DK950736
Clone id TST38A01NGRL0009_H17
Library
Length 570
Definition Adiantum capillus-veneris mRNA. clone: TST38A01NGRL0009_H17. 5' end sequence.
Accession
Tissue type prothallia
Developmental stage gametophyte
Contig ID -
Sequence
TCAAGGGCCTACTGATCAGCGGAAGCTATTTTCGCAAGTGACACGACTAGGCTTTGCTTC
TGCTCACGATGCACCTGATCTGACTCCTGCAACGAGTGGTGATGTATCTGCTCCATCCCA
GGAGAAGGCTGGCAGCTCAGCTTGGCCTGGAGCCTCTGGCAAAGCGGCAACAATGTCATT
TGCGGACATCATACAGGCCCAACCATTGAAGGCTTCACCTTCTGCTACAAATGGAGCTGA
TGCGCATAGTCAGTCTGGCTCCAAGAGGAACAAGAAATCATCAAAAATATTGCTCTCAAC
AGCAGGGGGACGGCGGTATTGATTGCTTACCTTGATTTGTGTAACATCTTGTTGGCTAGC
CTCTCGTGACTGAGCAATTGTTGATGTTGAAGCAACACATCGTATGTCAAGTTTGTCTTC
TCATTTGTCAAATTTTTCCTGACAAGAATCTTAGTAGACATGTATACTAATACGGCCCCC
TCCCGCTGCCCCTTATTGTGCATCCGACCCAAAAGAGAAAAAGAAGAAGAGGTGTTCTCT
TTCTGAGTTAAAAAAAAAAAAAAAAAAAAA
■■Homology search results ■■ -
sp_hit_id Q61361
Definition sp|Q61361|PGCB_MOUSE Brevican core protein OS=Mus musculus
Align length 74
Score (bit) 35.0
E-value 0.24
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= DK950736|Adiantum capillus-veneris mRNA, clone:
TST38A01NGRL0009_H17, 5'
(549 letters)

Database: uniprot_sprot.fasta
412,525 sequences; 148,809,765 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

sp|Q61361|PGCB_MOUSE Brevican core protein OS=Mus musculus GN=Bc... 35 0.24
sp|P55068|PGCB_RAT Brevican core protein OS=Rattus norvegicus GN... 35 0.31
sp|Q7Z5P9|MUC19_HUMAN Mucin-19 OS=Homo sapiens GN=MUC19 PE=1 SV=2 34 0.53
sp|Q9VZF4|FBXW7_DROME F-box/WD repeat-containing protein 7 OS=Dr... 33 0.69
sp|Q6Z2T8|SSY22_ORYSJ Soluble starch synthase 2-2, chloroplastic... 33 0.91
sp|Q0A9E2|ZNUC_ALHEH Zinc import ATP-binding protein znuC OS=Alk... 32 1.5
sp|Q54PA8|Y2080_DICDI Uncharacterized protein DDB_G0284671 OS=Di... 32 1.5
sp|P07812|PRGR_CHICK Progesterone receptor OS=Gallus gallus GN=P... 32 1.5
sp|Q8T2I5|LYSG3_DICDI Probable GH family 25 lysozyme 3 OS=Dictyo... 32 1.5
sp|Q96GW7|PGCB_HUMAN Brevican core protein OS=Homo sapiens GN=BC... 32 2.0
sp|A4FV97|RL1D1_BOVIN Ribosomal L1 domain-containing protein 1 O... 32 2.6
sp|Q9GLW0|PRGR_CANFA Progesterone receptor OS=Canis familiaris G... 32 2.6
sp|Q68EF6|BEGIN_MOUSE Brain-enriched guanylate kinase-associated... 32 2.6
sp|Q8IVL0|NAV3_HUMAN Neuron navigator 3 OS=Homo sapiens GN=NAV3 ... 31 3.4
sp|Q05164|HPF1_YEAST Haze protective factor 1 OS=Saccharomyces c... 31 3.4
sp|O15818|EIF3X_DICDI Putative eukaryotic translation initiation... 31 3.4
sp|Q8C5N3|NCM_MOUSE Nucampholin homolog OS=Mus musculus GN=Ncm P... 31 4.5
sp|Q9CQ35|GRPL2_MOUSE GLIPR1-like protein 2 OS=Mus musculus GN=G... 31 4.6
sp|Q8R370|USBP1_MOUSE USH1C-binding protein 1 OS=Mus musculus GN... 30 5.9
sp|P27654|TIP1_YEAST Temperature shock-inducible protein 1 OS=Sa... 30 5.9
sp|Q9GLM4|TENS1_BOVIN Tensin-1 OS=Bos taurus GN=TNS1 PE=2 SV=1 30 5.9
sp|Q5XI59|RNF10_RAT RING finger protein 10 OS=Rattus norvegicus ... 30 5.9
sp|Q8NP40|IF2_CORGL Translation initiation factor IF-2 OS=Coryne... 30 5.9
sp|P46992|YJR1_YEAST Uncharacterized protein YJL171C OS=Saccharo... 30 6.0
sp|Q28062|PGCB_BOVIN Brevican core protein OS=Bos taurus GN=BCAN... 30 7.7
sp|A4QEZ2|IF2_CORGB Translation initiation factor IF-2 OS=Coryne... 30 7.7
sp|Q7Z2K8|GRIN1_HUMAN G protein-regulated inducer of neurite out... 30 7.7
sp|Q2KIS6|CP071_BOVIN Uncharacterized protein C16orf71 homolog O... 30 7.7

>sp|Q61361|PGCB_MOUSE Brevican core protein OS=Mus musculus GN=Bcan
PE=1 SV=1
Length = 883

Score = 35.0 bits (79), Expect = 0.24
Identities = 25/74 (33%), Positives = 35/74 (47%), Gaps = 5/74 (6%)
Frame = +2

Query: 50 GFASAHDAPDLTPATSGDVS-----APSQEKAGSSAWPGASGKAATMSFADIIQAQPLKA 214
G +S D P L PAT V PS+EK+G + G S +QAQP+
Sbjct: 560 GSSSLEDGPSLLPATWAPVGPRELETPSEEKSGRTVLAGTS-----------VQAQPVLP 608

Query: 215 SPSATNGADAHSQS 256
+ SA++G A + S
Sbjct: 609 TDSASHGGVAVAPS 622


>sp|P55068|PGCB_RAT Brevican core protein OS=Rattus norvegicus
GN=Bcan PE=1 SV=2
Length = 883

Score = 34.7 bits (78), Expect = 0.31
Identities = 24/74 (32%), Positives = 35/74 (47%), Gaps = 5/74 (6%)
Frame = +2

Query: 50 GFASAHDAPDLTPAT-----SGDVSAPSQEKAGSSAWPGASGKAATMSFADIIQAQPLKA 214
G +S D P L P T + +V PS+EK+G + G S +QAQP+
Sbjct: 560 GSSSLEDGPSLLPETWAPVGTREVETPSEEKSGRTVLTGTS-----------VQAQPVLP 608

Query: 215 SPSATNGADAHSQS 256
+ SA+ G A + S
Sbjct: 609 TDSASRGGVAVAPS 622


>sp|Q7Z5P9|MUC19_HUMAN Mucin-19 OS=Homo sapiens GN=MUC19 PE=1 SV=2
Length = 6254

Score = 33.9 bits (76), Expect = 0.53
Identities = 20/60 (33%), Positives = 31/60 (51%)
Frame = +2

Query: 83 TPATSGDVSAPSQEKAGSSAWPGASGKAATMSFADIIQAQPLKASPSATNGADAHSQSGS 262
TP SG+ A G + PG +G AT+S + + A + ASP A+ + S+SG+
Sbjct: 1172 TPRVSGETPA-----VGGGSTPGEAGPGATVSGSTGVSAGSITASPGASATSSESSKSGT 1226


>sp|Q9VZF4|FBXW7_DROME F-box/WD repeat-containing protein 7
OS=Drosophila melanogaster GN=ago PE=1 SV=1
Length = 1326

Score = 33.5 bits (75), Expect = 0.69
Identities = 20/87 (22%), Positives = 42/87 (48%), Gaps = 1/87 (1%)
Frame = +2

Query: 59 SAHDAPDLTPATSGDVSAPSQEKAGSSAWPGASGKA-ATMSFADIIQAQPLKASPSATNG 235
+A+ + +PA S + +AP + +S+ +S + A + D+I+ + + T G
Sbjct: 315 TANTVSNPSPAASANAAAPEEASTSNSSSTSSSALSRADIESMDLIERRDFETEQRLTGG 374

Query: 236 ADAHSQSGSKRNKKSSKILLSTAGGRR 316
+ S +NK + ++ S AGG +
Sbjct: 375 IILRTSSMVSQNKLNLSLIKSMAGGSK 401


>sp|Q6Z2T8|SSY22_ORYSJ Soluble starch synthase 2-2,
chloroplastic/amyloplastic OS=Oryza sativa subsp.
japonica GN=SSII-2 PE=2 SV=2
Length = 694

Score = 33.1 bits (74), Expect = 0.91
Identities = 24/78 (30%), Positives = 33/78 (42%)
Frame = +2

Query: 56 ASAHDAPDLTPATSGDVSAPSQEKAGSSAWPGASGKAATMSFADIIQAQPLKASPSATNG 235
A+ DAP P V A E G++ KAA D+ A+PL+A A
Sbjct: 122 ATKSDAPVSKPKVDPSVPASKAEADGNAQ--AVESKAALDKKEDVGVAEPLEAKADAGGD 179

Query: 236 ADAHSQSGSKRNKKSSKI 289
A A S + NK+S +
Sbjct: 180 AGAVSSADDSENKESGPL 197


>sp|Q0A9E2|ZNUC_ALHEH Zinc import ATP-binding protein znuC
OS=Alkalilimnicola ehrlichei (strain MLHE-1) GN=znuC
PE=3 SV=1
Length = 259

Score = 32.3 bits (72), Expect = 1.5
Identities = 15/34 (44%), Positives = 19/34 (55%)
Frame = +3

Query: 180 LRTSYRPNH*RLHLLLQMELMRIVSLAPRGTRNH 281
LR Y P H R+ L + + R + LAPRG R H
Sbjct: 84 LRVGYVPQHFRIDRNLPITVRRFMKLAPRGRRGH 117


>sp|Q54PA8|Y2080_DICDI Uncharacterized protein DDB_G0284671
OS=Dictyostelium discoideum GN=DDB_G0284671 PE=4 SV=1
Length = 305

Score = 32.3 bits (72), Expect = 1.5
Identities = 22/79 (27%), Positives = 41/79 (51%), Gaps = 3/79 (3%)
Frame = +2

Query: 86 PATSGDVSA--PSQEKAGSSAWPGASGKAATMSFADI-IQAQPLKASPSATNGADAHSQS 256
P+++G S+ PS SS+ P ++GK ++ S Q + S S T+G+ + Q+
Sbjct: 134 PSSTGKASSSGPSSTGKASSSGPSSTGKTSSSSTQTSGSQTSGSQTSGSQTSGSQSGQQT 193

Query: 257 GSKRNKKSSKILLSTAGGR 313
GS+ +S + S +G +
Sbjct: 194 GSQSGSQSGQQTSSQSGSQ 212


>sp|P07812|PRGR_CHICK Progesterone receptor OS=Gallus gallus GN=PGR
PE=1 SV=1
Length = 786

Score = 32.3 bits (72), Expect = 1.5
Identities = 30/122 (24%), Positives = 49/122 (40%), Gaps = 12/122 (9%)
Frame = +2

Query: 71 APDLTPATSGDVSAPSQEKAGSSAWPGASGKAATMSFADIIQAQPLKASPSATNGADAHS 250
A D P G PSQ + G+ WPGA +++ A + P AS + G
Sbjct: 136 AVDAGPGAPG----PSQPRPGAPLWPGAD----SLNVAVKARPGPEDASENRAPGLPGAE 187

Query: 251 QSGSKRN------------KKSSKILLSTAGGRRY*LLTLICVTSCWLASRD*AIVDVEA 394
+ G +S + G+ Y + ++ + S +LASR ++DVEA
Sbjct: 188 ERGFPERDAGPGEGGLAPAAAASPAAVEPGAGQDYLHVPILPLNSAFLASRTRQLLDVEA 247

Query: 395 TH 400
+
Sbjct: 248 AY 249


>sp|Q8T2I5|LYSG3_DICDI Probable GH family 25 lysozyme 3
OS=Dictyostelium discoideum GN=DDB_G0276439 PE=3 SV=1
Length = 480

Score = 32.3 bits (72), Expect = 1.5
Identities = 25/82 (30%), Positives = 39/82 (47%), Gaps = 2/82 (2%)
Frame = +2

Query: 59 SAHDAPDLTPATSGDVSAPSQEKAGSSAWPGASGKAATMSFADIIQAQPLKASPSATNGA 238
S++ P +SG S+ +GSS P +SG + T QPL + S +G+
Sbjct: 292 SSNSGSSNQPLSSG--SSQDSSNSGSSNQPLSSGSSQTSGQTSGSSNQPLSSGSSQDSGS 349

Query: 239 DAHSQ--SGSKRNKKSSKILLS 298
++ SQ +GS+ SS L S
Sbjct: 350 NSGSQGTTGSQSGSSSSNPLTS 371


>sp|Q96GW7|PGCB_HUMAN Brevican core protein OS=Homo sapiens GN=BCAN
PE=1 SV=2
Length = 911

Score = 32.0 bits (71), Expect = 2.0
Identities = 22/67 (32%), Positives = 33/67 (49%), Gaps = 5/67 (7%)
Frame = +2

Query: 59 SAHDAPDLTPATSG-----DVSAPSQEKAGSSAWPGASGKAATMSFADIIQAQPLKASPS 223
S+ AP L PAT ++ APS++ +G +A G S +QAQP+ + S
Sbjct: 587 SSEGAPSLLPATRAPEGTRELEAPSEDNSGRTAPAGTS-----------VQAQPVLPTDS 635

Query: 224 ATNGADA 244
A+ G A
Sbjct: 636 ASRGGVA 642


tr_hit_id Q67UM6
Definition tr|Q67UM6|Q67UM6_ORYSJ Os02g0516600 protein OS=Oryza sativa subsp. japonica
Align length 107
Score (bit) 70.9
E-value 4.0e-11
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= DK950736|Adiantum capillus-veneris mRNA, clone:
TST38A01NGRL0009_H17, 5'
(549 letters)

Database: uniprot_trembl.fasta
7,341,751 sequences; 2,391,615,440 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

tr|Q67UM6|Q67UM6_ORYSJ Os02g0516600 protein OS=Oryza sativa subs... 71 4e-11
tr|B8AIM9|B8AIM9_ORYSI Putative uncharacterized protein OS=Oryza... 71 4e-11
tr|A3A7D1|A3A7D1_ORYSJ Putative uncharacterized protein OS=Oryza... 71 4e-11
tr|A7PA30|A7PA30_VITVI Chromosome chr14 scaffold_9, whole genome... 66 1e-09
tr|B6UER3|B6UER3_MAIZE Zinc finger, C3HC4 type family protein OS... 65 2e-09
tr|Q9LSE3|Q9LSE3_ARATH Emb|CAA66822.1 OS=Arabidopsis thaliana GN... 55 2e-06
tr|Q38966|Q38966_ARATH Putative uncharacterized protein (Fragmen... 39 0.14
tr|A8TLL4|A8TLL4_9PROT Putative uncharacterized protein OS=alpha... 39 0.18
tr|B8P8V5|B8P8V5_9APHY Predicted protein OS=Postia placenta Mad-... 38 0.31
tr|Q4G1Y5|Q4G1Y5_9ARAC Tubuliform spidroin 1 (Fragment) OS=Argio... 38 0.40
tr|Q1BZ01|Q1BZ01_BURCA ATP-dependent DNA helicase RecG OS=Burkho... 37 0.52
tr|B1JVZ0|B1JVZ0_BURCC ATP-dependent DNA helicase RecG OS=Burkho... 37 0.52
tr|A0K4Q0|A0K4Q0_BURCH ATP-dependent DNA helicase RecG OS=Burkho... 37 0.52
tr|A2VSS5|A2VSS5_9BURK RecG-like helicase OS=Burkholderia cenoce... 37 0.52
tr|B0WPB5|B0WPB5_CULQU Putative uncharacterized protein OS=Culex... 37 0.52
tr|B6KDC5|B6KDC5_TOXGO WD domain, G-beta repeat-containing prote... 37 0.68
tr|A7BCS5|A7BCS5_9ACTO Putative uncharacterized protein OS=Actin... 37 0.89
tr|Q4G1W5|Q4G1W5_9ARAC Tubuliform spidroin 1 (Fragment) OS=Argio... 37 0.89
tr|Q21PD3|Q21PD3_SACD2 Cellulose-binding protein OS=Saccharophag... 36 1.5
tr|Q3TSQ8|Q3TSQ8_MOUSE Putative uncharacterized protein (Fragmen... 35 2.0
tr|Q72KP2|Q72KP2_THET2 Putative uncharacterized protein OS=Therm... 35 2.0
tr|Q4G1W3|Q4G1W3_9ARAC Tubuliform spidroin 1 (Fragment) OS=Gea h... 35 2.0
tr|Q80WT7|Q80WT7_MOUSE Brevican OS=Mus musculus GN=Bcan PE=2 SV=1 35 2.6
tr|Q3TQE9|Q3TQE9_MOUSE Putative uncharacterized protein (Fragmen... 35 2.6
tr|B7FS98|B7FS98_PHATR Predicted protein OS=Phaeodactylum tricor... 35 2.6
tr|Q4QCU1|Q4QCU1_LEIMA Putative uncharacterized protein OS=Leish... 35 2.6
tr|B6KRM3|B6KRM3_TOXGO Thrombospondin type 1 domain-containing p... 35 2.6
tr|B6KJP4|B6KJP4_TOXGO Ppg3, putative OS=Toxoplasma gondii ME49 ... 35 2.6
tr|B4J0X8|B4J0X8_DROGR GH15902 OS=Drosophila grimshawi GN=GH1590... 35 2.6
tr|A2T1P5|A2T1P5_STRPY Serum opacity factor sof49.2 (Fragment) O... 35 3.4

>tr|Q67UM6|Q67UM6_ORYSJ Os02g0516600 protein OS=Oryza sativa subsp.
japonica GN=OSJNBb0071O21.25 PE=4 SV=1
Length = 744

Score = 70.9 bits (172), Expect = 4e-11
Identities = 48/107 (44%), Positives = 61/107 (57%), Gaps = 3/107 (2%)
Frame = +2

Query: 8 PTDQRKLFSQVTRLGFASAHDAPDLTPATSGDVSAPSQEKAGSSAWPGASGKAAT--MSF 181
P +RKLFS V RLGFASA D+P L SGD++ G S G G AAT +SF
Sbjct: 651 PASERKLFSDVARLGFASAQDSPPLR-VESGDLT-------GKSESTGEQGPAATPALSF 702

Query: 182 ADIIQAQPLKASPSATNGADAHSQS-GSKRNKKSSKILLSTAGGRRY 319
A II ++ ++ N D H + K+ KK +K+LLST GGRRY
Sbjct: 703 ASII-----SSTRASDNSLDTHKPNVVGKKGKKPTKVLLSTGGGRRY 744


>tr|B8AIM9|B8AIM9_ORYSI Putative uncharacterized protein OS=Oryza
sativa subsp. indica GN=OsI_07406 PE=4 SV=1
Length = 735

Score = 70.9 bits (172), Expect = 4e-11
Identities = 48/107 (44%), Positives = 61/107 (57%), Gaps = 3/107 (2%)
Frame = +2

Query: 8 PTDQRKLFSQVTRLGFASAHDAPDLTPATSGDVSAPSQEKAGSSAWPGASGKAAT--MSF 181
P +RKLFS V RLGFASA D+P L SGD++ G S G G AAT +SF
Sbjct: 642 PASERKLFSDVARLGFASAQDSPPLR-VESGDLT-------GKSESTGEQGPAATPALSF 693

Query: 182 ADIIQAQPLKASPSATNGADAHSQS-GSKRNKKSSKILLSTAGGRRY 319
A II ++ ++ N D H + K+ KK +K+LLST GGRRY
Sbjct: 694 ASII-----SSTRASDNSLDTHKPNVVGKKGKKPTKVLLSTGGGRRY 735


>tr|A3A7D1|A3A7D1_ORYSJ Putative uncharacterized protein OS=Oryza
sativa subsp. japonica GN=OsJ_006703 PE=4 SV=1
Length = 740

Score = 70.9 bits (172), Expect = 4e-11
Identities = 48/107 (44%), Positives = 61/107 (57%), Gaps = 3/107 (2%)
Frame = +2

Query: 8 PTDQRKLFSQVTRLGFASAHDAPDLTPATSGDVSAPSQEKAGSSAWPGASGKAAT--MSF 181
P +RKLFS V RLGFASA D+P L SGD++ G S G G AAT +SF
Sbjct: 647 PASERKLFSDVARLGFASAQDSPPLR-VESGDLT-------GKSESTGEQGPAATPALSF 698

Query: 182 ADIIQAQPLKASPSATNGADAHSQS-GSKRNKKSSKILLSTAGGRRY 319
A II ++ ++ N D H + K+ KK +K+LLST GGRRY
Sbjct: 699 ASII-----SSTRASDNSLDTHKPNVVGKKGKKPTKVLLSTGGGRRY 740


>tr|A7PA30|A7PA30_VITVI Chromosome chr14 scaffold_9, whole genome
shotgun sequence OS=Vitis vinifera GN=GSVIVT00037950001
PE=4 SV=1
Length = 607

Score = 66.2 bits (160), Expect = 1e-09
Identities = 44/102 (43%), Positives = 58/102 (56%), Gaps = 1/102 (0%)
Frame = +2

Query: 17 QRKLFSQVTRLGFASAHDAPDLTPATSGDVSAPSQEKAGSSAWPGASGKAATMSFADIIQ 196
+RKLFS VT+LGFA+ HD+P L V + S A S+ S A T SFA++I
Sbjct: 514 ERKLFSNVTKLGFAAGHDSPGLKIEEVHSVHSTSM--ASDSSGVTGSRNAGTPSFANVI- 570

Query: 197 AQPLKASPSATNGADAHSQSGS-KRNKKSSKILLSTAGGRRY 319
+ + DA G+ K+ KKS++ILLSTAGGRRY
Sbjct: 571 -----SRGKSVESLDASKTIGTGKKGKKSNQILLSTAGGRRY 607


>tr|B6UER3|B6UER3_MAIZE Zinc finger, C3HC4 type family protein
OS=Zea mays PE=2 SV=1
Length = 743

Score = 65.1 bits (157), Expect = 2e-09
Identities = 43/106 (40%), Positives = 57/106 (53%), Gaps = 2/106 (1%)
Frame = +2

Query: 8 PTDQRKLFSQVTRLGFASAHDAPDLTPATSGDVSAPSQ--EKAGSSAWPGASGKAATMSF 181
P + KLFS VT LGFASA D+P L T GD + S+ G A P +SF
Sbjct: 648 PASEXKLFSDVTHLGFASAQDSPPLRLGT-GDANGQSETSRDQGPLATP-------ALSF 699

Query: 182 ADIIQAQPLKASPSATNGADAHSQSGSKRNKKSSKILLSTAGGRRY 319
A II + +A +A N + K+ KK++++LLST GGRRY
Sbjct: 700 ASIISSS--RAVTAADNSEMQKANGAGKKGKKATRVLLSTGGGRRY 743


>tr|Q9LSE3|Q9LSE3_ARATH Emb|CAA66822.1 OS=Arabidopsis thaliana
GN=At3g26730 PE=2 SV=1
Length = 772

Score = 55.5 bits (132), Expect = 2e-06
Identities = 41/101 (40%), Positives = 54/101 (53%)
Frame = +2

Query: 17 QRKLFSQVTRLGFASAHDAPDLTPATSGDVSAPSQEKAGSSAWPGASGKAATMSFADIIQ 196
+R FS VTRLGFA+ HD+P+L + +V + S S+A GA T SFA +
Sbjct: 682 ERSSFSHVTRLGFAAGHDSPNLNNEPT-NVQSSSSSSEVSNATTGARNTNIT-SFASV-- 737

Query: 197 AQPLKASPSATNGADAHSQSGSKRNKKSSKILLSTAGGRRY 319
AS + T A + G KR KK S++LLST RRY
Sbjct: 738 -----ASRTTTPMAPTVKEPG-KRGKKQSRVLLSTTSVRRY 772


>tr|Q38966|Q38966_ARATH Putative uncharacterized protein (Fragment)
OS=Arabidopsis thaliana PE=4 SV=1
Length = 191

Score = 39.3 bits (90), Expect = 0.14
Identities = 25/69 (36%), Positives = 36/69 (52%)
Frame = +2

Query: 17 QRKLFSQVTRLGFASAHDAPDLTPATSGDVSAPSQEKAGSSAWPGASGKAATMSFADIIQ 196
+R FS VTRLGFA+ HD+P+L + +V + S S+A GA T SFA +
Sbjct: 120 ERSSFSHVTRLGFAAGHDSPNLNNEPT-NVQSSSSSSEVSNATTGARNTNIT-SFASVAS 177

Query: 197 AQPLKASPS 223
+P+
Sbjct: 178 RTTTPMAPT 186


>tr|A8TLL4|A8TLL4_9PROT Putative uncharacterized protein OS=alpha
proteobacterium BAL199 GN=BAL199_24184 PE=4 SV=1
Length = 803

Score = 38.9 bits (89), Expect = 0.18
Identities = 23/68 (33%), Positives = 34/68 (50%)
Frame = +2

Query: 71 APDLTPATSGDVSAPSQEKAGSSAWPGASGKAATMSFADIIQAQPLKASPSATNGADAHS 250
AP PA + D +A Q SS+ P A+G A +S A + Q L A+P AD+H+
Sbjct: 676 APTSIPAWASDAAAAVQSAVASSSIPAAAGIAIALSIAALGVGQGLIAAPVIARVADSHA 735

Query: 251 QSGSKRNK 274
R++
Sbjct: 736 AHSVGRDR 743


>tr|B8P8V5|B8P8V5_9APHY Predicted protein OS=Postia placenta
Mad-698-R GN=POSPLDRAFT_102346 PE=4 SV=1
Length = 373

Score = 38.1 bits (87), Expect = 0.31
Identities = 31/102 (30%), Positives = 51/102 (50%), Gaps = 3/102 (2%)
Frame = +2

Query: 71 APDLTPATSGDVSAPSQEKAGSSAWPGASGKAATMSFADIIQAQPLKASPSATNGADAHS 250
+P +PA++G V +PS A + P + G T +F + P + S GA++HS
Sbjct: 153 SPAASPASNGIVPSPSSSSASDAIAPSSPG-GGTSTF-ETSGTSPAPSPSSTVVGANSHS 210

Query: 251 QSGSKRNKKS--SKILLSTAGGRRY*LLTLIC-VTSCWLASR 367
SGS NK + ++ GG LL L+C + + W++ R
Sbjct: 211 ASGSS-NKTALVGGVVGGVLGGL---LLALVCTILAFWISRR 248


>tr|Q4G1Y5|Q4G1Y5_9ARAC Tubuliform spidroin 1 (Fragment) OS=Argiope
argentata PE=2 SV=1
Length = 900

Score = 37.7 bits (86), Expect = 0.40
Identities = 25/77 (32%), Positives = 41/77 (53%)
Frame = +2

Query: 53 FASAHDAPDLTPATSGDVSAPSQEKAGSSAWPGASGKAATMSFADIIQAQPLKASPSATN 232
FASA A + A+S + SQ +A +SA+ A+ ++A+ S A + S+T+
Sbjct: 15 FASALSASAASVASSSAAQSASQSQAAASAFSRAASQSASQSAARSGAQSSSTTTTSSTS 74

Query: 233 GADAHSQSGSKRNKKSS 283
G+ A SQS S ++S
Sbjct: 75 GSQAASQSASSSASQAS 91



Score = 37.7 bits (86), Expect = 0.40
Identities = 25/77 (32%), Positives = 41/77 (53%)
Frame = +2

Query: 53 FASAHDAPDLTPATSGDVSAPSQEKAGSSAWPGASGKAATMSFADIIQAQPLKASPSATN 232
FASA A + A+S + SQ +A +SA+ A+ ++A+ S A + S+T+
Sbjct: 555 FASALSASAASVASSSAAQSASQSQAAASAFSRAASQSASQSAARSGAQSSSTTTTSSTS 614

Query: 233 GADAHSQSGSKRNKKSS 283
G+ A SQS S ++S
Sbjct: 615 GSQAASQSASSSASQAS 631



Score = 36.6 bits (83), Expect = 0.89
Identities = 24/77 (31%), Positives = 41/77 (53%)
Frame = +2

Query: 53 FASAHDAPDLTPATSGDVSAPSQEKAGSSAWPGASGKAATMSFADIIQAQPLKASPSATN 232
FASA A + A+S + +Q +A +SA+ A+ ++A+ S A + S+T+
Sbjct: 375 FASALSASAASVASSSAAQSATQSQAAASAFSRAASQSASQSAARSGAQSSSTTTTSSTS 434

Query: 233 GADAHSQSGSKRNKKSS 283
G+ A SQS S ++S
Sbjct: 435 GSQAASQSASSSASQAS 451