DK950723
Clone id TST38A01NGRL0009_H03
Library
Length 705
Definition Adiantum capillus-veneris mRNA. clone: TST38A01NGRL0009_H03. 5' end sequence.
Accession
Tissue type prothallia
Developmental stage gametophyte
Contig ID -
Sequence
GCAAGCACACCCTTGCCTTTCGTTGCTGCAACGGCAGCGATTCCTCCGATCCCCCGCCGG
ACCCAGCAGCAATTCCCTCCTCCCGTAAGTCCAAGCGCCCTCCCAAGGAATCACTCCCCC
GGGGTCTTCGCCGCTATGAGACCACTGTGGTCTTGCGCCCTGACATCACAGAAGAGGAAA
GGCTTGCATGGACCCAGCGATACGATGAGGCAATAATTGCAGGAGGTGCAACAAGTGTGG
AATTCTCGAATCGTGGTATTTTGCCCCTTACATACAGCATAAAGAAAAAAGACTTGGGAG
GAGTGGCCAGAACATACCTAGATGGTGTCTACATGCATATTGCATACATTACCAAGCCCC
AATGTCAACTTGATTTGCCCCCCAGGTTCAATCAGGATGACGATGTGATCAAGAGCATCA
CGATGCTACTGAAGTAAGAGACTCTTTCTTTTCTCTCATTTTTCCTGCTCCAATGGGCCT
TGAATTGCAAGGCTGCGATAGATTGCTAATGAAAAGAGGCATCCATTTTTCTCCTTTGTC
AAGTCATGGCTGCCATCAGAGCACTCTCAGATTCGAGCCTAAAGTAGATTCTTGGTAACT
TGTTGAGCTCCATGGATGGATCAATGTCTACTCTTTATTATAGGTTTGCTTGTTTTATGG
CTAAGCTTGCGTAGAGACCGCTGGTTGTTTCTGGAGGTTCTGCGA
■■Homology search results ■■ -
sp_hit_id Q8VY91
Definition sp|Q8VY91|RR6_ARATH 30S ribosomal protein S6 alpha, chloroplastic OS=Arabidopsis thaliana
Align length 104
Score (bit) 113.0
E-value 9.0e-25
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= DK950723|Adiantum capillus-veneris mRNA, clone:
TST38A01NGRL0009_H03, 5'
(705 letters)

Database: uniprot_sprot.fasta
412,525 sequences; 148,809,765 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

sp|Q8VY91|RR6_ARATH 30S ribosomal protein S6 alpha, chloroplasti... 113 9e-25
sp|P82403|RR6_SPIOL 30S ribosomal protein S6 alpha, chloroplasti... 112 2e-24
sp|Q7NNH7|RS6_GLOVI 30S ribosomal protein S6 OS=Gloeobacter viol... 50 2e-05
sp|Q3MBE2|RS6_ANAVT 30S ribosomal protein S6 OS=Anabaena variabi... 49 3e-05
sp|Q8YMX2|RS6_ANASP 30S ribosomal protein S6 OS=Anabaena sp. (st... 48 6e-05
sp|Q1XDC8|RR6_PORYE 30S ribosomal protein S6, chloroplastic OS=P... 47 1e-04
sp|Q8R6M1|RS6_THETN 30S ribosomal protein S6 OS=Thermoanaerobact... 47 1e-04
sp|Q6B922|RR6_GRATL 30S ribosomal protein S6, chloroplastic OS=G... 47 1e-04
sp|Q047E8|RS6_LACGA 30S ribosomal protein S6 OS=Lactobacillus ga... 46 2e-04
sp|Q5KU69|RS6_GEOKA 30S ribosomal protein S6 OS=Geobacillus kaus... 46 2e-04
sp|Q74M28|RS6_LACJO 30S ribosomal protein S6 OS=Lactobacillus jo... 46 2e-04
sp|P51359|RR6_PORPU 30S ribosomal protein S6, chloroplastic OS=P... 45 3e-04
sp|A5GX14|RS6_SYNR3 30S ribosomal protein S6 OS=Synechococcus sp... 45 4e-04
sp|A2BZ93|RS6_PROM5 30S ribosomal protein S6 OS=Prochlorococcus ... 45 5e-04
sp|Q3AG80|RS6_SYNSC 30S ribosomal protein S6 OS=Synechococcus sp... 44 6e-04
sp|Q3AVM1|RS6_SYNS9 30S ribosomal protein S6 OS=Synechococcus sp... 44 6e-04
sp|Q7U3C1|RS6_SYNPX 30S ribosomal protein S6 OS=Synechococcus sp... 44 6e-04
sp|P48134|RR6_CYAPA 30S ribosomal protein S6, cyanelle OS=Cyanop... 44 6e-04
sp|A8YW47|RS6_LACH4 30S ribosomal protein S6 OS=Lactobacillus he... 44 8e-04
sp|Q5FN09|RS6_LACAC 30S ribosomal protein S6 OS=Lactobacillus ac... 44 8e-04
sp|Q8DJE6|RS6_THEEB 30S ribosomal protein S6 OS=Thermosynechococ... 44 0.001
sp|A5GPS8|RS6_SYNPW 30S ribosomal protein S6 OS=Synechococcus sp... 44 0.001
sp|A6Q464|RS6_NITSB 30S ribosomal protein S6 OS=Nitratiruptor sp... 44 0.001
sp|Q2JQZ7|RS6_SYNJA 30S ribosomal protein S6 OS=Synechococcus sp... 43 0.001
sp|Q7V3T1|RS6_PROMM 30S ribosomal protein S6 OS=Prochlorococcus ... 43 0.001
sp|A2CE27|RS6_PROM3 30S ribosomal protein S6 OS=Prochlorococcus ... 43 0.001
sp|Q10XV0|RS6_TRIEI 30S ribosomal protein S6 OS=Trichodesmium er... 42 0.002
sp|Q2JKZ9|RS6_SYNJB 30S ribosomal protein S6 OS=Synechococcus sp... 42 0.002
sp|Q7MQZ8|RS6_WOLSU 30S ribosomal protein S6 OS=Wolinella succin... 42 0.003
sp|A6KWD7|RS6_BACV8 30S ribosomal protein S6 OS=Bacteroides vulg... 42 0.003

>sp|Q8VY91|RR6_ARATH 30S ribosomal protein S6 alpha, chloroplastic
OS=Arabidopsis thaliana GN=RPS6 PE=2 SV=1
Length = 207

Score = 113 bits (283), Expect = 9e-25
Identities = 52/104 (50%), Positives = 72/104 (69%)
Frame = +3

Query: 123 GLRRYETTVVLRPDITEEERLAWTQRYDEAIIAGGATSVEFSNRGILPLTYSIKKKDLGG 302
GLR+YET VLRPD++E+ERL TQ+Y+E ++AGG VE NRG++PL YSI+KK+ G
Sbjct: 99 GLRQYETMAVLRPDMSEDERLGLTQKYEELLVAGGGMYVEVFNRGVIPLAYSIRKKNKAG 158

Query: 303 VARTYLDGVYMHIAYITKPQCQLDLPPRFNQDDDVIKSITMLLK 434
TYLDG+Y+ Y TKP+ + L DDD+I+S + +K
Sbjct: 159 ETNTYLDGIYLLFTYFTKPESIVPLETVLTADDDIIRSSSFKIK 202


>sp|P82403|RR6_SPIOL 30S ribosomal protein S6 alpha, chloroplastic
(Fragment) OS=Spinacia oleracea GN=RPS6 PE=1 SV=2
Length = 168

Score = 112 bits (280), Expect = 2e-24
Identities = 53/104 (50%), Positives = 71/104 (68%)
Frame = +3

Query: 123 GLRRYETTVVLRPDITEEERLAWTQRYDEAIIAGGATSVEFSNRGILPLTYSIKKKDLGG 302
GLR+YET VLRPD+TE+ERL TQ+Y+E ++AGGA VE NRG++PL YSIK+K+ G
Sbjct: 61 GLRQYETMAVLRPDMTEDERLTLTQKYEELLVAGGAMYVEVFNRGVIPLAYSIKRKNKAG 120

Query: 303 VARTYLDGVYMHIAYITKPQCQLDLPPRFNQDDDVIKSITMLLK 434
YLDG+Y+ Y TKP+ L DDDVI+S + ++
Sbjct: 121 ETNNYLDGIYLLFTYFTKPESISPLEAALVTDDDVIRSSSFKIR 164


>sp|Q7NNH7|RS6_GLOVI 30S ribosomal protein S6 OS=Gloeobacter
violaceus GN=rpsF PE=3 SV=1
Length = 96

Score = 49.7 bits (117), Expect = 2e-05
Identities = 29/98 (29%), Positives = 47/98 (47%)
Frame = +3

Query: 132 RYETTVVLRPDITEEERLAWTQRYDEAIIAGGATSVEFSNRGILPLTYSIKKKDLGGVAR 311
+YET +LRPD+T+E RY + GA VE +RG L Y +KK
Sbjct: 4 KYETMYILRPDLTDEIIDQTITRYQTLLAEQGAAPVETQHRGKRRLAYELKK-------- 55

Query: 312 TYLDGVYMHIAYITKPQCQLDLPPRFNQDDDVIKSITM 425
+ +G+Y+ + Y +L F ++VI+ +T+
Sbjct: 56 -FKEGIYVQMNYDAPTTAVAELEKAFRLSEEVIRFLTV 92


>sp|Q3MBE2|RS6_ANAVT 30S ribosomal protein S6 OS=Anabaena variabilis
(strain ATCC 29413 / PCC 7937) GN=rpsF PE=3 SV=1
Length = 108

Score = 48.5 bits (114), Expect = 3e-05
Identities = 30/97 (30%), Positives = 45/97 (46%)
Frame = +3

Query: 135 YETTVVLRPDITEEERLAWTQRYDEAIIAGGATSVEFSNRGILPLTYSIKKKDLGGVART 314
YET +LRPD+T+E+ +Y + GAT +E NRG L Y IKK+
Sbjct: 5 YETLYILRPDLTDEQVELAIAKYQNLLQEQGATDIEVQNRGKRRLAYEIKKQ-------- 56

Query: 315 YLDGVYMHIAYITKPQCQLDLPPRFNQDDDVIKSITM 425
DG Y+ Y + L ++VI+ +T+
Sbjct: 57 -RDGFYVQFNYNAPGKAIAILERAMRLSEEVIRYLTV 92


>sp|Q8YMX2|RS6_ANASP 30S ribosomal protein S6 OS=Anabaena sp.
(strain PCC 7120) GN=rpsF PE=3 SV=1
Length = 108

Score = 47.8 bits (112), Expect = 6e-05
Identities = 30/97 (30%), Positives = 45/97 (46%)
Frame = +3

Query: 135 YETTVVLRPDITEEERLAWTQRYDEAIIAGGATSVEFSNRGILPLTYSIKKKDLGGVART 314
YET +LRPD+T+E+ +Y + GAT +E NRG L Y IKK+
Sbjct: 5 YETLYILRPDLTDEQVELAIAKYQNLLQEQGATDLEVQNRGKRRLAYEIKKQ-------- 56

Query: 315 YLDGVYMHIAYITKPQCQLDLPPRFNQDDDVIKSITM 425
DG Y+ Y + L ++VI+ +T+
Sbjct: 57 -RDGFYVQFNYNAPGKAIAILERAMRLSEEVIRYLTV 92


>sp|Q1XDC8|RR6_PORYE 30S ribosomal protein S6, chloroplastic
OS=Porphyra yezoensis GN=rps6 PE=3 SV=1
Length = 109

Score = 47.0 bits (110), Expect = 1e-04
Identities = 27/99 (27%), Positives = 46/99 (46%)
Frame = +3

Query: 126 LRRYETTVVLRPDITEEERLAWTQRYDEAIIAGGATSVEFSNRGILPLTYSIKKKDLGGV 305
L YET +L+ D+ E++ L+ Y + GGA ++ +RG L+Y+I
Sbjct: 9 LNCYETVYILKSDLNEDKTLSIINDYKSMLTNGGAKNIVLQHRGRRHLSYTI-------- 60

Query: 306 ARTYLDGVYMHIAYITKPQCQLDLPPRFNQDDDVIKSIT 422
Y DG+Y+ + Y Q DD++I+ +T
Sbjct: 61 -NDYHDGIYVQVNYEGNGQLVKSFEKSLRFDDNIIRYLT 98


>sp|Q8R6M1|RS6_THETN 30S ribosomal protein S6 OS=Thermoanaerobacter
tengcongensis GN=rpsF PE=3 SV=1
Length = 95

Score = 46.6 bits (109), Expect = 1e-04
Identities = 28/96 (29%), Positives = 43/96 (44%)
Frame = +3

Query: 126 LRRYETTVVLRPDITEEERLAWTQRYDEAIIAGGATSVEFSNRGILPLTYSIKKKDLGGV 305
+R YET VL PD+ EEER +R+ I+ G F G L Y I+KK
Sbjct: 1 MRSYETMYVLSPDLNEEERKGLIERFKNLIVERGGEITNFDEWGKRKLAYPIQKKS---- 56

Query: 306 ARTYLDGVYMHIAYITKPQCQLDLPPRFNQDDDVIK 413
+G Y+ + + + P +L + D V++
Sbjct: 57 -----EGYYVLMNFNSSPDVSRELERVYRITDGVLR 87


>sp|Q6B922|RR6_GRATL 30S ribosomal protein S6, chloroplastic
OS=Gracilaria tenuistipitata var. liui GN=rps6 PE=3 SV=1
Length = 103

Score = 46.6 bits (109), Expect = 1e-04
Identities = 29/100 (29%), Positives = 44/100 (44%)
Frame = +3

Query: 126 LRRYETTVVLRPDITEEERLAWTQRYDEAIIAGGATSVEFSNRGILPLTYSIKKKDLGGV 305
L +YET +L+P+ITE E L Y I G ++ ++G L Y+IK
Sbjct: 3 LNKYETIYILQPNITESENLILINEYKALIKKYGGNNIVVQHKGRRHLNYNIK------- 55

Query: 306 ARTYLDGVYMHIAYITKPQCQLDLPPRFNQDDDVIKSITM 425
+Y DG+Y+ I Y L VI+ +T+
Sbjct: 56 --SYYDGIYVQINYTASSNLVRILEKAMRLSQHVIRYMTI 93


>sp|Q047E8|RS6_LACGA 30S ribosomal protein S6 OS=Lactobacillus
gasseri (strain ATCC 33323 / DSM 20243) GN=rpsF PE=3
SV=1
Length = 98

Score = 46.2 bits (108), Expect = 2e-04
Identities = 27/101 (26%), Positives = 52/101 (51%), Gaps = 1/101 (0%)
Frame = +3

Query: 132 RYETTVVLRPDITEEERLAWTQRYDEAIIAGGATSVEFSNRGILPLTYSIKKKDLGGVAR 311
+YE T +++PDI E+ + A R+D+ + GA +E + G Y I+K
Sbjct: 5 KYEVTYIIKPDIDEDSKKALIDRFDKVVTDNGAEELESKDWGKRRFAYEIEK-------- 56

Query: 312 TYLDGVYMHIAYITKPQCQLDLPPRFNQ-DDDVIKSITMLL 431
Y +G Y + ++ + +D R ++ D+ V++S+T+ L
Sbjct: 57 -YREGTYHIMTFVAENSEPVDEFGRLSRIDNQVLRSMTVKL 96


>sp|Q5KU69|RS6_GEOKA 30S ribosomal protein S6 OS=Geobacillus
kaustophilus GN=rpsF PE=3 SV=1
Length = 95

Score = 46.2 bits (108), Expect = 2e-04
Identities = 25/100 (25%), Positives = 49/100 (49%)
Frame = +3

Query: 126 LRRYETTVVLRPDITEEERLAWTQRYDEAIIAGGATSVEFSNRGILPLTYSIKKKDLGGV 305
+R+YE ++RP++ +E R A +R++ + GA ++ G L Y I+K
Sbjct: 1 MRKYEIMYIIRPNMDDEARQALVERFNNVLKENGAEITNVTDWGKRRLAYEIQK------ 54

Query: 306 ARTYLDGVYMHIAYITKPQCQLDLPPRFNQDDDVIKSITM 425
Y DG YM + +++P+ + +D+I+ I +
Sbjct: 55 ---YRDGYYMIVNVVSEPKAVQEFDRLARISEDIIRHIVV 91


tr_hit_id A9TXI7
Definition tr|A9TXI7|A9TXI7_PHYPA Predicted protein OS=Physcomitrella patens subsp. patens
Align length 104
Score (bit) 129.0
E-value 1.0e-28
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= DK950723|Adiantum capillus-veneris mRNA, clone:
TST38A01NGRL0009_H03, 5'
(705 letters)

Database: uniprot_trembl.fasta
7,341,751 sequences; 2,391,615,440 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

tr|A9TXI7|A9TXI7_PHYPA Predicted protein OS=Physcomitrella paten... 129 1e-28
tr|A9RRL7|A9RRL7_PHYPA Predicted protein OS=Physcomitrella paten... 129 2e-28
tr|A9NNZ1|A9NNZ1_PICSI Putative uncharacterized protein OS=Picea... 122 2e-26
tr|A9NMM3|A9NMM3_PICSI Putative uncharacterized protein OS=Picea... 122 2e-26
tr|A7QU48|A7QU48_VITVI Chromosome chr2 scaffold_176, whole genom... 115 3e-24
tr|Q75LD8|Q75LD8_ORYSJ Os03g0843400 protein OS=Oryza sativa subs... 113 1e-23
tr|A3APM6|A3APM6_ORYSJ Putative uncharacterized protein OS=Oryza... 113 1e-23
tr|A2XNY1|A2XNY1_ORYSI Putative uncharacterized protein OS=Oryza... 113 1e-23
tr|B1ST01|B1ST01_9BACI Ribosomal protein S6 OS=Geobacillus sp. W... 47 0.001
tr|A0ZMJ0|A0ZMJ0_NODSP Ribosomal protein S6 OS=Nodularia spumige... 47 0.001
tr|B1C976|B1C976_9FIRM Putative uncharacterized protein OS=Anaer... 47 0.002
tr|B7Y721|B7Y721_9BACI Ribosomal protein S6 OS=Geobacillus sp. Y... 46 0.002
tr|A6ETE1|A6ETE1_9BACT 30S ribosomal protein S6 OS=unidentified ... 46 0.003
tr|B2J6T8|B2J6T8_NOSP7 Ribosomal protein S6 OS=Nostoc punctiform... 45 0.003
tr|B7GMU9|B7GMU9_9BACI Ribosomal protein S6 OS=Anoxybacillus fla... 45 0.003
tr|B5IIU7|B5IIU7_9CHRO Ribosomal protein S6 OS=Cyanobium sp. PCC... 45 0.005
tr|B4BPI9|B4BPI9_9BACI Ribosomal protein S6 OS=Geobacillus sp. G... 45 0.005
tr|Q2LUJ8|Q2LUJ8_SYNAS SSU ribosomal protein S6P OS=Syntrophus a... 45 0.006
tr|A4ITW0|A4ITW0_GEOTN Ribosomal protein S6 (BS9) OS=Geobacillus... 45 0.006
tr|A8YA66|A8YA66_MICAE Genome sequencing data, contig C245 OS=Mi... 45 0.006
tr|B0K8G4|B0K8G4_THEP3 Ribosomal protein S6 OS=Thermoanaerobacte... 44 0.008
tr|B0K5L9|B0K5L9_THEPX Ribosomal protein S6 OS=Thermoanaerobacte... 44 0.008
tr|A3PFJ5|A3PFJ5_PROM0 30S ribosomal protein S6 OS=Prochlorococc... 44 0.008
tr|Q062E7|Q062E7_9SYNE Ribosomal protein S6 OS=Synechococcus sp.... 44 0.008
tr|Q05UX1|Q05UX1_9SYNE Ribosomal protein S6 OS=Synechococcus sp.... 44 0.010
tr|A6MVT3|A6MVT3_RHDSA Ribosomal protein S6 OS=Rhodomonas salina... 44 0.010
tr|B0JSQ9|B0JSQ9_MICAN 30S ribosomal protein S6 OS=Microcystis a... 44 0.013
tr|B2Q7R6|B2Q7R6_9BACL Ribosomal protein S6 OS=Exiguobacterium s... 44 0.013
tr|A4CWV7|A4CWV7_SYNPV 30S ribosomal protein S6 OS=Synechococcus... 44 0.013
tr|B4VU74|B4VU74_9CYAN Ribosomal protein S6 OS=Microcoleus chtho... 43 0.017

>tr|A9TXI7|A9TXI7_PHYPA Predicted protein OS=Physcomitrella patens
subsp. patens GN=PHYPADRAFT_152300 PE=4 SV=1
Length = 118

Score = 129 bits (325), Expect = 1e-28
Identities = 61/104 (58%), Positives = 77/104 (74%)
Frame = +3

Query: 123 GLRRYETTVVLRPDITEEERLAWTQRYDEAIIAGGATSVEFSNRGILPLTYSIKKKDLGG 302
GL+RYET VLRPDITE++RLA TQRY+EAIIAGG VE NRG+ PL Y+IK K++ G
Sbjct: 14 GLQRYETMTVLRPDITEDQRLALTQRYEEAIIAGGGLDVEMFNRGMQPLAYNIKTKNMAG 73

Query: 303 VARTYLDGVYMHIAYITKPQCQLDLPPRFNQDDDVIKSITMLLK 434
A YLDG+Y+ Y+TKP+ Q + R N+DDD+I+S T LK
Sbjct: 74 FANRYLDGIYLLFTYVTKPESQKTIQDRLNRDDDIIRSTTFRLK 117


>tr|A9RRL7|A9RRL7_PHYPA Predicted protein OS=Physcomitrella patens
subsp. patens GN=PHYPADRAFT_118389 PE=4 SV=1
Length = 118

Score = 129 bits (324), Expect = 2e-28
Identities = 61/104 (58%), Positives = 77/104 (74%)
Frame = +3

Query: 123 GLRRYETTVVLRPDITEEERLAWTQRYDEAIIAGGATSVEFSNRGILPLTYSIKKKDLGG 302
GL+RYET VLRPDITEE+RLA TQRY+E+IIAGG VE NRG+ PL Y+IK K++ G
Sbjct: 14 GLQRYETMTVLRPDITEEQRLALTQRYEESIIAGGGLDVEMFNRGMQPLAYNIKTKNMAG 73

Query: 303 VARTYLDGVYMHIAYITKPQCQLDLPPRFNQDDDVIKSITMLLK 434
A YLDG+Y+ Y+TKP+ Q + R N+DDD+I+S T LK
Sbjct: 74 FANRYLDGIYLLFTYVTKPESQKAIQDRLNRDDDIIRSTTFRLK 117


>tr|A9NNZ1|A9NNZ1_PICSI Putative uncharacterized protein OS=Picea
sitchensis PE=2 SV=1
Length = 206

Score = 122 bits (307), Expect = 2e-26
Identities = 60/100 (60%), Positives = 73/100 (73%)
Frame = +3

Query: 123 GLRRYETTVVLRPDITEEERLAWTQRYDEAIIAGGATSVEFSNRGILPLTYSIKKKDLGG 302
GLR YET VLRPDI+EEERLA TQRY+E I+AGG VE NRG++PL Y+IKKK+L G
Sbjct: 99 GLRDYETMAVLRPDISEEERLALTQRYEEIIVAGGGMGVEVFNRGMIPLAYAIKKKNLSG 158

Query: 303 VARTYLDGVYMHIAYITKPQCQLDLPPRFNQDDDVIKSIT 422
+ TYLDGVY+ Y TKP+ +L + DDDVI+S T
Sbjct: 159 KSNTYLDGVYLLFTYFTKPESIPELEKKLKTDDDVIRSST 198


>tr|A9NMM3|A9NMM3_PICSI Putative uncharacterized protein OS=Picea
sitchensis PE=2 SV=1
Length = 206

Score = 122 bits (307), Expect = 2e-26
Identities = 60/100 (60%), Positives = 73/100 (73%)
Frame = +3

Query: 123 GLRRYETTVVLRPDITEEERLAWTQRYDEAIIAGGATSVEFSNRGILPLTYSIKKKDLGG 302
GLR YET VLRPDI+EEERLA TQRY+E I+AGG VE NRG++PL Y+IKKK+L G
Sbjct: 99 GLRDYETMAVLRPDISEEERLALTQRYEEIIVAGGGMGVEVFNRGMIPLAYAIKKKNLSG 158

Query: 303 VARTYLDGVYMHIAYITKPQCQLDLPPRFNQDDDVIKSIT 422
+ TYLDGVY+ Y TKP+ +L + DDDVI+S T
Sbjct: 159 KSNTYLDGVYLLFTYFTKPESIPELEKKLKTDDDVIRSST 198


>tr|A7QU48|A7QU48_VITVI Chromosome chr2 scaffold_176, whole genome
shotgun sequence OS=Vitis vinifera GN=GSVIVT00006697001
PE=4 SV=1
Length = 199

Score = 115 bits (288), Expect = 3e-24
Identities = 54/104 (51%), Positives = 73/104 (70%)
Frame = +3

Query: 123 GLRRYETTVVLRPDITEEERLAWTQRYDEAIIAGGATSVEFSNRGILPLTYSIKKKDLGG 302
GLR+YET VLRPD++E+ERLA TQ+Y+E ++AGG VE NRG++PL YSIKKK+ G
Sbjct: 92 GLRQYETMAVLRPDMSEDERLALTQKYEELLVAGGGMYVEVFNRGVIPLAYSIKKKNKAG 151

Query: 303 VARTYLDGVYMHIAYITKPQCQLDLPPRFNQDDDVIKSITMLLK 434
+ TYLDG+Y+ Y TKP+ L DDDVI+S + ++
Sbjct: 152 ESNTYLDGIYLLFTYFTKPESMEVLEATLTADDDVIRSSSFKIR 195


>tr|Q75LD8|Q75LD8_ORYSJ Os03g0843400 protein OS=Oryza sativa subsp.
japonica GN=OSJNBa0032G11.6 PE=2 SV=1
Length = 219

Score = 113 bits (283), Expect = 1e-23
Identities = 56/105 (53%), Positives = 76/105 (72%), Gaps = 1/105 (0%)
Frame = +3

Query: 123 GLRRYETTVVLRPDITEEERLAWTQRYDEAIIAGGATSVEFSNRGILPLTYSIKKKD-LG 299
GLR+YET VVLRPD++EEERLA QRY+E ++AGGA VE NRG++PL YSI+K++
Sbjct: 110 GLRQYETMVVLRPDMSEEERLALIQRYEELLVAGGAMYVEVFNRGVIPLAYSIRKRNSRT 169

Query: 300 GVARTYLDGVYMHIAYITKPQCQLDLPPRFNQDDDVIKSITMLLK 434
G+ TY DG+Y+ + Y TKP+ L R N DDDVI+S + ++
Sbjct: 170 GLPSTYYDGIYLLVTYFTKPESLDALQMRLNADDDVIRSTSFKVR 214


>tr|A3APM6|A3APM6_ORYSJ Putative uncharacterized protein OS=Oryza
sativa subsp. japonica GN=OsJ_012748 PE=4 SV=1
Length = 215

Score = 113 bits (283), Expect = 1e-23
Identities = 56/105 (53%), Positives = 76/105 (72%), Gaps = 1/105 (0%)
Frame = +3

Query: 123 GLRRYETTVVLRPDITEEERLAWTQRYDEAIIAGGATSVEFSNRGILPLTYSIKKKD-LG 299
GLR+YET VVLRPD++EEERLA QRY+E ++AGGA VE NRG++PL YSI+K++
Sbjct: 106 GLRQYETMVVLRPDMSEEERLALIQRYEELLVAGGAMYVEVFNRGVIPLAYSIRKRNSRT 165

Query: 300 GVARTYLDGVYMHIAYITKPQCQLDLPPRFNQDDDVIKSITMLLK 434
G+ TY DG+Y+ + Y TKP+ L R N DDDVI+S + ++
Sbjct: 166 GLPSTYYDGIYLLVTYFTKPESLDALQMRLNADDDVIRSTSFKVR 210


>tr|A2XNY1|A2XNY1_ORYSI Putative uncharacterized protein OS=Oryza
sativa subsp. indica GN=OsI_14280 PE=4 SV=1
Length = 215

Score = 113 bits (283), Expect = 1e-23
Identities = 56/105 (53%), Positives = 76/105 (72%), Gaps = 1/105 (0%)
Frame = +3

Query: 123 GLRRYETTVVLRPDITEEERLAWTQRYDEAIIAGGATSVEFSNRGILPLTYSIKKKD-LG 299
GLR+YET VVLRPD++EEERLA QRY+E ++AGGA VE NRG++PL YSI+K++
Sbjct: 106 GLRQYETMVVLRPDMSEEERLALIQRYEELLVAGGAMYVEVFNRGVIPLAYSIRKRNSRT 165

Query: 300 GVARTYLDGVYMHIAYITKPQCQLDLPPRFNQDDDVIKSITMLLK 434
G+ TY DG+Y+ + Y TKP+ L R N DDDVI+S + ++
Sbjct: 166 GLPSTYYDGIYLLVTYFTKPESLDALQMRLNADDDVIRSTSFKVR 210


>tr|B1ST01|B1ST01_9BACI Ribosomal protein S6 OS=Geobacillus sp.
WCH70 GN=GWCH70DRAFT_2043 PE=4 SV=1
Length = 95

Score = 47.0 bits (110), Expect = 0.001
Identities = 27/100 (27%), Positives = 48/100 (48%)
Frame = +3

Query: 126 LRRYETTVVLRPDITEEERLAWTQRYDEAIIAGGATSVEFSNRGILPLTYSIKKKDLGGV 305
+R+YE ++RP++ +E R A R++ + GA ++ G L Y IKK
Sbjct: 1 MRKYEIMYIIRPNLDDEARQAVVDRFNNILKENGAEITNVTDWGKRRLAYEIKK------ 54

Query: 306 ARTYLDGVYMHIAYITKPQCQLDLPPRFNQDDDVIKSITM 425
Y DG YM + +++P+ + DD+I+ I +
Sbjct: 55 ---YRDGHYMILNVVSEPKAVQEFDRLARISDDIIRHIVV 91


>tr|A0ZMJ0|A0ZMJ0_NODSP Ribosomal protein S6 OS=Nodularia spumigena
CCY 9414 GN=N9414_06554 PE=4 SV=1
Length = 113

Score = 47.0 bits (110), Expect = 0.001
Identities = 28/97 (28%), Positives = 45/97 (46%)
Frame = +3

Query: 135 YETTVVLRPDITEEERLAWTQRYDEAIIAGGATSVEFSNRGILPLTYSIKKKDLGGVART 314
YET +LRPD+ EE+ +Y + GA ++E NRG L Y IKK
Sbjct: 5 YETIYILRPDLGEEQVEQAIAKYQGLLTEQGAENIEIQNRGKRRLAYEIKK--------- 55

Query: 315 YLDGVYMHIAYITKPQCQLDLPPRFNQDDDVIKSITM 425
+ DG+Y+ + Y + ++VI+ +T+
Sbjct: 56 HRDGIYVQMNYTGPGTAIAPMERAMRLSEEVIRYLTI 92