DK950770
Clone id TST38A01NGRL0009_J05
Library
Length 652
Definition Adiantum capillus-veneris mRNA. clone: TST38A01NGRL0009_J05. 5' end sequence.
Accession
Tissue type prothallia
Developmental stage gametophyte
Contig ID
Sequence
GCGGAGCAGGGTGCGGGAAGAAGAAGAGGAAGCAGGAAGCCCTGAAGTCGCGCAAGAGGC
AAAGAAAGCTAAGGAGGACGAGGAAAAGAGAGGTGAAGAACCAGGTAACTTAGAGGCTGA
GGAAAGGCCGGAGATCAGAGAAAGCACTGAAGATGACGAAGAAGCAGCAAGCAGGGAGCT
CCATATTTCTCGTTGCAAGGCCGTCTTGCAGGTCTTGATGGACCACAAGTATGCCTGGCT
CTTTAGCGAGCCTGTGGATCCTGTTGCACTTGAAATTCCCGACTACCCTACAATTGTCAA
GCATCCCATGGACCTTGGTACCATCATGGCCAAGCTCAACAGGAAAGAATATGGCGATCT
ACCCCTCAACTTCATACAGGATGTCCGGCTCACCTTTGACAATGCCATGCTCTACAACCC
TCCAGGGCATGAGGTAAATAATTCTGCAAAAAAAATGCTGGCCTTCTTCCATAAAGAGTG
GGACAAGAGTGCAACCAGGAGCTTGGCTGTGTCGACCCCCAGAACTCCCAGACATAGTGC
AGTCTCTGTGAAGGCCTTCAGTTTTGAGGATAAACAGATTTTGTTGGAGAATCTGCAGAC
CCTTCCCCCTCATATGCAGTATGCAGCTGTCTTGCTGATGAGCGAGAGAAGC
■■Homology search results ■■ -
sp_hit_id Q8K2F0
Definition sp|Q8K2F0|BRD3_MOUSE Bromodomain-containing protein 3 OS=Mus musculus
Align length 130
Score (bit) 90.9
E-value 5.0e-18
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= DK950770|Adiantum capillus-veneris mRNA, clone:
TST38A01NGRL0009_J05, 5'
(652 letters)

Database: uniprot_sprot.fasta
412,525 sequences; 148,809,765 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

sp|Q8K2F0|BRD3_MOUSE Bromodomain-containing protein 3 OS=Mus mus... 91 5e-18
sp|Q15059|BRD3_HUMAN Bromodomain-containing protein 3 OS=Homo sa... 90 9e-18
sp|Q9Y7N0|YCK2_SCHPO Bromodomain-containing protein C1450.02 OS=... 86 1e-16
sp|O60885|BRD4_HUMAN Bromodomain-containing protein 4 OS=Homo sa... 86 2e-16
sp|P25440|BRD2_HUMAN Bromodomain-containing protein 2 OS=Homo sa... 85 3e-16
sp|Q6MGA9|BRD2_RAT Bromodomain-containing protein 2 OS=Rattus no... 85 4e-16
sp|Q7JJ13|BRD2_MOUSE Bromodomain-containing protein 2 OS=Mus mus... 85 4e-16
sp|Q5TJG6|BRD2_CANFA Bromodomain-containing protein 2 OS=Canis f... 85 4e-16
sp|Q32S26|BRD2_BOVIN Bromodomain-containing protein 2 OS=Bos tau... 85 4e-16
sp|Q9ESU6|BRD4_MOUSE Bromodomain-containing protein 4 OS=Mus mus... 84 6e-16
sp|Q4R8Y1|BRDT_MACFA Bromodomain testis-specific protein OS=Maca... 80 1e-14
sp|P13709|FSH_DROME Homeotic protein female sterile OS=Drosophil... 79 3e-14
sp|Q58F21|BRDT_HUMAN Bromodomain testis-specific protein OS=Homo... 78 4e-14
sp|P35817|BDF1_YEAST Bromodomain-containing factor 1 OS=Saccharo... 78 4e-14
sp|Q07442|BDF2_YEAST Bromodomain-containing factor 2 OS=Saccharo... 78 5e-14
sp|Q91Y44|BRDT_MOUSE Bromodomain testis-specific protein OS=Mus ... 77 6e-14
sp|Q9HGP4|YK82_SCHPO Bromodomain-containing protein C631.02 OS=S... 74 5e-13
sp|P45481|CBP_MOUSE CREB-binding protein OS=Mus musculus GN=Creb... 73 1e-12
sp|Q92793|CBP_HUMAN CREB-binding protein OS=Homo sapiens GN=CREB... 70 1e-11
sp|Q6BER5|NU301_CAEEL Nucleosome-remodeling factor subunit NURF3... 68 5e-11
sp|Q12830|BPTF_HUMAN Nucleosome-remodeling factor subunit BPTF O... 68 5e-11
sp|Q6CXW4|GCN5_KLULA Histone acetyltransferase GCN5 OS=Kluyverom... 66 1e-10
sp|Q09472|EP300_HUMAN Histone acetyltransferase p300 OS=Homo sap... 66 2e-10
sp|Q756G9|GCN5_ASHGO Histone acetyltransferase GCN5 OS=Ashbya go... 64 5e-10
sp|Q9UIF8|BAZ2B_HUMAN Bromodomain adjacent to zinc finger domain... 64 5e-10
sp|Q03330|GCN5_YEAST Histone acetyltransferase GCN5 OS=Saccharom... 64 7e-10
sp|Q6FTW5|GCN5_CANGA Histone acetyltransferase GCN5 OS=Candida g... 64 9e-10
sp|Q5RDX4|ATAD2_PONAB ATPase family AAA domain-containing protei... 64 9e-10
sp|Q6PL18|ATAD2_HUMAN ATPase family AAA domain-containing protei... 64 9e-10
sp|Q9DE13|BAZ2B_CHICK Bromodomain adjacent to zinc finger domain... 63 1e-09

>sp|Q8K2F0|BRD3_MOUSE Bromodomain-containing protein 3 OS=Mus
musculus GN=Brd3 PE=1 SV=2
Length = 726

Score = 90.9 bits (224), Expect = 5e-18
Identities = 50/130 (38%), Positives = 68/130 (52%), Gaps = 3/130 (2%)
Frame = +2

Query: 182 HISRCKAVLQVLMDHK---YAWLFSEPVDPVALEIPDYPTIVKHPMDLGTIMAKLNRKEY 352
H+ C ++L+ ++ K YAW F +PVD ALE+ DY I+KHPMDL T+ K++ +EY
Sbjct: 310 HLRHCDSILREMLSKKHAAYAWPFYKPVDAEALELHDYHDIIKHPMDLSTVKRKMDSREY 369

Query: 353 GDLPLNFIQDVRLTFDNAMLYNPPGHEVNNSAKKMLAFFHKEWDKSATRSLAVSTPRTPR 532
D F D+RL F N YNPP HEV A+K+ F + K + P
Sbjct: 370 PDAQ-GFAADIRLMFSNCYKYNPPDHEVVAMARKLQDVFEMRFAKMPDEPMEAPALPAPT 428

Query: 533 HSAVSVKAFS 562
VS A S
Sbjct: 429 APIVSKGAES 438



Score = 66.6 bits (161), Expect = 1e-10
Identities = 32/89 (35%), Positives = 49/89 (55%)
Frame = +2

Query: 203 VLQVLMDHKYAWLFSEPVDPVALEIPDYPTIVKHPMDLGTIMAKLNRKEYGDLPLNFIQD 382
V++ L H++AW F +PVD + L +PDY I+K+PMD+GTI +L Y +QD
Sbjct: 45 VVKTLWKHQFAWPFYQPVDAIKLNLPDYHKIIKNPMDMGTIKKRLENNYYWSAS-ECMQD 103

Query: 383 VRLTFDNAMLYNPPGHEVNNSAKKMLAFF 469
F N +YN P ++ A+ + F
Sbjct: 104 FNTMFTNCYIYNKPTDDIVLMAQALEKIF 132


>sp|Q15059|BRD3_HUMAN Bromodomain-containing protein 3 OS=Homo
sapiens GN=BRD3 PE=1 SV=1
Length = 726

Score = 90.1 bits (222), Expect = 9e-18
Identities = 51/126 (40%), Positives = 68/126 (53%), Gaps = 3/126 (2%)
Frame = +2

Query: 182 HISRCKAVLQVLMDHK---YAWLFSEPVDPVALEIPDYPTIVKHPMDLGTIMAKLNRKEY 352
H+ C ++L+ ++ K YAW F +PVD ALE+ DY I+KHPMDL T+ K++ +EY
Sbjct: 311 HLRYCDSILREMLSKKHAAYAWPFYKPVDAEALELHDYHDIIKHPMDLSTVKRKMDGREY 370

Query: 353 GDLPLNFIQDVRLTFDNAMLYNPPGHEVNNSAKKMLAFFHKEWDKSATRSLAVSTPRTPR 532
D F DVRL F N YNPP HEV A+K+ F + K V P P
Sbjct: 371 PDAQ-GFAADVRLMFSNCYKYNPPDHEVVAMARKLQDVFEMRFAKMPDE--PVEAPALPA 427

Query: 533 HSAVSV 550
+A V
Sbjct: 428 PAAPMV 433



Score = 66.6 bits (161), Expect = 1e-10
Identities = 32/89 (35%), Positives = 49/89 (55%)
Frame = +2

Query: 203 VLQVLMDHKYAWLFSEPVDPVALEIPDYPTIVKHPMDLGTIMAKLNRKEYGDLPLNFIQD 382
V++ L H++AW F +PVD + L +PDY I+K+PMD+GTI +L Y +QD
Sbjct: 46 VVKTLWKHQFAWPFYQPVDAIKLNLPDYHKIIKNPMDMGTIKKRLENNYYWSAS-ECMQD 104

Query: 383 VRLTFDNAMLYNPPGHEVNNSAKKMLAFF 469
F N +YN P ++ A+ + F
Sbjct: 105 FNTMFTNCYIYNKPTDDIVLMAQALEKIF 133


>sp|Q9Y7N0|YCK2_SCHPO Bromodomain-containing protein C1450.02
OS=Schizosaccharomyces pombe GN=SPCC1450.02 PE=1 SV=1
Length = 578

Score = 86.3 bits (212), Expect = 1e-16
Identities = 52/132 (39%), Positives = 69/132 (52%), Gaps = 14/132 (10%)
Frame = +2

Query: 194 CKAVLQVLMDHKYAWLFSEPVDPVALEIPDYPTIVKHPMDLGTIMAKLNRKEYGDLPLNF 373
C A+++ L K + F PVDP+ IPDYPTIVK+PMDLGTI KL EY +P F
Sbjct: 93 CLAIVRQLKRTKNSAPFKVPVDPIKQNIPDYPTIVKNPMDLGTIEKKLTSYEY-SVPQEF 151

Query: 374 IQDVRLTFDNAMLYNPPGHEVNNSAKKMLAFFHKEW--------------DKSATRSLAV 511
I D+ L F N LYN V + K + F ++ KS +S +
Sbjct: 152 IDDMNLMFSNCFLYNGTESPVGSMGKALQEVFERQLKQLPDAEQPAAAPVKKSKQKSAST 211

Query: 512 STPRTPRHSAVS 547
+ PRT R+S+VS
Sbjct: 212 APPRTRRNSSVS 223



Score = 83.2 bits (204), Expect = 1e-15
Identities = 42/100 (42%), Positives = 60/100 (60%), Gaps = 3/100 (3%)
Frame = +2

Query: 194 CKAVLQVLMDHKY---AWLFSEPVDPVALEIPDYPTIVKHPMDLGTIMAKLNRKEYGDLP 364
C VL+ L +Y A+ F +PVDPVA + PDY ++K PMDL TI +KLN+ EY L
Sbjct: 260 CSTVLKELYKRQYESFAFPFYQPVDPVACDCPDYFDVIKEPMDLSTIQSKLNKNEYSTLE 319

Query: 365 LNFIQDVRLTFDNAMLYNPPGHEVNNSAKKMLAFFHKEWD 484
F D+ L F+N YNPPG V+ +++ F ++W+
Sbjct: 320 -EFESDILLMFNNCFTYNPPGTPVHVMGRQLENVFKEKWE 358


>sp|O60885|BRD4_HUMAN Bromodomain-containing protein 4 OS=Homo
sapiens GN=BRD4 PE=1 SV=2
Length = 1362

Score = 85.9 bits (211), Expect = 2e-16
Identities = 53/146 (36%), Positives = 77/146 (52%), Gaps = 7/146 (4%)
Frame = +2

Query: 113 EAEERPEIRESTEDDEEAASRELHISRCKAVLQVLMDHK---YAWLFSEPVDPVALEIPD 283
++++ P +S++ E+ + C +L+ + K YAW F +PVD AL + D
Sbjct: 337 DSQQHPAPEKSSKVSEQ-------LKCCSGILKEMFAKKHAAYAWPFYKPVDVEALGLHD 389

Query: 284 YPTIVKHPMDLGTIMAKLNRKEYGDLPLNFIQDVRLTFDNAMLYNPPGHEVNNSAKKMLA 463
Y I+KHPMD+ TI +KL +EY D F DVRL F N YNPP HEV A+K+
Sbjct: 390 YCDIIKHPMDMSTIKSKLEAREYRDAQ-EFGADVRLMFSNCYKYNPPDHEVVAMARKLQD 448

Query: 464 FFHKEW----DKSATRSLAVSTPRTP 529
F + D+ +AVS+P P
Sbjct: 449 VFEMRFAKMPDEPEEPVVAVSSPAVP 474



Score = 74.3 bits (181), Expect = 5e-13
Identities = 42/137 (30%), Positives = 67/137 (48%)
Frame = +2

Query: 101 PGNLEAEERPEIRESTEDDEEAASRELHISRCKAVLQVLMDHKYAWLFSEPVDPVALEIP 280
P N + P S + + + +L + VL+ L H++AW F +PVD V L +P
Sbjct: 37 PANAASTNPPPPETSNPNKPKRQTNQLQYL-LRVVLKTLWKHQFAWPFQQPVDAVKLNLP 95

Query: 281 DYPTIVKHPMDLGTIMAKLNRKEYGDLPLNFIQDVRLTFDNAMLYNPPGHEVNNSAKKML 460
DY I+K PMD+GTI +L Y + IQD F N +YN PG ++ A+ +
Sbjct: 96 DYYKIIKTPMDMGTIKKRLENNYYWNAQ-ECIQDFNTMFTNCYIYNKPGDDIVLMAEALE 154

Query: 461 AFFHKEWDKSATRSLAV 511
F ++ ++ T +
Sbjct: 155 KLFLQKINELPTEETEI 171


>sp|P25440|BRD2_HUMAN Bromodomain-containing protein 2 OS=Homo
sapiens GN=BRD2 PE=1 SV=2
Length = 801

Score = 85.1 bits (209), Expect = 3e-16
Identities = 54/158 (34%), Positives = 79/158 (50%), Gaps = 10/158 (6%)
Frame = +2

Query: 125 RPEIRESTEDDEEAASREL--HISRCKAVLQVLMDHK---YAWLFSEPVDPVALEIPDYP 289
R ++ +S + + + +L + C +L+ L+ K YAW F +PVD AL + DY
Sbjct: 328 RKDLPDSQQQHQSSKKGKLSEQLKHCNGILKELLSKKHAAYAWPFYKPVDASALGLHDYH 387

Query: 290 TIVKHPMDLGTIMAKLNRKEYGDLPLNFIQDVRLTFDNAMLYNPPGHEVNNSAKKMLAFF 469
I+KHPMDL T+ K+ ++Y D F DVRL F N YNPP H+V A+K+ F
Sbjct: 388 DIIKHPMDLSTVKRKMENRDYRDAQ-EFAADVRLMFSNCYKYNPPDHDVVAMARKLQDVF 446

Query: 470 HKEWDKSATR-----SLAVSTPRTPRHSAVSVKAFSFE 568
+ K L VST P + S ++ S E
Sbjct: 447 EFRYAKMPDEPLEPGPLPVSTAMPPGLAKSSSESSSEE 484



Score = 67.8 bits (164), Expect = 5e-11
Identities = 34/91 (37%), Positives = 49/91 (53%)
Frame = +2

Query: 197 KAVLQVLMDHKYAWLFSEPVDPVALEIPDYPTIVKHPMDLGTIMAKLNRKEYGDLPLNFI 376
K V++ L H++AW F +PVD V L +PDY I+K PMD+GTI +L Y +
Sbjct: 84 KVVMKALWKHQFAWPFRQPVDAVKLGLPDYHKIIKQPMDMGTIKRRLENNYYW-AASECM 142

Query: 377 QDVRLTFDNAMLYNPPGHEVNNSAKKMLAFF 469
QD F N +YN P ++ A+ + F
Sbjct: 143 QDFNTMFTNCYIYNKPTDDIVLMAQTLEKIF 173


>sp|Q6MGA9|BRD2_RAT Bromodomain-containing protein 2 OS=Rattus
norvegicus GN=Brd2 PE=2 SV=1
Length = 798

Score = 84.7 bits (208), Expect = 4e-16
Identities = 46/126 (36%), Positives = 68/126 (53%), Gaps = 5/126 (3%)
Frame = +2

Query: 125 RPEIRESTEDDEEAASREL--HISRCKAVLQVLMDHK---YAWLFSEPVDPVALEIPDYP 289
R ++ +S + + + +L + C +L+ L+ K YAW F +PVD AL + DY
Sbjct: 327 RKDLPDSQQQHQSSKKGKLSEQLKHCNGILKELLSKKHAAYAWPFYKPVDASALGLHDYH 386

Query: 290 TIVKHPMDLGTIMAKLNRKEYGDLPLNFIQDVRLTFDNAMLYNPPGHEVNNSAKKMLAFF 469
I+KHPMDL T+ K+ ++Y D F DVRL F N YNPP H+V A+K+ F
Sbjct: 387 DIIKHPMDLSTVKRKMENRDYRDAQ-EFAADVRLMFSNCYKYNPPDHDVVAMARKLQDVF 445

Query: 470 HKEWDK 487
+ K
Sbjct: 446 EFRYAK 451



Score = 67.8 bits (164), Expect = 5e-11
Identities = 34/91 (37%), Positives = 49/91 (53%)
Frame = +2

Query: 197 KAVLQVLMDHKYAWLFSEPVDPVALEIPDYPTIVKHPMDLGTIMAKLNRKEYGDLPLNFI 376
K V++ L H++AW F +PVD V L +PDY I+K PMD+GTI +L Y +
Sbjct: 83 KVVMKALWKHQFAWPFRQPVDAVKLGLPDYHKIIKQPMDMGTIKRRLENNYYW-AASECM 141

Query: 377 QDVRLTFDNAMLYNPPGHEVNNSAKKMLAFF 469
QD F N +YN P ++ A+ + F
Sbjct: 142 QDFNTMFTNCYIYNKPTDDIVLMAQTLEKIF 172


>sp|Q7JJ13|BRD2_MOUSE Bromodomain-containing protein 2 OS=Mus
musculus GN=Brd2 PE=1 SV=1
Length = 798

Score = 84.7 bits (208), Expect = 4e-16
Identities = 46/126 (36%), Positives = 68/126 (53%), Gaps = 5/126 (3%)
Frame = +2

Query: 125 RPEIRESTEDDEEAASREL--HISRCKAVLQVLMDHK---YAWLFSEPVDPVALEIPDYP 289
R ++ +S + + + +L + C +L+ L+ K YAW F +PVD AL + DY
Sbjct: 327 RKDLPDSQQQHQSSKKGKLSEQLKHCNGILKELLSKKHAAYAWPFYKPVDASALGLHDYH 386

Query: 290 TIVKHPMDLGTIMAKLNRKEYGDLPLNFIQDVRLTFDNAMLYNPPGHEVNNSAKKMLAFF 469
I+KHPMDL T+ K+ ++Y D F DVRL F N YNPP H+V A+K+ F
Sbjct: 387 DIIKHPMDLSTVKRKMENRDYRDAQ-EFAADVRLMFSNCYKYNPPDHDVVAMARKLQDVF 445

Query: 470 HKEWDK 487
+ K
Sbjct: 446 EFRYAK 451



Score = 67.8 bits (164), Expect = 5e-11
Identities = 34/91 (37%), Positives = 49/91 (53%)
Frame = +2

Query: 197 KAVLQVLMDHKYAWLFSEPVDPVALEIPDYPTIVKHPMDLGTIMAKLNRKEYGDLPLNFI 376
K V++ L H++AW F +PVD V L +PDY I+K PMD+GTI +L Y +
Sbjct: 83 KVVMKALWKHQFAWPFRQPVDAVKLGLPDYHKIIKQPMDMGTIKRRLENNYYW-AASECM 141

Query: 377 QDVRLTFDNAMLYNPPGHEVNNSAKKMLAFF 469
QD F N +YN P ++ A+ + F
Sbjct: 142 QDFNTMFTNCYIYNKPTDDIVLMAQTLEKIF 172


>sp|Q5TJG6|BRD2_CANFA Bromodomain-containing protein 2 OS=Canis
familiaris GN=BRD2 PE=3 SV=1
Length = 803

Score = 84.7 bits (208), Expect = 4e-16
Identities = 46/126 (36%), Positives = 68/126 (53%), Gaps = 5/126 (3%)
Frame = +2

Query: 125 RPEIRESTEDDEEAASREL--HISRCKAVLQVLMDHK---YAWLFSEPVDPVALEIPDYP 289
R ++ +S + + + +L + C +L+ L+ K YAW F +PVD AL + DY
Sbjct: 328 RKDLPDSQQQHQSSKKGKLSEQLKHCNGILKELLSKKHAAYAWPFYKPVDASALGLHDYH 387

Query: 290 TIVKHPMDLGTIMAKLNRKEYGDLPLNFIQDVRLTFDNAMLYNPPGHEVNNSAKKMLAFF 469
I+KHPMDL T+ K+ ++Y D F DVRL F N YNPP H+V A+K+ F
Sbjct: 388 DIIKHPMDLSTVKRKMENRDYRDAQ-EFAADVRLMFSNCYKYNPPDHDVVAMARKLQDVF 446

Query: 470 HKEWDK 487
+ K
Sbjct: 447 EFRYAK 452



Score = 67.8 bits (164), Expect = 5e-11
Identities = 34/91 (37%), Positives = 49/91 (53%)
Frame = +2

Query: 197 KAVLQVLMDHKYAWLFSEPVDPVALEIPDYPTIVKHPMDLGTIMAKLNRKEYGDLPLNFI 376
K V++ L H++AW F +PVD V L +PDY I+K PMD+GTI +L Y +
Sbjct: 84 KVVMKALWKHQFAWPFRQPVDAVKLGLPDYHKIIKQPMDMGTIKRRLENNYYW-AASECM 142

Query: 377 QDVRLTFDNAMLYNPPGHEVNNSAKKMLAFF 469
QD F N +YN P ++ A+ + F
Sbjct: 143 QDFNTMFTNCYIYNKPTDDIVLMAQTLEKIF 173


>sp|Q32S26|BRD2_BOVIN Bromodomain-containing protein 2 OS=Bos taurus
GN=BRD2 PE=3 SV=1
Length = 803

Score = 84.7 bits (208), Expect = 4e-16
Identities = 46/126 (36%), Positives = 68/126 (53%), Gaps = 5/126 (3%)
Frame = +2

Query: 125 RPEIRESTEDDEEAASREL--HISRCKAVLQVLMDHK---YAWLFSEPVDPVALEIPDYP 289
R ++ +S + + + +L + C +L+ L+ K YAW F +PVD AL + DY
Sbjct: 328 RKDLPDSQQQHQSSKKGKLSEQLKHCNGILKELLSKKHAAYAWPFYKPVDASALGLHDYH 387

Query: 290 TIVKHPMDLGTIMAKLNRKEYGDLPLNFIQDVRLTFDNAMLYNPPGHEVNNSAKKMLAFF 469
I+KHPMDL T+ K+ ++Y D F DVRL F N YNPP H+V A+K+ F
Sbjct: 388 DIIKHPMDLSTVKRKMENRDYRDAQ-EFAADVRLMFSNCYKYNPPDHDVVAMARKLQDVF 446

Query: 470 HKEWDK 487
+ K
Sbjct: 447 EFRYAK 452



Score = 67.8 bits (164), Expect = 5e-11
Identities = 34/91 (37%), Positives = 49/91 (53%)
Frame = +2

Query: 197 KAVLQVLMDHKYAWLFSEPVDPVALEIPDYPTIVKHPMDLGTIMAKLNRKEYGDLPLNFI 376
K V++ L H++AW F +PVD V L +PDY I+K PMD+GTI +L Y +
Sbjct: 84 KVVMKALWKHQFAWPFRQPVDAVKLGLPDYHKIIKQPMDMGTIKRRLENNYYW-AASECM 142

Query: 377 QDVRLTFDNAMLYNPPGHEVNNSAKKMLAFF 469
QD F N +YN P ++ A+ + F
Sbjct: 143 QDFNTMFTNCYIYNKPTDDIVLMAQTLEKIF 173


>sp|Q9ESU6|BRD4_MOUSE Bromodomain-containing protein 4 OS=Mus
musculus GN=Brd4 PE=1 SV=1
Length = 1400

Score = 84.0 bits (206), Expect = 6e-16
Identities = 50/131 (38%), Positives = 69/131 (52%), Gaps = 7/131 (5%)
Frame = +2

Query: 158 EEAASRELHISRCKAVLQVLMDHK---YAWLFSEPVDPVALEIPDYPTIVKHPMDLGTIM 328
E+++ + C +L+ + K YAW F +PVD AL + DY I+KHPMD+ TI
Sbjct: 346 EKSSKISEQLKCCSGILKEMFAKKHAAYAWPFYKPVDVEALGLHDYCDIIKHPMDMSTIK 405

Query: 329 AKLNRKEYGDLPLNFIQDVRLTFDNAMLYNPPGHEVNNSAKKMLAFFHKEW----DKSAT 496
+KL +EY D F DVRL F N YNPP HEV A+K+ F + D+
Sbjct: 406 SKLESREYRDAQ-EFGADVRLMFSNCYKYNPPDHEVVAMARKLQDVFEMRFAKMPDEPEE 464

Query: 497 RSLAVSTPRTP 529
+ VS+P P
Sbjct: 465 PVVTVSSPAVP 475



Score = 74.3 bits (181), Expect = 5e-13
Identities = 42/137 (30%), Positives = 67/137 (48%)
Frame = +2

Query: 101 PGNLEAEERPEIRESTEDDEEAASRELHISRCKAVLQVLMDHKYAWLFSEPVDPVALEIP 280
P N + P S + + + +L + VL+ L H++AW F +PVD V L +P
Sbjct: 37 PANAASTNPPPPETSNPNKPKRQTNQLQYL-LRVVLKTLWKHQFAWPFQQPVDAVKLNLP 95

Query: 281 DYPTIVKHPMDLGTIMAKLNRKEYGDLPLNFIQDVRLTFDNAMLYNPPGHEVNNSAKKML 460
DY I+K PMD+GTI +L Y + IQD F N +YN PG ++ A+ +
Sbjct: 96 DYYKIIKTPMDMGTIKKRLENNYYWNAQ-ECIQDFNTMFTNCYIYNKPGDDIVLMAEALE 154

Query: 461 AFFHKEWDKSATRSLAV 511
F ++ ++ T +
Sbjct: 155 KLFLQKINELPTEETEI 171


tr_hit_id A7PLT9
Definition tr|A7PLT9|A7PLT9_VITVI Chromosome chr14 scaffold_21, whole genome shotgun sequence OS=Vitis vinifera
Align length 124
Score (bit) 111.0
E-value 4.0e-23
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= DK950770|Adiantum capillus-veneris mRNA, clone:
TST38A01NGRL0009_J05, 5'
(652 letters)

Database: uniprot_trembl.fasta
7,341,751 sequences; 2,391,615,440 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

tr|A7PLT9|A7PLT9_VITVI Chromosome chr14 scaffold_21, whole genom... 111 4e-23
tr|Q9FGW9|Q9FGW9_ARATH Similarity to kinase (At5g63330) OS=Arabi... 109 1e-22
tr|Q7XIR9|Q7XIR9_ORYSJ Os07g0507700 protein OS=Oryza sativa subs... 109 1e-22
tr|A3BK59|A3BK59_ORYSJ Putative uncharacterized protein OS=Oryza... 109 1e-22
tr|B8B6H0|B8B6H0_ORYSI Putative uncharacterized protein OS=Oryza... 108 2e-22
tr|A7PHD1|A7PHD1_VITVI Chromosome chr17 scaffold_16, whole genom... 108 3e-22
tr|A5C0I5|A5C0I5_VITVI Putative uncharacterized protein OS=Vitis... 108 4e-22
tr|A7QV74|A7QV74_VITVI Chromosome undetermined scaffold_186, who... 107 6e-22
tr|A7QS98|A7QS98_VITVI Chromosome chr3 scaffold_157, whole genom... 103 7e-21
tr|A9RJI5|A9RJI5_PHYPA Predicted protein OS=Physcomitrella paten... 103 9e-21
tr|Q9S7T1|Q9S7T1_ARATH Putative uncharacterized protein T18K17.1... 102 2e-20
tr|A9SEB7|A9SEB7_PHYPA Predicted protein (Fragment) OS=Physcomit... 102 2e-20
tr|Q9S7A8|Q9S7A8_ARATH F28J7.10 protein (F4P13.32 protein) OS=Ar... 102 3e-20
tr|Q9LS28|Q9LS28_ARATH Similarity to kinase OS=Arabidopsis thali... 102 3e-20
tr|Q93ZB7|Q93ZB7_ARATH AT3g01770/F28J7_10 (Putative uncharacteri... 102 3e-20
tr|Q8GXL8|Q8GXL8_ARATH Putative uncharacterized protein At5g4655... 102 3e-20
tr|Q9LYA2|Q9LYA2_ARATH Kinase-like protein OS=Arabidopsis thalia... 101 5e-20
tr|Q93YS6|Q93YS6_ARATH Putative kinase OS=Arabidopsis thaliana G... 101 5e-20
tr|Q9LMU8|Q9LMU8_ARATH F2H15.2 protein OS=Arabidopsis thaliana G... 100 6e-20
tr|Q8H1D7|Q8H1D7_ARATH Putative uncharacterized protein At1g1779... 100 6e-20
tr|Q93ZU2|Q93ZU2_ARATH Putative uncharacterized protein At1g1779... 100 8e-20
tr|Q0E2D1|Q0E2D1_ORYSJ Os02g0250300 protein OS=Oryza sativa subs... 100 8e-20
tr|B8AEZ6|B8AEZ6_ORYSI Putative uncharacterized protein OS=Oryza... 100 1e-19
tr|A7R202|A7R202_VITVI Chromosome undetermined scaffold_388, who... 100 1e-19
tr|Q84UX7|Q84UX7_MAIZE Global transcription factor group E OS=Ze... 100 1e-19
tr|Q0WSA6|Q0WSA6_ARATH Putative uncharacterized protein At1g7315... 100 1e-19
tr|B8A2Z6|B8A2Z6_MAIZE Putative uncharacterized protein OS=Zea m... 100 1e-19
tr|A1XX44|A1XX44_9MAGN Chloroplast bromodomain-containing protei... 98 4e-19
tr|Q9LK27|Q9LK27_ARATH Gb|AAF01563.1 OS=Arabidopsis thaliana PE=... 97 7e-19
tr|Q9LNC4|Q9LNC4_ARATH F9P14.9 protein OS=Arabidopsis thaliana G... 97 9e-19

>tr|A7PLT9|A7PLT9_VITVI Chromosome chr14 scaffold_21, whole genome
shotgun sequence OS=Vitis vinifera GN=GSVIVT00020563001
PE=4 SV=1
Length = 704

Score = 111 bits (277), Expect = 4e-23
Identities = 55/124 (44%), Positives = 79/124 (63%)
Frame = +2

Query: 143 STEDDEEAASRELHISRCKAVLQVLMDHKYAWLFSEPVDPVALEIPDYPTIVKHPMDLGT 322
+T+ + + L + +C+ +L+ LM H++ W+F+EPVD V L IPDY TI+KHPMDLGT
Sbjct: 126 ATQASAPSTASVLLMKQCETLLKQLMSHQHGWVFNEPVDIVKLNIPDYFTIIKHPMDLGT 185

Query: 323 IMAKLNRKEYGDLPLNFIQDVRLTFDNAMLYNPPGHEVNNSAKKMLAFFHKEWDKSATRS 502
I K+ Y PL+F DVRLTF NA +NPPG++V+ A + FF W K+ +
Sbjct: 186 IKGKIASGAYSS-PLDFAADVRLTFSNAQTFNPPGNDVHKMADTLSKFFEVRW-KTIEKK 243

Query: 503 LAVS 514
L V+
Sbjct: 244 LPVT 247


>tr|Q9FGW9|Q9FGW9_ARATH Similarity to kinase (At5g63330)
OS=Arabidopsis thaliana GN=At5g63330 PE=2 SV=1
Length = 477

Score = 109 bits (273), Expect = 1e-22
Identities = 60/159 (37%), Positives = 93/159 (58%), Gaps = 11/159 (6%)
Frame = +2

Query: 113 EAEERPEIRESTEDDEEAASRELHI----------SRCKAVLQVLMDHKYAWLFSEPVDP 262
+ ++RP +R + +++ SR L++ C+ +L L HK W F PVDP
Sbjct: 129 QGKKRPPVRSDKQRNKKGPSR-LNVPTSYTVASVMKECETLLNRLWSHKSGWPFRTPVDP 187

Query: 263 VALEIPDYPTIVKHPMDLGTIMAKLNRKEYGDLPLNFIQDVRLTFDNAMLYNPPGHEVNN 442
V L IPDY ++KHPMDLGTI ++L + EY PL+F DVRLTF N++ YNPPG++ +
Sbjct: 188 VMLNIPDYFNVIKHPMDLGTIRSRLCKGEYSS-PLDFAADVRLTFSNSIAYNPPGNQFHT 246

Query: 443 SAKKMLAFFHKEWDKSATRSLAVSTPRT-PRHSAVSVKA 556
A+ + +F W KS + + +S P P S+ S+++
Sbjct: 247 MAQGISKYFESGW-KSIEKKIPMSKPPVIPLTSSASLES 284


>tr|Q7XIR9|Q7XIR9_ORYSJ Os07g0507700 protein OS=Oryza sativa subsp.
japonica GN=OJ1163_G04.101 PE=2 SV=1
Length = 484

Score = 109 bits (273), Expect = 1e-22
Identities = 49/97 (50%), Positives = 67/97 (69%)
Frame = +2

Query: 191 RCKAVLQVLMDHKYAWLFSEPVDPVALEIPDYPTIVKHPMDLGTIMAKLNRKEYGDLPLN 370
+C ++L+ LMDHK W+F+ PVDPV IPDY ++++PMDLGT+ KL K+Y + P
Sbjct: 64 QCGSILKKLMDHKSGWIFNTPVDPVVYGIPDYFDVIRNPMDLGTVKRKLTSKQYSN-PYE 122

Query: 371 FIQDVRLTFDNAMLYNPPGHEVNNSAKKMLAFFHKEW 481
F DVRLTF NAM YNPPG++V+ A ++ F EW
Sbjct: 123 FAADVRLTFSNAMKYNPPGNDVHGIADQLNKIFDSEW 159


>tr|A3BK59|A3BK59_ORYSJ Putative uncharacterized protein OS=Oryza
sativa subsp. japonica GN=OsJ_023431 PE=4 SV=1
Length = 516

Score = 109 bits (273), Expect = 1e-22
Identities = 49/97 (50%), Positives = 67/97 (69%)
Frame = +2

Query: 191 RCKAVLQVLMDHKYAWLFSEPVDPVALEIPDYPTIVKHPMDLGTIMAKLNRKEYGDLPLN 370
+C ++L+ LMDHK W+F+ PVDPV IPDY ++++PMDLGT+ KL K+Y + P
Sbjct: 116 QCGSILKKLMDHKSGWIFNTPVDPVVYGIPDYFDVIRNPMDLGTVKRKLTSKQYSN-PYE 174

Query: 371 FIQDVRLTFDNAMLYNPPGHEVNNSAKKMLAFFHKEW 481
F DVRLTF NAM YNPPG++V+ A ++ F EW
Sbjct: 175 FAADVRLTFSNAMKYNPPGNDVHGIADQLNKIFDSEW 211


>tr|B8B6H0|B8B6H0_ORYSI Putative uncharacterized protein OS=Oryza
sativa subsp. indica GN=OsI_26141 PE=4 SV=1
Length = 484

Score = 108 bits (271), Expect = 2e-22
Identities = 49/97 (50%), Positives = 67/97 (69%)
Frame = +2

Query: 191 RCKAVLQVLMDHKYAWLFSEPVDPVALEIPDYPTIVKHPMDLGTIMAKLNRKEYGDLPLN 370
+C ++L+ LMDHK W+F+ PVDPV IPDY ++++PMDLGT+ KL K+Y + P
Sbjct: 64 QCGSILKKLMDHKSGWIFNTPVDPVVYGIPDYFDVIRNPMDLGTVKRKLTSKQYSN-PYE 122

Query: 371 FIQDVRLTFDNAMLYNPPGHEVNNSAKKMLAFFHKEW 481
F DVRLTF NAM YNPPG++V+ A ++ F EW
Sbjct: 123 FAADVRLTFSNAMKYNPPGNDVHAIADQLNKIFDSEW 159


>tr|A7PHD1|A7PHD1_VITVI Chromosome chr17 scaffold_16, whole genome
shotgun sequence OS=Vitis vinifera GN=GSVIVT00017896001
PE=4 SV=1
Length = 730

Score = 108 bits (270), Expect = 3e-22
Identities = 59/148 (39%), Positives = 87/148 (58%), Gaps = 1/148 (0%)
Frame = +2

Query: 170 SRELHISRCKAVLQVLMDHKYAWLFSEPVDPVALEIPDYPTIVKHPMDLGTIMAKLNRKE 349
S + + +C+ +L LM H++ W+F+ PVD V L+IPDY T++KHPMDLGTI +K+ E
Sbjct: 156 SNSMLMKQCETLLSRLMTHQFGWIFNNPVDVVELKIPDYFTVIKHPMDLGTIKSKMASGE 215

Query: 350 YGDLPLNFIQDVRLTFDNAMLYNPPGHEVNNSAKKMLAFFHKEWDKSATRSLAVSTPRTP 529
Y P +F DVRLTF NAM YNP G++V+ A+ + FF W K + L V+
Sbjct: 216 YLS-PFDFAADVRLTFSNAMTYNPRGNDVHFMAETLNKFFEMRW-KPIEKKLPVT----- 268

Query: 530 RHSAVSVKAF-SFEDKQILLENLQTLPP 610
+ V++ S D + +E +PP
Sbjct: 269 ----IDVESLPSRSDAHLEIETADRMPP 292


>tr|A5C0I5|A5C0I5_VITVI Putative uncharacterized protein OS=Vitis
vinifera GN=VITISV_007433 PE=4 SV=1
Length = 588

Score = 108 bits (269), Expect = 4e-22
Identities = 65/166 (39%), Positives = 89/166 (53%), Gaps = 24/166 (14%)
Frame = +2

Query: 191 RCKAVLQVLMDHKYAWLFSEPVDPVALEIPDYPTIVKHPMDLGTIMAKLNRKEYGDLPLN 370
+C ++L+ LM H W+F++PVDPVAL IPDY +I+ PMDLGTI +KL + Y
Sbjct: 73 QCTSILKXLMTHPAGWVFNQPVDPVALNIPDYFSIISKPMDLGTIKSKLEKNXYLATE-E 131

Query: 371 FIQDVRLTFDNAMLYNPPGHEVNNSAKKMLAFFHKEWDK-----------------SATR 499
F DVRLTF NAMLYNPP + V+ AKK+ F+ W S R
Sbjct: 132 FAADVRLTFANAMLYNPPSNNVHQMAKKLNDLFNTRWKTVDTNWSESSKVDPGKILSGGR 191

Query: 500 SLAVSTPRTPRHSAVSVKA--FSFEDKQILLENLQ-----TLPPHM 616
+++ R + S+ A SFEDKQ L + L +PP++
Sbjct: 192 GKTINSSRQKCSTTPSLHANSMSFEDKQKLRKELMEVSRGKMPPYL 237


>tr|A7QV74|A7QV74_VITVI Chromosome undetermined scaffold_186, whole
genome shotgun sequence OS=Vitis vinifera
GN=GSVIVT00007222001 PE=4 SV=1
Length = 456

Score = 107 bits (267), Expect = 6e-22
Identities = 65/166 (39%), Positives = 89/166 (53%), Gaps = 24/166 (14%)
Frame = +2

Query: 191 RCKAVLQVLMDHKYAWLFSEPVDPVALEIPDYPTIVKHPMDLGTIMAKLNRKEYGDLPLN 370
+C ++L+ LM H W+F++PVDPVAL IPDY +I+ PMDLGTI +KL + Y
Sbjct: 8 QCTSILKKLMTHPAGWVFNQPVDPVALNIPDYFSIISKPMDLGTIKSKLEKNMYLATE-E 66

Query: 371 FIQDVRLTFDNAMLYNPPGHEVNNSAKKMLAFFHKEWDK-----------------SATR 499
F DVRLTF NAMLYNPP + V+ AKK+ F+ W S R
Sbjct: 67 FAADVRLTFANAMLYNPPSNNVHQMAKKLNDLFNTRWKTVDTNWSESSKVDPGKILSGGR 126

Query: 500 SLAVSTPRTPRHSAVSVKA--FSFEDKQILLENLQ-----TLPPHM 616
+++ R + S+ A SFEDKQ L + L +PP++
Sbjct: 127 GKTINSSRQKCSTTPSLHANSMSFEDKQKLRKELMEVSRGKMPPYL 172


>tr|A7QS98|A7QS98_VITVI Chromosome chr3 scaffold_157, whole genome
shotgun sequence OS=Vitis vinifera GN=GSVIVT00005742001
PE=4 SV=1
Length = 537

Score = 103 bits (258), Expect = 7e-21
Identities = 52/121 (42%), Positives = 78/121 (64%), Gaps = 1/121 (0%)
Frame = +2

Query: 110 LEAEERPEIRESTEDDEEAASRELHISR-CKAVLQVLMDHKYAWLFSEPVDPVALEIPDY 286
+ +RP +S + +A+ + + C L LM HK++W+F+ PVD V + + DY
Sbjct: 145 IAGNKRPPPFDSGRGPKRSAAENASLMKLCGQTLTKLMKHKHSWVFNSPVDVVGMGLHDY 204

Query: 287 PTIVKHPMDLGTIMAKLNRKEYGDLPLNFIQDVRLTFDNAMLYNPPGHEVNNSAKKMLAF 466
I+K PMDLGT+ +K+ + Y D PL+F DVRLTFDNA+LYNP GH+V+ A+++LA
Sbjct: 205 HQIIKRPMDLGTVKSKIAKNLY-DSPLDFAADVRLTFDNALLYNPKGHDVHVMAEQLLAR 263

Query: 467 F 469
F
Sbjct: 264 F 264


>tr|A9RJI5|A9RJI5_PHYPA Predicted protein OS=Physcomitrella patens
subsp. patens GN=PHYPADRAFT_66961 PE=4 SV=1
Length = 694

Score = 103 bits (257), Expect = 9e-21
Identities = 67/199 (33%), Positives = 95/199 (47%), Gaps = 43/199 (21%)
Frame = +2

Query: 185 ISRCKAVLQVLMDHKYAWLFSEPVDPVALEIPDYPTIVKHPMDLGTIMAKLNRKEYGDLP 364
+ +C +L+ LM HK+ W+F+EPVD L + DY +I+K PMDLGTI KL+ K+Y P
Sbjct: 252 LKQCMTLLRKLMTHKHGWVFNEPVDAEKLGLHDYHSIIKKPMDLGTIKKKLHLKQYAS-P 310

Query: 365 LNFIQDVRLTFDNAMLYNPPGHEVNNSAKKMLAFFHKEWDK------------------- 487
L F +D+RLTF NAM YNP GH+V A+ + F + W
Sbjct: 311 LEFGEDIRLTFSNAMTYNPVGHDVYVMAELLKNMFEEWWKNMGRKVEEERRRCGKEEEML 370

Query: 488 ---------------------SATRSLAVS---TPRTPRHSAVSVKAFSFEDKQILLENL 595
S TR A S + PR V +A +FE+K+ L NL
Sbjct: 371 ANDEDSVEESGEVRRGERDVVSLTRGKASSRMGSQPKPRPEEVGKRAMTFEEKRKLSVNL 430

Query: 596 QTLPPHMQYAAVLLMSERS 652
+ LP V ++ +R+
Sbjct: 431 ERLPGDKLERIVQIIKKRN 449