVV L+ERQ+FAVPKN KLLAVPLFELYDNVQRYG
Sbjct: 121 RPNFETLLYPYQPPHITKPKECKKLFVVCLSERQYFAVPKNLKLLAVPLFELYDNVQRYG 180

Query: 607 PVISSIPQQLSRFSINSIN 663
PVIS+IPQQLSRF+ N+IN
Sbjct: 181 PVISAIPQQLSRFNFNAIN 199


>tr|Q259F9|Q259F9_ORYSA H0124B04.17 protein OS=Oryza sativa
GN=H0124B04.17 PE=3 SV=1
Length = 2505

Score = 346 bits (888), Expect = 7e-94
Identities = 160/192 (83%), Positives = 178/192 (92%)
Frame = +1

Query: 79 PVLNVHSLSNYSFGTKDVKMEKDTSVADRLARMKQNYMKEGMRKCVEGILLVQEHNHPHV 258
PV+NV+ L+NY+FGTK+ KMEKDTSVADRLARMK NYMKEGMR VE ILLVQEHNHPH+
Sbjct: 7 PVVNVYPLANYTFGTKEPKMEKDTSVADRLARMKVNYMKEGMRTSVEAILLVQEHNHPHI 66

Query: 259 LMLQIGNTFCKLPGGRLKPGEDEIEGLKRKLTSKLAPASASVPPDWQIGECVAVWWRPNF 438
L+LQIGNTFCKLPGGRLKPGE+EIEGLKRKL SKLA S S PP+WQ+GECVAVWWRPNF
Sbjct: 67 LLLQIGNTFCKLPGGRLKPGENEIEGLKRKLCSKLAVNSPSFPPNWQVGECVAVWWRPNF 126

Query: 439 ETLMYPYCPPHITKPKECKKMFVVHLAERQHFAVPKNYKLLAVPLFELYDNVQRYGPVIS 618
ET+MYPYCPPHITKPKECKK+F+VHL+ER++FAVP+N KLLAVPLFELYDNVQRYGPVIS
Sbjct: 127 ETVMYPYCPPHITKPKECKKLFIVHLSEREYFAVPRNLKLLAVPLFELYDNVQRYGPVIS 186

Query: 619 SIPQQLSRFSIN 654
+IPQQLSRF N
Sbjct: 187 TIPQQLSRFQFN 198


>tr|B6T7P5|B6T7P5_MAIZE Cleavage and polyadenylation specificity
factor 5 OS=Zea mays PE=2 SV=1
Length = 202

Score = 346 bits (888), Expect = 7e-94
Identities = 160/195 (82%), Positives = 179/195 (91%)
Frame = +1

Query: 79 PVLNVHSLSNYSFGTKDVKMEKDTSVADRLARMKQNYMKEGMRKCVEGILLVQEHNHPHV 258
PV+NV+ L+NY+FGTK+ KMEKDTSVADRLARMK NYMKEGMR VE ILLVQEHNHPH+
Sbjct: 7 PVVNVYPLANYTFGTKEPKMEKDTSVADRLARMKVNYMKEGMRTSVEAILLVQEHNHPHI 66

Query: 259 LMLQIGNTFCKLPGGRLKPGEDEIEGLKRKLTSKLAPASASVPPDWQIGECVAVWWRPNF 438
L+LQIGNTFCKLPGGRLKPGE+EIEGLKRKL SKLA S S PP+WQ+GECVAVWWRPNF
Sbjct: 67 LLLQIGNTFCKLPGGRLKPGENEIEGLKRKLCSKLAVNSPSFPPNWQVGECVAVWWRPNF 126

Query: 439 ETLMYPYCPPHITKPKECKKMFVVHLAERQHFAVPKNYKLLAVPLFELYDNVQRYGPVIS 618
ET+MYPYCPPHITKPKECKK+F+VHL ER++FAVP+N KLLAVPLFELYDNVQRYGPVIS
Sbjct: 127 ETVMYPYCPPHITKPKECKKLFIVHLFEREYFAVPRNLKLLAVPLFELYDNVQRYGPVIS 186

Query: 619 SIPQQLSRFSINSIN 663
+IPQQLSRF N ++
Sbjct: 187 TIPQQLSRFQFNMVS 201


>tr|A3AYR9|A3AYR9_ORYSJ Putative uncharacterized protein OS=Oryza
sativa subsp. japonica GN=OsJ_015941 PE=3 SV=1
Length = 2351

Score = 346 bits (888), Expect = 7e-94
Identities = 160/192 (83%), Positives = 178/192 (92%)
Frame = +1

Query: 79 PVLNVHSLSNYSFGTKDVKMEKDTSVADRLARMKQNYMKEGMRKCVEGILLVQEHNHPHV 258
PV+NV+ L+NY+FGTK+ KMEKDTSVADRLARMK NYMKEGMR VE ILLVQEHNHPH+
Sbjct: 7 PVVNVYPLANYTFGTKEPKMEKDTSVADRLARMKVNYMKEGMRTSVEAILLVQEHNHPHI 66

Query: 259 LMLQIGNTFCKLPGGRLKPGEDEIEGLKRKLTSKLAPASASVPPDWQIGECVAVWWRPNF 438
L+LQIGNTFCKLPGGRLKPGE+EIEGLKRKL SKLA S S PP+WQ+GECVAVWWRPNF
Sbjct: 67 LLLQIGNTFCKLPGGRLKPGENEIEGLKRKLCSKLAVNSPSFPPNWQVGECVAVWWRPNF 126

Query: 439 ETLMYPYCPPHITKPKECKKMFVVHLAERQHFAVPKNYKLLAVPLFELYDNVQRYGPVIS 618
ET+MYPYCPPHITKPKECKK+F+VHL+ER++FAVP+N KLLAVPLFELYDNVQRYGPVIS
Sbjct: 127 ETVMYPYCPPHITKPKECKKLFIVHLSEREYFAVPRNLKLLAVPLFELYDNVQRYGPVIS 186

Query: 619 SIPQQLSRFSIN 654
+IPQQLSRF N
Sbjct: 187 TIPQQLSRFQFN 198


>tr|Q7XPV9|Q7XPV9_ORYSJ OSJNBa0032F06.22 protein OS=Oryza sativa
subsp. japonica GN=OSJNBa0032F06.22 PE=4 SV=1
Length = 202

Score = 346 bits (887), Expect = 1e-93
Identities = 159/195 (81%), Positives = 179/195 (91%)
Frame = +1

Query: 79 PVLNVHSLSNYSFGTKDVKMEKDTSVADRLARMKQNYMKEGMRKCVEGILLVQEHNHPHV 258
PV+NV+ L+NY+FGTK+ KMEKDTSVADR ARMK NYMKEGMR VE ILLVQEHNHPH+
Sbjct: 7 PVVNVYPLANYTFGTKEPKMEKDTSVADRFARMKVNYMKEGMRTSVEAILLVQEHNHPHI 66

Query: 259 LMLQIGNTFCKLPGGRLKPGEDEIEGLKRKLTSKLAPASASVPPDWQIGECVAVWWRPNF 438
L+LQIGNTFCKLPGGRLKPGE+EIEGLKRKL SKLA S S PP+WQ+GECVAVWWRPNF
Sbjct: 67 LLLQIGNTFCKLPGGRLKPGENEIEGLKRKLCSKLAVNSPSFPPNWQVGECVAVWWRPNF 126

Query: 439 ETLMYPYCPPHITKPKECKKMFVVHLAERQHFAVPKNYKLLAVPLFELYDNVQRYGPVIS 618
ET+MYPYCPPHITKPKECKK+F+VHL+ER++FAVP+N KLLAVPLFELYDNVQRYGPVIS
Sbjct: 127 ETVMYPYCPPHITKPKECKKLFIVHLSEREYFAVPRNLKLLAVPLFELYDNVQRYGPVIS 186

Query: 619 SIPQQLSRFSINSIN 663
+IPQQLSRF N ++
Sbjct: 187 TIPQQLSRFQFNMVS 201


>tr|Q0J8X2|Q0J8X2_ORYSJ Os04g0683100 protein (Fragment) OS=Oryza
sativa subsp. japonica GN=Os04g0683100 PE=4 SV=1
Length = 259

Score = 346 bits (887), Expect = 1e-93
Identities = 159/195 (81%), Positives = 179/195 (91%)
Frame = +1

Query: 79 PVLNVHSLSNYSFGTKDVKMEKDTSVADRLARMKQNYMKEGMRKCVEGILLVQEHNHPHV 258
PV+NV+ L+NY+FGTK+ KMEKDTSVADR ARMK NYMKEGMR VE ILLVQEHNHPH+
Sbjct: 64 PVVNVYPLANYTFGTKEPKMEKDTSVADRFARMKVNYMKEGMRTSVEAILLVQEHNHPHI 123

Query: 259 LMLQIGNTFCKLPGGRLKPGEDEIEGLKRKLTSKLAPASASVPPDWQIGECVAVWWRPNF 438
L+LQIGNTFCKLPGGRLKPGE+EIEGLKRKL SKLA S S PP+WQ+GECVAVWWRPNF
Sbjct: 124 LLLQIGNTFCKLPGGRLKPGENEIEGLKRKLCSKLAVNSPSFPPNWQVGECVAVWWRPNF 183

Query: 439 ETLMYPYCPPHITKPKECKKMFVVHLAERQHFAVPKNYKLLAVPLFELYDNVQRYGPVIS 618
ET+MYPYCPPHITKPKECKK+F+VHL+ER++FAVP+N KLLAVPLFELYDNVQRYGPVIS
Sbjct: 184 ETVMYPYCPPHITKPKECKKLFIVHLSEREYFAVPRNLKLLAVPLFELYDNVQRYGPVIS 243

Query: 619 SIPQQLSRFSINSIN 663
+IPQQLSRF N ++
Sbjct: 244 TIPQQLSRFQFNMVS 258


>tr|A7PZ92|A7PZ92_VITVI Chromosome chr15 scaffold_40, whole genome
shotgun sequence OS=Vitis vinifera GN=GSVIVT00026791001
PE=4 SV=1
Length = 200

Score = 346 bits (887), Expect = 1e-93
Identities = 159/196 (81%), Positives = 180/196 (91%)
Frame = +1

Query: 67 LLLGPVLNVHSLSNYSFGTKDVKMEKDTSVADRLARMKQNYMKEGMRKCVEGILLVQEHN 246
++ PV+N + LS+Y+FGTK+ KMEKDTSVADRLARMK NYMKEGMR VE ILLVQEHN
Sbjct: 1 MVTSPVVNTYPLSSYTFGTKEPKMEKDTSVADRLARMKVNYMKEGMRTSVEAILLVQEHN 60

Query: 247 HPHVLMLQIGNTFCKLPGGRLKPGEDEIEGLKRKLTSKLAPASASVPPDWQIGECVAVWW 426
HPH+L+LQIGNTFCKLPGGRLKPGE+EIEGLKRKL+SKLA S ++ PDWQIGECVA+WW
Sbjct: 61 HPHILLLQIGNTFCKLPGGRLKPGENEIEGLKRKLSSKLAANSLALQPDWQIGECVAIWW 120

Query: 427 RPNFETLMYPYCPPHITKPKECKKMFVVHLAERQHFAVPKNYKLLAVPLFELYDNVQRYG 606
RPNFET+MYPYCPPHITKPKECKK+F+VHL+ER++FAVPKN KLLAVPLFELYDNVQRYG
Sbjct: 121 RPNFETIMYPYCPPHITKPKECKKLFIVHLSEREYFAVPKNLKLLAVPLFELYDNVQRYG 180

Query: 607 PVISSIPQQLSRFSIN 654
PVIS+IPQQLSRF N
Sbjct: 181 PVISTIPQQLSRFQFN 196


>tr|B6T6P2|B6T6P2_MAIZE Cleavage and polyadenylation specificity
factor 5 OS=Zea mays PE=2 SV=1
Length = 202

Score = 344 bits (883), Expect = 3e-93
Identities = 158/194 (81%), Positives = 179/194 (92%)
Frame = +1

Query: 82 VLNVHSLSNYSFGTKDVKMEKDTSVADRLARMKQNYMKEGMRKCVEGILLVQEHNHPHVL 261
V+NV+ L+NY+FGTK+ KMEKDTSVADRLARMK NYMKEGMR VE ILLVQEHNHPH+L
Sbjct: 8 VVNVYPLANYTFGTKEPKMEKDTSVADRLARMKVNYMKEGMRTSVEAILLVQEHNHPHIL 67

Query: 262 MLQIGNTFCKLPGGRLKPGEDEIEGLKRKLTSKLAPASASVPPDWQIGECVAVWWRPNFE 441
+LQIGNTFCKLPGGRLKPGE+EIEGLKRKL SKLA S S PP+WQ+GECVAVWWRPNFE
Sbjct: 68 LLQIGNTFCKLPGGRLKPGENEIEGLKRKLCSKLAVNSPSFPPNWQVGECVAVWWRPNFE 127

Query: 442 TLMYPYCPPHITKPKECKKMFVVHLAERQHFAVPKNYKLLAVPLFELYDNVQRYGPVISS 621
T+MYPYCPPHITKPKECKK+F+VHL+ER++FAVP+N KLLAVPLFELYDN+QRYGPVIS+
Sbjct: 128 TVMYPYCPPHITKPKECKKLFIVHLSEREYFAVPRNLKLLAVPLFELYDNIQRYGPVIST 187

Query: 622 IPQQLSRFSINSIN 663
IPQQLSRF N ++
Sbjct: 188 IPQQLSRFQFNMVS 201