DK950760
Clone id TST38A01NGRL0009_I18
Library
Length 605
Definition Adiantum capillus-veneris mRNA. clone: TST38A01NGRL0009_I18. 5' end sequence.
Accession
Tissue type prothallia
Developmental stage gametophyte
Contig ID -
Sequence
CTCTTTTCTTGTTTACAATCCTTTAACAAAGTCCTGCAGTGCCCTCACTCCAAAGAGAAG
GGGTACTGGCTTGGACAAGGACAAGGTTTGGGTGGTAACGGATGAATCTGAGGGTTTCAT
AATAGTGGTTGTCAGAGAAAGCGGGCGATGTGAGGTGTATGATTCTTTCAACAATCAGTG
GAGCAAACCTGGGTGGCTCCCTCATAATGTCTCTCTCTCTCAAGAATCCTTTCAACCTGC
AAGAAGTGTGGCAAGTGATGGGACACTTTATTTGATTGTCGGACCACCGTACGATGTGGT
AGCATATGATACGATAACAGGGTCTTGGAGTAGGCTCTATTTGCAGTGGCCGGAGCAATC
ATGGGATCACGTTCTTTCAGAAGACAGGGGCCGCATCTATCTGCTTGCTTTTCATAGGGA
GAAGGACACACTTCTCTTTTCTGAATGGGAACTTCACTCAGCAACAAGGTTGTGGGTGAA
AGTGGAGACAATGCCCTCGCTGTTTTGTCTAGAGCCGTATGCTGGCTCAAACAAAAAATG
GCAGCTCCAAAGCTTTGCTAACCGTAATCTGGTGCTTTTACAGTTTACTTATGACAGCTC
AAATC
■■Homology search results ■■ -
sp_hit_id Q9FZK1
Definition sp|Q9FZK1|FBX6_ARATH F-box only protein 6 OS=Arabidopsis thaliana
Align length 196
Score (bit) 95.9
E-value 1.0e-19
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= DK950760|Adiantum capillus-veneris mRNA, clone:
TST38A01NGRL0009_I18, 5'
(605 letters)

Database: uniprot_sprot.fasta
412,525 sequences; 148,809,765 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

sp|Q9FZK1|FBX6_ARATH F-box only protein 6 OS=Arabidopsis thalian... 96 1e-19
sp|Q9LFV5|FK111_ARATH F-box/Kelch-repeat protein At5g15710 OS=Ar... 42 0.002
sp|Q9CAG8|FBK28_ARATH F-box/Kelch-repeat protein At1g67480 OS=Ar... 41 0.004
sp|Q9FHS6|FK119_ARATH F-box/Kelch-repeat protein At5g43190 OS=Ar... 38 0.035
sp|Q39090|UFO_ARATH Protein UNUSUAL FLORAL ORGANS OS=Arabidopsis... 37 0.060
sp|Q9LPW4|FB7_ARATH Putative F-box protein At1g12855 OS=Arabidop... 37 0.10
sp|Q9SAF4|FBK3_ARATH Putative F-box/Kelch-repeat protein At1g132... 35 0.39
sp|O33062|SERC_MYCLE Putative phosphoserine aminotransferase OS=... 33 0.86
sp|Q56A24|KLH24_RAT Kelch-like protein 24 OS=Rattus norvegicus G... 32 2.5
sp|Q8BRG6|KLH24_MOUSE Kelch-like protein 24 OS=Mus musculus GN=K... 32 2.5
sp|Q6TFL4|KLH24_HUMAN Kelch-like protein 24 OS=Homo sapiens GN=K... 32 2.5
sp|A1TF55|SERC_MYCVP Putative phosphoserine aminotransferase OS=... 31 4.3
sp|Q13635|PTC1_HUMAN Protein patched homolog 1 OS=Homo sapiens G... 31 4.3
sp|P79815|TRFE_ONCKI Serotransferrin OS=Oncorhynchus kisutch GN=... 31 5.6
sp|O59894|PEX7_PICPA Peroxisomal targeting signal 2 receptor OS=... 31 5.6
sp|Q05937|STP3_YEAST Zinc finger protein STP3 OS=Saccharomyces c... 30 7.3
sp|P32373|PYHD_NPVHC Polyhedrin OS=Hyphantria cunea nuclear poly... 30 7.3
sp|Q4FPY8|GLMU_PSYA2 Bifunctional protein glmU OS=Psychrobacter ... 30 7.3
sp|P63514|SERC_MYCTU Putative phosphoserine aminotransferase OS=... 30 9.5
sp|P63515|SERC_MYCBO Putative phosphoserine aminotransferase OS=... 30 9.5
sp|Q1Q830|GLMU_PSYCK Bifunctional protein glmU OS=Psychrobacter ... 30 9.5
sp|P0A9S3|GATD_ECOLI Galactitol-1-phosphate 5-dehydrogenase OS=E... 30 9.5
sp|P0A9S4|GATD_ECO57 Galactitol-1-phosphate 5-dehydrogenase OS=E... 30 9.5

>sp|Q9FZK1|FBX6_ARATH F-box only protein 6 OS=Arabidopsis thaliana
GN=FBX6 PE=2 SV=1
Length = 467

Score = 95.9 bits (237), Expect = 1e-19
Identities = 60/196 (30%), Positives = 96/196 (48%), Gaps = 3/196 (1%)
Frame = +2

Query: 2 SFLVYNPLTKSCSALTPKRRGTGLDKDKVWVVTD---ESEGFIIVVVRESGRCEVYDSFN 172
+F V NPLTKS L P R + V + + S G+ ++ V G EVYDS +
Sbjct: 224 NFYVSNPLTKSFREL-PARSFKVWSRVAVGMTLNGNSTSHGYKVLWVGCEGEYEVYDSLS 282

Query: 173 NQWSKPGWLPHNVSLSQESFQPARSVASDGTLYLIVGPPYDVVAYDTITGSWSRLYLQWP 352
N W+K G +P N+ L ++ VA TLY ++ P +++YD ++G W + + P
Sbjct: 283 NVWTKRGTIPSNIKLPVLLNFKSQPVAIHSTLYFMLTDPEGILSYDMVSGKWKQFIIPGP 342

Query: 353 EQSWDHVLSEDRGRIYLLAFHREKDTLLFSEWELHSATRLWVKVETMPSLFCLEPYAGSN 532
DH L+ R+ L+ + WEL T LW +V+ MP+++CLE Y
Sbjct: 343 PDLSDHTLAACGERLMLVGLLTKNAATCVCIWELQKMTLLWKEVDRMPNIWCLEFY---G 399

Query: 533 KKWQLQSFANRNLVLL 580
K ++ N+ ++L
Sbjct: 400 KHIRMNCLGNKGCLIL 415


>sp|Q9LFV5|FK111_ARATH F-box/Kelch-repeat protein At5g15710
OS=Arabidopsis thaliana GN=At5g15710 PE=2 SV=1
Length = 448

Score = 42.0 bits (97), Expect = 0.002
Identities = 42/171 (24%), Positives = 72/171 (42%), Gaps = 8/171 (4%)
Frame = +2

Query: 8 LVYNPLTKSCSALTPKRRGTGLDKDKVWVVTDESEGFIIVVVRE-----SGRCEVYDSFN 172
LV NPL +S L + + VV + F ++ + S EVYDS
Sbjct: 216 LVCNPLMQSWRTLPSMHYNQ--QRQLIMVVDRSDKSFKVIATSDIYGDKSLPTEVYDSKT 273

Query: 173 NQWSKPGWLPH-NVSLSQESFQPARSVASDGTLYLIVGPPYDVVAYDTITGSWSRLYLQW 349
++WS +P N+ S+ ++ D LYL P ++ Y +G W + ++
Sbjct: 274 DKWSLHQIMPAVNLCSSKMAY-------CDSRLYLETLSPLGLMMYRLDSGQWEHIPAKF 326

Query: 350 PEQSWD-HVLSEDRGRIYLLAFHREKDTLLFSE-WELHSATRLWVKVETMP 496
P D ++++ + R++L+ TL WEL WV++ MP
Sbjct: 327 PRSLLDGYLVAGTQKRLFLVGRIGLYSTLQSMRIWELDHTKVSWVEISRMP 377


>sp|Q9CAG8|FBK28_ARATH F-box/Kelch-repeat protein At1g67480
OS=Arabidopsis thaliana GN=At1g67480 PE=2 SV=1
Length = 376

Score = 41.2 bits (95), Expect = 0.004
Identities = 47/179 (26%), Positives = 68/179 (37%), Gaps = 22/179 (12%)
Frame = +2

Query: 23 LTKSCSALTPKRRGTGLDKD-KVWVVTDESEGFIIVVVRESGRCEVY--------DSFNN 175
+ K C AL P+ R + K W +S+ FI V R +G E + +N
Sbjct: 47 VAKQCLALVPRARFPSMGSVCKKWRFVVQSKEFI-TVRRLAGMLEEWLYVLTMNAGGKDN 105

Query: 176 QWSKPGWLPHNVSLSQESFQPARS----VASDGTLYLIVG---------PPYDVVAYDTI 316
+W L +S PA++ V DG L +I G DV YDT
Sbjct: 106 RWEVMDCLGQKLSSLPPMPGPAKTGFKVVVVDGKLLVIAGCCMINGSLVASADVYQYDTC 165

Query: 317 TGSWSRLYLQWPEQSWDHVLSEDRGRIYLLAFHREKDTLLFSEWELHSATRLWVKVETM 493
SWSRL +D +E G +Y++ H L S T W +E++
Sbjct: 166 LNSWSRL-ADLEVARYDFACAEVNGHVYVVGGHGVDGESLSSAEVYDPETCTWTFIESL 223


>sp|Q9FHS6|FK119_ARATH F-box/Kelch-repeat protein At5g43190
OS=Arabidopsis thaliana GN=At5g43190 PE=2 SV=1
Length = 403

Score = 38.1 bits (87), Expect = 0.035
Identities = 40/183 (21%), Positives = 76/183 (41%), Gaps = 14/183 (7%)
Frame = +2

Query: 2 SFLVYNPLTKSCSALTPKRRGTGLDKDKVWVVTDESEGFIIVVVRESGRCE-----VYDS 166
S ++NPLT+S ++ K + + +VT I + S +YDS
Sbjct: 156 SLSIFNPLTRSSRSI--KLPCYPFPFELLSLVTSPKGYKIFTLCSSSSAASSRSVCLYDS 213

Query: 167 FNNQWSKPGWLPHNV--SLSQESFQPARSVASDGTLYLIVGPPYDVVAYDTITGSWSR-- 334
+ W K G + + +Q+ V +G+LY P+ +V+ D G W+
Sbjct: 214 GDRSWRKFGGVDQVLPRGFNQDG------VFYNGSLYFARSEPFLIVSVDLNDGKWTTAT 267

Query: 335 ---LYLQWPEQSWDHVLSEDRGRIYLLAFHREKDTLLFSE--WELHSATRLWVKVETMPS 499
++ E ++ ++S+ +I + + + S WE T W++VET+P
Sbjct: 268 GDGVFPADDEITFARLVSDPEKKILYMVGGIGSNGICRSIKIWEFKEETESWIEVETLPD 327

Query: 500 LFC 508
+ C
Sbjct: 328 IVC 330


>sp|Q39090|UFO_ARATH Protein UNUSUAL FLORAL ORGANS OS=Arabidopsis
thaliana GN=UFO PE=1 SV=2
Length = 442

Score = 37.4 bits (85), Expect = 0.060
Identities = 44/179 (24%), Positives = 68/179 (37%), Gaps = 14/179 (7%)
Frame = +2

Query: 2 SFLVYNPLTKSCSALTPKRR-----GTGLDKDKVWV-VTDESEGFIIVVVRESGRCEVYD 163
+ L+ NPL S S L P R GL + VT + I ++ E +
Sbjct: 172 TILLCNPLVGSVSQLPPISRPRLFPSIGLSVTPTSIDVTVAGDDLISPYAVKNLSSESFH 231

Query: 164 ----SFNNQWSKPGWLPHNVSLSQESFQPARSVASDGTLYLIVGPPYDVVAYDTITGSWS 331
F + W+ LP SL + + V G Y + P+ V++Y+ W
Sbjct: 232 VDAGGFFSLWAMTSSLPRLCSL-----ESGKMVYVQGKFYCMNYSPFSVLSYEVTGNRWI 286

Query: 332 RLYLQWPEQSWDHVLSEDRGRIYLLAFHREKDTLLFSE----WELHSATRLWVKVETMP 496
++ L E +GR+ L+A EK L + W L WV++E MP
Sbjct: 287 KIQAPMRRFLRSPSLLESKGRLILVAAV-EKSKLNVPKSLRLWSLQQDNATWVEIERMP 344


>sp|Q9LPW4|FB7_ARATH Putative F-box protein At1g12855 OS=Arabidopsis
thaliana GN=At1g12855 PE=4 SV=1
Length = 462

Score = 36.6 bits (83), Expect = 0.10
Identities = 39/129 (30%), Positives = 52/129 (40%), Gaps = 8/129 (6%)
Frame = +2

Query: 146 RCEVYDSFNNQWSKPGWLPHNVSLSQESFQPARSVASDGTLYLIVGP---PYDVVAYDTI 316
+CEV+D N W P S F A++G++Y P VVA D
Sbjct: 265 KCEVFDFRANAWRYLTCTP-----SYRIFPDQVPAATNGSIYWFTEPYNGEIKVVALDIH 319

Query: 317 TGSWSRLYLQWP---EQSWDHV--LSEDRGRIYLLAFHREKDTLLFSEWELHSATRLWVK 481
T ++ L P DH+ + D G L RE DTL+ W L S+ W K
Sbjct: 320 TETFRVLPKINPAIASSDPDHIDMCTLDNG---LCMSKRESDTLVQEIWRLKSSEDSWEK 376

Query: 482 VETMPSLFC 508
V T+ L C
Sbjct: 377 VYTIDLLSC 385


>sp|Q9SAF4|FBK3_ARATH Putative F-box/Kelch-repeat protein At1g13200
OS=Arabidopsis thaliana GN=At1g13200 PE=4 SV=1
Length = 435

Score = 34.7 bits (78), Expect = 0.39
Identities = 30/126 (23%), Positives = 53/126 (42%), Gaps = 5/126 (3%)
Frame = +2

Query: 146 RCEVYDSFNNQWSKPGWLPHNVSLSQESFQPARSVASDGTLYLIVGP---PYDVVAYDTI 316
+CE++D N W P S + F + +++G++Y P +VVA+D
Sbjct: 239 KCEIFDFRKNAWRYLACTP-----SHQIFYYQKPASANGSVYWFTEPYNERIEVVAFDIQ 293

Query: 317 TGSWSRLYLQWPEQSWDHVLSEDRGRI--YLLAFHREKDTLLFSEWELHSATRLWVKVET 490
T ++ L P + D + L REKDT++ W L + W K+ +
Sbjct: 294 TETFRLLPKINPAIAGSDPHHIDMCTLDNSLCMSKREKDTMIQDIWRLKPSEDTWEKIFS 353

Query: 491 MPSLFC 508
+ + C
Sbjct: 354 IDLVSC 359


>sp|O33062|SERC_MYCLE Putative phosphoserine aminotransferase
OS=Mycobacterium leprae GN=serC PE=3 SV=1
Length = 376

Score = 33.5 bits (75), Expect = 0.86
Identities = 31/111 (27%), Positives = 47/111 (42%), Gaps = 3/111 (2%)
Frame = +2

Query: 29 KSCSALTPKRRGTGLDKDKVWVVTDESEGFIIVVVRESGRCEVYDSFNNQWSKPGWLPHN 208
KS PK G W + S G + V R +G + + S G LP +
Sbjct: 129 KSDPGSAPKPTGDPSVDVIAWAHNETSTGVAVPVRRPTGSGGALIAIDAT-SGAGGLPVD 187

Query: 209 VSLSQES-FQPARSVASDGTLYLIVGPPYDVVAYDTIT--GSWSRLYLQWP 352
++ + F P ++ ASDG L+L + P + D+IT G W +L P
Sbjct: 188 IAQTDAYYFAPQKNFASDGGLWLAIMSPAALARVDSITASGRWVPDFLSLP 238


>sp|Q56A24|KLH24_RAT Kelch-like protein 24 OS=Rattus norvegicus
GN=Klhl24 PE=1 SV=1
Length = 600

Score = 32.0 bits (71), Expect = 2.5
Identities = 21/65 (32%), Positives = 32/65 (49%), Gaps = 6/65 (9%)
Frame = +2

Query: 152 EVYDSFNNQWSKPGWLPHNVSLSQESFQPARSVASDGTLYLIVGPPYD------VVAYDT 313
E YDSF+N+W++ V+ +E+ + G L++I G P D V +YD
Sbjct: 425 ECYDSFSNRWTE-------VAPLKEAVSSPAVTSCIGKLFVIGGGPDDNTCSDKVQSYDP 477

Query: 314 ITGSW 328
T SW
Sbjct: 478 ETNSW 482


>sp|Q8BRG6|KLH24_MOUSE Kelch-like protein 24 OS=Mus musculus
GN=Klhl24 PE=2 SV=2
Length = 600

Score = 32.0 bits (71), Expect = 2.5
Identities = 21/65 (32%), Positives = 32/65 (49%), Gaps = 6/65 (9%)
Frame = +2

Query: 152 EVYDSFNNQWSKPGWLPHNVSLSQESFQPARSVASDGTLYLIVGPPYD------VVAYDT 313
E YDSF+N+W++ V+ +E+ + G L++I G P D V +YD
Sbjct: 425 ECYDSFSNRWTE-------VAPLKEAVSSPAVTSCIGKLFVIGGGPDDNTCSDKVQSYDP 477

Query: 314 ITGSW 328
T SW
Sbjct: 478 ETNSW 482


tr_hit_id A9NRM5
Definition tr|A9NRM5|A9NRM5_PICSI Putative uncharacterized protein OS=Picea sitchensis
Align length 211
Score (bit) 108.0
E-value 2.0e-22
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= DK950760|Adiantum capillus-veneris mRNA, clone:
TST38A01NGRL0009_I18, 5'
(605 letters)

Database: uniprot_trembl.fasta
7,341,751 sequences; 2,391,615,440 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

tr|A9NRM5|A9NRM5_PICSI Putative uncharacterized protein OS=Picea... 108 2e-22
tr|A7QP47|A7QP47_VITVI Chromosome chr1 scaffold_136, whole genom... 105 2e-21
tr|A5BZT8|A5BZT8_VITVI Putative uncharacterized protein OS=Vitis... 105 2e-21
tr|B6DXL9|B6DXL9_MALDO Fbox protein OS=Malus domestica PE=2 SV=1 105 2e-21
tr|B6U651|B6U651_MAIZE F-box domain containing protein OS=Zea ma... 104 3e-21
tr|B8Y9B5|B8Y9B5_PONTR F-box family protein OS=Poncirus trifolia... 104 5e-21
tr|Q5JJQ2|Q5JJQ2_ORYSJ cDNA, clone: J065176G22, full insert sequ... 102 2e-20
tr|Q0JGH1|Q0JGH1_ORYSJ Os01g0923900 protein OS=Oryza sativa subs... 102 2e-20
tr|A3A125|A3A125_ORYSJ Putative uncharacterized protein OS=Oryza... 102 2e-20
tr|A2WYI6|A2WYI6_ORYSI Putative uncharacterized protein OS=Oryza... 102 2e-20
tr|Q70JS1|Q70JS1_WHEAT Putative F-box protein (Fragment) OS=Trit... 101 4e-20
tr|A9SDY4|A9SDY4_PHYPA Predicted protein (Fragment) OS=Physcomit... 69 2e-10
tr|B4FG30|B4FG30_MAIZE Putative uncharacterized protein OS=Zea m... 66 1e-09
tr|B2CTL4|B2CTL4_ARATH At1g27340 (Fragment) OS=Arabidopsis thali... 64 7e-09
tr|B2CTJ1|B2CTJ1_ARATH At1g27340 (Fragment) OS=Arabidopsis thali... 64 7e-09
tr|A9U4F8|A9U4F8_PHYPA Predicted protein OS=Physcomitrella paten... 62 2e-08
tr|A9RPC5|A9RPC5_PHYPA Predicted protein OS=Physcomitrella paten... 60 1e-07
tr|A9T141|A9T141_PHYPA Predicted protein OS=Physcomitrella paten... 57 6e-07
tr|A9TN76|A9TN76_PHYPA Predicted protein OS=Physcomitrella paten... 57 8e-07
tr|A9TY82|A9TY82_PHYPA Predicted protein OS=Physcomitrella paten... 56 1e-06
tr|A9TB91|A9TB91_PHYPA Predicted protein OS=Physcomitrella paten... 56 2e-06
tr|B8LS03|B8LS03_PICSI Putative uncharacterized protein OS=Picea... 53 2e-05
tr|A9SK59|A9SK59_PHYPA Predicted protein (Fragment) OS=Physcomit... 52 3e-05
tr|A9SDA0|A9SDA0_PHYPA Predicted protein OS=Physcomitrella paten... 52 4e-05
tr|A9SR45|A9SR45_PHYPA Predicted protein OS=Physcomitrella paten... 49 2e-04
tr|A9TDG3|A9TDG3_PHYPA Predicted protein OS=Physcomitrella paten... 48 5e-04
tr|A7PAG5|A7PAG5_VITVI Chromosome chr14 scaffold_9, whole genome... 47 7e-04
tr|Q1KUZ9|Q1KUZ9_9ROSI Putative uncharacterized protein OS=Cleom... 47 9e-04
tr|B8LMU8|B8LMU8_PICSI Putative uncharacterized protein OS=Picea... 47 9e-04
tr|A9RIS8|A9RIS8_PHYPA Predicted protein OS=Physcomitrella paten... 47 9e-04

>tr|A9NRM5|A9NRM5_PICSI Putative uncharacterized protein OS=Picea
sitchensis PE=2 SV=1
Length = 274

Score = 108 bits (271), Expect = 2e-22
Identities = 68/211 (32%), Positives = 109/211 (51%), Gaps = 10/211 (4%)
Frame = +2

Query: 2 SFLVYNPLTKSCSALTPKRRGTGLDKDKVWVVTDESE-GFIIVVVRESGRCEVYDSFNNQ 178
+F V NPLT+S L P R + V ++ + + G+ ++ + +G EVYDS N
Sbjct: 34 NFYVCNPLTQSFQEL-PSRSVRVWSRVAVGMILNPNGVGYKLLWLGCAGDYEVYDSIENA 92

Query: 179 WSKPGWLPHNVSLSQESFQPARSVASDGTLYLIVGPPYDVVAYDTITGSWSRLYLQWPEQ 358
W++PG +P ++ L ++++ DG +Y + P +V+YDT+ G+W +L + P
Sbjct: 93 WTRPGNMPSHIKLPLALNFRSQAITIDGVMYFMRTNPDGLVSYDTMNGTWQQLSIPSPLH 152

Query: 359 SWDHVLSEDRGRIYLLAFHREKDTLLFSEWELHSATRLWVKVETMPSLFCLEPYAGSNKK 538
S DH L+E +GRI L+ + WEL T LW +V+ MP++ CLE Y K+
Sbjct: 153 SMDHTLAECKGRIMLVGLLTKNAATCVCIWELQKMTLLWKEVDRMPNMMCLEFY---GKQ 209

Query: 539 WQLQSFANRNLVLLQF---------TYDSSN 604
++ N+ LVLL YD SN
Sbjct: 210 VRMTCLGNKGLVLLSLRSRQLNRLVIYDMSN 240


>tr|A7QP47|A7QP47_VITVI Chromosome chr1 scaffold_136, whole genome
shotgun sequence OS=Vitis vinifera GN=GSVIVT00002798001
PE=4 SV=1
Length = 460

Score = 105 bits (263), Expect = 2e-21
Identities = 65/196 (33%), Positives = 102/196 (52%), Gaps = 3/196 (1%)
Frame = +2

Query: 2 SFLVYNPLTKSCSALTPKRRGTGLDKDKVWVVTDESE---GFIIVVVRESGRCEVYDSFN 172
+F V NPLT+S L P R + V + + + G+ I+ V G EVYDS
Sbjct: 217 NFFVCNPLTQSFKEL-PARSVRVWSRVAVGMTLNGNSTTAGYKILWVGCDGEYEVYDSVK 275

Query: 173 NQWSKPGWLPHNVSLSQESFQPARSVASDGTLYLIVGPPYDVVAYDTITGSWSRLYLQWP 352
N W++PG +P +V L +++V+ DGT+YL+ P +V+YD +TG+W + + P
Sbjct: 276 NSWARPGSMPLHVKLPLSLNFLSQAVSIDGTIYLMRSDPDGIVSYDMVTGAWKQFIIPAP 335

Query: 353 EQSWDHVLSEDRGRIYLLAFHREKDTLLFSEWELHSATRLWVKVETMPSLFCLEPYAGSN 532
DH L+E GRI L+ + WEL LW +V+ MP+++CLE Y
Sbjct: 336 LHLTDHTLAECGGRIMLVGLLTKNAATCVCIWELQKMMLLWKEVDRMPNIWCLEFY---G 392

Query: 533 KKWQLQSFANRNLVLL 580
K ++ N+ L++L
Sbjct: 393 KHVRMTCLGNKGLLML 408


>tr|A5BZT8|A5BZT8_VITVI Putative uncharacterized protein OS=Vitis
vinifera GN=VITISV_001738 PE=4 SV=1
Length = 396

Score = 105 bits (263), Expect = 2e-21
Identities = 65/196 (33%), Positives = 102/196 (52%), Gaps = 3/196 (1%)
Frame = +2

Query: 2 SFLVYNPLTKSCSALTPKRRGTGLDKDKVWVVTDESE---GFIIVVVRESGRCEVYDSFN 172
+F V NPLT+S L P R + V + + + G+ I+ V G EVYDS
Sbjct: 153 NFFVCNPLTQSFKEL-PARSVRVWSRVAVGMTLNGNSTTAGYKILWVGCDGEYEVYDSVK 211

Query: 173 NQWSKPGWLPHNVSLSQESFQPARSVASDGTLYLIVGPPYDVVAYDTITGSWSRLYLQWP 352
N W++PG +P +V L +++V+ DGT+YL+ P +V+YD +TG+W + + P
Sbjct: 212 NSWARPGSMPLHVKLPLSLNFLSQAVSIDGTIYLMRSDPDGIVSYDMVTGAWKQFIIPAP 271

Query: 353 EQSWDHVLSEDRGRIYLLAFHREKDTLLFSEWELHSATRLWVKVETMPSLFCLEPYAGSN 532
DH L+E GRI L+ + WEL LW +V+ MP+++CLE Y
Sbjct: 272 LHLTDHTLAECGGRIMLVGLLTKNAATCVCIWELQKMMLLWKEVDRMPNIWCLEFY---G 328

Query: 533 KKWQLQSFANRNLVLL 580
K ++ N+ L++L
Sbjct: 329 KHVRMTCLGNKGLLML 344


>tr|B6DXL9|B6DXL9_MALDO Fbox protein OS=Malus domestica PE=2 SV=1
Length = 472

Score = 105 bits (262), Expect = 2e-21
Identities = 65/199 (32%), Positives = 99/199 (49%), Gaps = 6/199 (3%)
Frame = +2

Query: 2 SFLVYNPLTKSCSALTPK------RRGTGLDKDKVWVVTDESEGFIIVVVRESGRCEVYD 163
+F V NPL +S L + R G+ ++ + S G+ I+ V G EVYD
Sbjct: 230 NFYVCNPLNQSFKELPARSVKVWSRIAVGMTLNR----SSASGGYKILWVVCDGEYEVYD 285

Query: 164 SFNNQWSKPGWLPHNVSLSQESFQPARSVASDGTLYLIVGPPYDVVAYDTITGSWSRLYL 343
S N W++PG +P V L +++V+ DGTLY + P +V+YD TG W + +
Sbjct: 286 SVTNSWTRPGIMPSGVKLPLSLNFRSQAVSIDGTLYFMRSDPEGIVSYDMATGIWKQFII 345

Query: 344 QWPEQSWDHVLSEDRGRIYLLAFHREKDTLLFSEWELHSATRLWVKVETMPSLFCLEPYA 523
P DH L+E GRI L+ + WEL T LW +V+ MP+++CLE Y
Sbjct: 346 PTPLHLTDHTLAECGGRIMLVGLLSKNAVTCVCIWELQKMTLLWKEVDRMPNIWCLEFY- 404

Query: 524 GSNKKWQLQSFANRNLVLL 580
K ++ N+ L++L
Sbjct: 405 --GKHVRMTCLGNKGLLML 421


>tr|B6U651|B6U651_MAIZE F-box domain containing protein OS=Zea mays
PE=2 SV=1
Length = 443

Score = 104 bits (260), Expect = 3e-21
Identities = 63/196 (32%), Positives = 99/196 (50%), Gaps = 3/196 (1%)
Frame = +2

Query: 2 SFLVYNPLTKSCSALTPKRRGTGLDKDKVWVVTD---ESEGFIIVVVRESGRCEVYDSFN 172
+F + NPLT+S + P R G + V +V + S+G+ ++ + G CEVYDS
Sbjct: 201 NFYICNPLTQSLKEIPP-RSVHGWSRVVVGMVLNGRSSSDGYKVMWLDIDGTCEVYDSTK 259

Query: 173 NQWSKPGWLPHNVSLSQESFQPARSVASDGTLYLIVGPPYDVVAYDTITGSWSRLYLQWP 352
N WS PG P ++ L ++ VA +Y + P V++YD TG W + + P
Sbjct: 260 NVWSCPGTFPPSIKLPLALNLRSQPVAVGSMIYFMCAEPDGVLSYDVSTGIWRQFAIPLP 319

Query: 353 EQSWDHVLSEDRGRIYLLAFHREKDTLLFSEWELHSATRLWVKVETMPSLFCLEPYAGSN 532
DH L+E +GR+ L+ + WEL T LW +V+ MP+L+CLE Y
Sbjct: 320 LHLTDHTLAEFQGRVMLVGLLCKNAATCICIWELQKMTLLWKEVDRMPNLWCLEFY---G 376

Query: 533 KKWQLQSFANRNLVLL 580
K +++ N L++L
Sbjct: 377 KHMKMKCLGNSGLLML 392


>tr|B8Y9B5|B8Y9B5_PONTR F-box family protein OS=Poncirus trifoliata
PE=2 SV=1
Length = 468

Score = 104 bits (259), Expect = 5e-21
Identities = 63/196 (32%), Positives = 100/196 (51%), Gaps = 3/196 (1%)
Frame = +2

Query: 2 SFLVYNPLTKSCSALTPKRRGTGLDKDKVWVVTD---ESEGFIIVVVRESGRCEVYDSFN 172
+F V NPLT+S L P R + V + + S G+ I+ V G E+YDS
Sbjct: 226 NFYVCNPLTQSFKEL-PARSVKVWSRVAVGMTLNGNSTSSGYKILWVGCDGEYEIYDSLR 284

Query: 173 NQWSKPGWLPHNVSLSQESFQPARSVASDGTLYLIVGPPYDVVAYDTITGSWSRLYLQWP 352
N W++PG +P N+ L +++V+ DG LY + P +V+Y+ +TG W + + P
Sbjct: 285 NSWTRPGSMPSNIKLPLSLNFRSQAVSVDGILYFMRSDPEGIVSYNMVTGVWKQFIIPAP 344

Query: 353 EQSWDHVLSEDRGRIYLLAFHREKDTLLFSEWELHSATRLWVKVETMPSLFCLEPYAGSN 532
DH L+E GRI L+ + WEL T LW +V+ MP+++CL+ Y
Sbjct: 345 LHLNDHTLAECGGRIMLVGLLTKNAATCVCIWELQKMTLLWKEVDRMPNIWCLDFY---G 401

Query: 533 KKWQLQSFANRNLVLL 580
K ++ N+ L++L
Sbjct: 402 KHVRMTCLGNKGLLML 417


>tr|Q5JJQ2|Q5JJQ2_ORYSJ cDNA, clone: J065176G22, full insert
sequence OS=Oryza sativa subsp. japonica GN=P0592G05.24
PE=2 SV=1
Length = 443

Score = 102 bits (254), Expect = 2e-20
Identities = 61/196 (31%), Positives = 97/196 (49%), Gaps = 3/196 (1%)
Frame = +2

Query: 2 SFLVYNPLTKSCSALTPKRRGTGLDKDKVWVVTD---ESEGFIIVVVRESGRCEVYDSFN 172
+F + NPLT+S + P+R + V +V + +EG+ ++ + G EVYDS
Sbjct: 201 NFYICNPLTQSLKEI-PRRSVQAWSRVAVGMVMNGGTSNEGYKVMWLGNDGNYEVYDSMK 259

Query: 173 NQWSKPGWLPHNVSLSQESFQPARSVASDGTLYLIVGPPYDVVAYDTITGSWSRLYLQWP 352
N WS PG P ++ L ++ VA LY + P V++YD TG W + + P
Sbjct: 260 NMWSCPGTFPPSIKLPLALNFRSQPVAVGSMLYFMCAEPEGVLSYDVSTGIWRQFVIPLP 319

Query: 353 EQSWDHVLSEDRGRIYLLAFHREKDTLLFSEWELHSATRLWVKVETMPSLFCLEPYAGSN 532
DH L+E +GR+ L+ + WEL T LW +V+ MP+++CLE Y
Sbjct: 320 LHLTDHTLAEFQGRVMLVGLLCKNAATCVCIWELQKMTLLWKEVDRMPNIWCLEFY---G 376

Query: 533 KKWQLQSFANRNLVLL 580
K ++ N L++L
Sbjct: 377 KHMKMTCLGNSGLLML 392


>tr|Q0JGH1|Q0JGH1_ORYSJ Os01g0923900 protein OS=Oryza sativa subsp.
japonica GN=Os01g0923900 PE=4 SV=1
Length = 429

Score = 102 bits (254), Expect = 2e-20
Identities = 61/196 (31%), Positives = 97/196 (49%), Gaps = 3/196 (1%)
Frame = +2

Query: 2 SFLVYNPLTKSCSALTPKRRGTGLDKDKVWVVTD---ESEGFIIVVVRESGRCEVYDSFN 172
+F + NPLT+S + P+R + V +V + +EG+ ++ + G EVYDS
Sbjct: 187 NFYICNPLTQSLKEI-PRRSVQAWSRVAVGMVMNGGTSNEGYKVMWLGNDGNYEVYDSMK 245

Query: 173 NQWSKPGWLPHNVSLSQESFQPARSVASDGTLYLIVGPPYDVVAYDTITGSWSRLYLQWP 352
N WS PG P ++ L ++ VA LY + P V++YD TG W + + P
Sbjct: 246 NMWSCPGTFPPSIKLPLALNFRSQPVAVGSMLYFMCAEPEGVLSYDVSTGIWRQFVIPLP 305

Query: 353 EQSWDHVLSEDRGRIYLLAFHREKDTLLFSEWELHSATRLWVKVETMPSLFCLEPYAGSN 532
DH L+E +GR+ L+ + WEL T LW +V+ MP+++CLE Y
Sbjct: 306 LHLTDHTLAEFQGRVMLVGLLCKNAATCVCIWELQKMTLLWKEVDRMPNIWCLEFY---G 362

Query: 533 KKWQLQSFANRNLVLL 580
K ++ N L++L
Sbjct: 363 KHMKMTCLGNSGLLML 378


>tr|A3A125|A3A125_ORYSJ Putative uncharacterized protein OS=Oryza
sativa subsp. japonica GN=OsJ_004497 PE=4 SV=1
Length = 375

Score = 102 bits (254), Expect = 2e-20
Identities = 61/196 (31%), Positives = 97/196 (49%), Gaps = 3/196 (1%)
Frame = +2

Query: 2 SFLVYNPLTKSCSALTPKRRGTGLDKDKVWVVTD---ESEGFIIVVVRESGRCEVYDSFN 172
+F + NPLT+S + P+R + V +V + +EG+ ++ + G EVYDS
Sbjct: 133 NFYICNPLTQSLKEI-PRRSVQAWSRVAVGMVMNGGTSNEGYKVMWLGNDGNYEVYDSMK 191

Query: 173 NQWSKPGWLPHNVSLSQESFQPARSVASDGTLYLIVGPPYDVVAYDTITGSWSRLYLQWP 352
N WS PG P ++ L ++ VA LY + P V++YD TG W + + P
Sbjct: 192 NMWSCPGTFPPSIKLPLALNFRSQPVAVGSMLYFMCAEPEGVLSYDVSTGIWRQFVIPLP 251

Query: 353 EQSWDHVLSEDRGRIYLLAFHREKDTLLFSEWELHSATRLWVKVETMPSLFCLEPYAGSN 532
DH L+E +GR+ L+ + WEL T LW +V+ MP+++CLE Y
Sbjct: 252 LHLTDHTLAEFQGRVMLVGLLCKNAATCVCIWELQKMTLLWKEVDRMPNIWCLEFY---G 308

Query: 533 KKWQLQSFANRNLVLL 580
K ++ N L++L
Sbjct: 309 KHMKMTCLGNSGLLML 324


>tr|A2WYI6|A2WYI6_ORYSI Putative uncharacterized protein OS=Oryza
sativa subsp. indica GN=OsI_04987 PE=4 SV=1
Length = 437

Score = 102 bits (254), Expect = 2e-20
Identities = 61/196 (31%), Positives = 97/196 (49%), Gaps = 3/196 (1%)
Frame = +2

Query: 2 SFLVYNPLTKSCSALTPKRRGTGLDKDKVWVVTD---ESEGFIIVVVRESGRCEVYDSFN 172
+F + NPLT+S + P+R + V +V + +EG+ ++ + G EVYDS
Sbjct: 195 NFYICNPLTQSLKEI-PRRSVQAWSRVAVGMVMNGGTSNEGYKVMWLGNDGNYEVYDSMK 253

Query: 173 NQWSKPGWLPHNVSLSQESFQPARSVASDGTLYLIVGPPYDVVAYDTITGSWSRLYLQWP 352
N WS PG P ++ L ++ VA LY + P V++YD TG W + + P
Sbjct: 254 NMWSCPGTFPPSIKLPLALNFRSQPVAVGSMLYFMCAEPEGVLSYDVSTGIWRQFVIPLP 313

Query: 353 EQSWDHVLSEDRGRIYLLAFHREKDTLLFSEWELHSATRLWVKVETMPSLFCLEPYAGSN 532
DH L+E +GR+ L+ + WEL T LW +V+ MP+++CLE Y
Sbjct: 314 LHLTDHTLAEFQGRVMLVGLLCKNAATCVCIWELQKMTLLWKEVDRMPNIWCLEFY---G 370

Query: 533 KKWQLQSFANRNLVLL 580
K ++ N L++L
Sbjct: 371 KHMKMTCLGNSGLLML 386