DK950796
Clone id TST38A01NGRL0009_K11
Library
Length 655
Definition Adiantum capillus-veneris mRNA. clone: TST38A01NGRL0009_K11. 5' end sequence.
Accession
Tissue type prothallia
Developmental stage gametophyte
Contig ID -
Sequence
TCATTTCATGCAATCTTCTGCGGAAGAGTGCAACCATCAGAATGTCTGTCTTGTCAGAGC
CCAACTCCAGAAGCGAGATTGTGGAATTGGAAGGGTAATTGTCGTCGGAGCAGACGTTGT
GGCCGCCGCAGGAGGAGGAAGAAGAAGGCATCCTAAGCTCTAAGCCTCCACCCAGATCCG
TCATGGCTCCGGCAGTGGAGTACTCTGAGCCTCTGCTCGATGCCCTCCCGATAAGTTCTA
GGTCCGATGATCCGGCATGGAAGCAATTGAAGGGGGGAGGGTCGACCAGCGGGCAACCGC
AGCATGACTTGCAGTCTGAGGTGCACAACGTGGAAAAGGAGGTACCCATGCAGCAAGCCA
ACTGCTTTTTTCGCCTTGCTTTCCACTGGGTTCAGCCTCTTCTTTACATTGGAGGGGGGG
CGTCTTGGAGCTCACGGATGTTCCTGGTATCCCTGCCCAGGACCGCGCCCAGAAGAATGT
CCAGGATTTTCTCAAAGCGTGGAATGCTCGGAAGGCACAGAAACGCACCCCCTCAGTCTG
CAGAGCCCTTCTTCAGTGCTACTGGAGAGACGTGTTGTGGACAGGTTTCTTGGCCTTTCT
CAAAGGTGCAGGTACCGTTGCTGGGCCCATCTTTCTCTATTTCTTTGTTGATTAC
■■Homology search results ■■ -
sp_hit_id O15439
Definition sp|O15439|MRP4_HUMAN Multidrug resistance-associated protein 4 OS=Homo sapiens
Align length 83
Score (bit) 42.7
E-value 4.0e-06
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= DK950796|Adiantum capillus-veneris mRNA, clone:
TST38A01NGRL0009_K11, 5'
(655 letters)

Database: uniprot_sprot.fasta
412,525 sequences; 148,809,765 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

sp|O15439|MRP4_HUMAN Multidrug resistance-associated protein 4 O... 43 4e-06
sp|Q07DZ6|CFTR_ORNAN Cystic fibrosis transmembrane conductance r... 40 2e-05
sp|Q7GB25|MRP5_ARATH Multidrug resistance-associated protein 5 O... 49 3e-05
sp|Q8LGU1|MRP6_ARATH Multidrug resistance-associated protein 6 O... 48 4e-05
sp|Q9LZJ5|MRP10_ARATH Multidrug resistance-associated protein 10... 48 5e-05
sp|Q2QLH0|CFTR_OTOGA Cystic fibrosis transmembrane conductance r... 41 7e-05
sp|Q9LYS2|MRP14_ARATH Multidrug resistance-associated protein 14... 47 7e-05
sp|Q00PJ2|CFTR_ATEAB Cystic fibrosis transmembrane conductance r... 41 2e-04
sp|Q2QL83|CFTR_MICMU Cystic fibrosis transmembrane conductance r... 41 3e-04
sp|Q9TSP5|CFTR_PAPAN Cystic fibrosis transmembrane conductance r... 41 4e-04
sp|Q9TUQ2|CFTR_MACNE Cystic fibrosis transmembrane conductance r... 41 4e-04
sp|Q00553|CFTR_MACMU Cystic fibrosis transmembrane conductance r... 41 4e-04
sp|Q7JII7|CFTR_MACFU Cystic fibrosis transmembrane conductance r... 41 4e-04
sp|Q7JII8|CFTR_MACFA Cystic fibrosis transmembrane conductance r... 41 4e-04
sp|Q2IBA1|CFTR_CERAE Cystic fibrosis transmembrane conductance r... 41 4e-04
sp|Q2QLB4|CFTR_CALMO Cystic fibrosis transmembrane conductance r... 41 4e-04
sp|Q5D1Z7|CFTR_TRIVU Cystic fibrosis transmembrane conductance r... 36 4e-04
sp|Q7DM58|MRP4_ARATH Multidrug resistance-associated protein 4 O... 45 4e-04
sp|Q00554|CFTR_RABIT Cystic fibrosis transmembrane conductance r... 40 5e-04
sp|Q2QLC5|CFTR_CARPS Cystic fibrosis transmembrane conductance r... 40 7e-04
sp|Q6PQZ2|CFTR_PIG Cystic fibrosis transmembrane conductance reg... 37 7e-04
sp|Q07E16|CFTR_MUSPF Cystic fibrosis transmembrane conductance r... 39 9e-04
sp|Q5U820|CFTR_CANFA Cystic fibrosis transmembrane conductance r... 39 9e-04
sp|Q2QLF9|CFTR_CALJA Cystic fibrosis transmembrane conductance r... 40 9e-04
sp|Q07DV2|CFTR_AOTNA Cystic fibrosis transmembrane conductance r... 40 9e-04
sp|Q07E42|CFTR_DASNO Cystic fibrosis transmembrane conductance r... 39 0.001
sp|Q09YH0|CFTR_SAIBB Cystic fibrosis transmembrane conductance r... 40 0.001
sp|Q2IBE4|CFTR_PONAB Cystic fibrosis transmembrane conductance r... 39 0.001
sp|Q07DX5|CFTR_HYLLE Cystic fibrosis transmembrane conductance r... 39 0.001
sp|Q2QL74|CFTR_DIDMA Cystic fibrosis transmembrane conductance r... 37 0.001

>sp|O15439|MRP4_HUMAN Multidrug resistance-associated protein 4
OS=Homo sapiens GN=ABCC4 PE=1 SV=3
Length = 1325

Score = 42.7 bits (99), Expect(2) = 4e-06
Identities = 25/83 (30%), Positives = 42/83 (50%), Gaps = 6/83 (7%)
Frame = +2

Query: 425 LELTDVPGIPAQDRAQKNVQDFLKAWNAR------KAQKRTPSVCRALLQCYWRDVLWTG 586
LE D+ + +DR+Q ++ W+ AQK PS+ RA+++CYW+ L G
Sbjct: 39 LEEDDMYSVLPEDRSQHLGEELQGFWDKEVLRAENDAQK--PSLTRAIIKCYWKSYLVLG 96

Query: 587 FLAFLKGAGTVAGPIFLYFFVDY 655
++ + V PIFL ++Y
Sbjct: 97 IFTLIEESAKVIQPIFLGKIINY 119



Score = 28.1 bits (61), Expect(2) = 4e-06
Identities = 13/31 (41%), Positives = 17/31 (54%)
Frame = +3

Query: 321 VHNVEKEVPMQQANCFFRLAFHWVQPLLYIG 413
V+ K P+Q AN R+ F W+ PL IG
Sbjct: 4 VYQEVKPNPLQDANLCSRVFFWWLNPLFKIG 34


>sp|Q07DZ6|CFTR_ORNAN Cystic fibrosis transmembrane conductance
regulator OS=Ornithorhynchus anatinus GN=CFTR PE=3 SV=1
Length = 1484

Score = 40.4 bits (93), Expect(2) = 2e-05
Identities = 20/71 (28%), Positives = 34/71 (47%)
Frame = +2

Query: 425 LELTDVPGIPAQDRAQKNVQDFLKAWNARKAQKRTPSVCRALLQCYWRDVLWTGFLAFLK 604
LEL+D+ IP D A + + W+ A K+ P + AL +C++ ++ G L +L
Sbjct: 32 LELSDIYQIPTADSADNLSEKLEREWDRELASKKNPKLINALRRCFFWRFMFYGLLLYLG 91

Query: 605 GAGTVAGPIFL 637
P+ L
Sbjct: 92 EVTKAVQPLLL 102



Score = 27.7 bits (60), Expect(2) = 2e-05
Identities = 10/23 (43%), Positives = 16/23 (69%)
Frame = +3

Query: 345 PMQQANCFFRLAFHWVQPLLYIG 413
P+++AN F +L F W +P+L G
Sbjct: 5 PLERANLFSKLFFSWTKPILKKG 27


>sp|Q7GB25|MRP5_ARATH Multidrug resistance-associated protein 5
OS=Arabidopsis thaliana GN=MRP5 PE=2 SV=2
Length = 1514

Score = 48.5 bits (114), Expect = 3e-05
Identities = 23/79 (29%), Positives = 42/79 (53%), Gaps = 2/79 (2%)
Frame = +2

Query: 425 LELTDVPGIPAQDRAQKNVQDFLKAWNARKAQK--RTPSVCRALLQCYWRDVLWTGFLAF 598
LEL D+P + +DRA+ + + W K++ + PS+ RA+++ +W++ A
Sbjct: 256 LELKDIPLLAPRDRAKSSYKVLKSNWKRCKSENPSKPPSLARAIMKSFWKEAACNAVFAG 315

Query: 599 LKGAGTVAGPIFLYFFVDY 655
L + GP + +FVDY
Sbjct: 316 LNTLVSYVGPYLISYFVDY 334


>sp|Q8LGU1|MRP6_ARATH Multidrug resistance-associated protein 6
OS=Arabidopsis thaliana GN=MRP6 PE=2 SV=2
Length = 1295

Score = 48.1 bits (113), Expect = 4e-05
Identities = 29/100 (29%), Positives = 48/100 (48%), Gaps = 12/100 (12%)
Frame = +2

Query: 392 SASSLHWRGGVLEL--------TDVPGIPAQDRAQKNVQDFLKAWNA----RKAQKRTPS 535
S S W +L L D+P + +D AQ + F +AW+ + K
Sbjct: 51 SILSFSWMNPLLSLGFKKPLSPEDIPSVVPEDEAQLAYKKFSQAWDTLLGDESSTKERNL 110

Query: 536 VCRALLQCYWRDVLWTGFLAFLKGAGTVAGPIFLYFFVDY 655
V RA+++ Y+++ ++ AFL+ V+ P+ LY FVDY
Sbjct: 111 VFRAVVKVYFKENIFIAVFAFLRTFAVVSLPLMLYVFVDY 150


>sp|Q9LZJ5|MRP10_ARATH Multidrug resistance-associated protein 10
OS=Arabidopsis thaliana GN=MRP10 PE=1 SV=1
Length = 1539

Score = 47.8 bits (112), Expect = 5e-05
Identities = 23/77 (29%), Positives = 40/77 (51%)
Frame = +2

Query: 425 LELTDVPGIPAQDRAQKNVQDFLKAWNARKAQKRTPSVCRALLQCYWRDVLWTGFLAFLK 604
L L VP + + RA+K F W + R P V L++C+W+++ +T LA ++
Sbjct: 276 LNLDQVPTLSPEHRAEKLATLFESKWPKPQENSRNP-VRTTLIRCFWKEIAFTAVLAIIR 334

Query: 605 GAGTVAGPIFLYFFVDY 655
+ GP+ + FVD+
Sbjct: 335 LSVIYVGPVLIQSFVDF 351


>sp|Q2QLH0|CFTR_OTOGA Cystic fibrosis transmembrane conductance
regulator OS=Otolemur garnettii GN=CFTR PE=3 SV=1
Length = 1482

Score = 40.8 bits (94), Expect(2) = 7e-05
Identities = 20/71 (28%), Positives = 35/71 (49%)
Frame = +2

Query: 425 LELTDVPGIPAQDRAQKNVQDFLKAWNARKAQKRTPSVCRALLQCYWRDVLWTGFLAFLK 604
LEL+D+ IP+ D A + + W+ A K+ P + AL +C++ ++ G L +L
Sbjct: 32 LELSDIYQIPSADSADNLSEKLEREWDRELASKKNPKLINALRRCFFWRFMFYGILLYLG 91

Query: 605 GAGTVAGPIFL 637
P+ L
Sbjct: 92 EVTKAVQPLLL 102



Score = 25.8 bits (55), Expect(2) = 7e-05
Identities = 9/23 (39%), Positives = 16/23 (69%)
Frame = +3

Query: 345 PMQQANCFFRLAFHWVQPLLYIG 413
P+++A+ F +L F W +P+L G
Sbjct: 5 PLEKASVFSKLFFSWTRPILRKG 27


>sp|Q9LYS2|MRP14_ARATH Multidrug resistance-associated protein 14
OS=Arabidopsis thaliana GN=MRP14 PE=2 SV=1
Length = 1389

Score = 47.4 bits (111), Expect = 7e-05
Identities = 30/89 (33%), Positives = 45/89 (50%), Gaps = 5/89 (5%)
Frame = +2

Query: 398 SSLHWRGGV--LELTDVPGIPAQDRAQKNVQDF---LKAWNARKAQKRTPSVCRALLQCY 562
+SL RG V LE D+P + ++RA+ F L R PS+ + + C
Sbjct: 158 NSLIKRGNVKDLEEEDIPELRKEERAETCYSLFEENLIEQKRRLGSSCQPSILKVTVLCV 217

Query: 563 WRDVLWTGFLAFLKGAGTVAGPIFLYFFV 649
WR++L +GF AF+K AGP+ L F+
Sbjct: 218 WRELLTSGFFAFMKIVAVSAGPLLLNAFI 246


>sp|Q00PJ2|CFTR_ATEAB Cystic fibrosis transmembrane conductance
regulator OS=Atelerix albiventris GN=CFTR PE=3 SV=1
Length = 1483

Score = 41.2 bits (95), Expect(2) = 2e-04
Identities = 20/71 (28%), Positives = 35/71 (49%)
Frame = +2

Query: 425 LELTDVPGIPAQDRAQKNVQDFLKAWNARKAQKRTPSVCRALLQCYWRDVLWTGFLAFLK 604
LEL+D+ IP+ D A + + W+ A K+ P + AL +C++ ++ G L +L
Sbjct: 32 LELSDIYQIPSTDSADNLSEKLEREWDRELASKKNPKLINALRRCFFWKFMFYGILLYLG 91

Query: 605 GAGTVAGPIFL 637
P+ L
Sbjct: 92 EVTKAVQPLLL 102



Score = 23.5 bits (49), Expect(2) = 2e-04
Identities = 8/23 (34%), Positives = 15/23 (65%)
Frame = +3

Query: 345 PMQQANCFFRLAFHWVQPLLYIG 413
P+++A+ +L F W +P+L G
Sbjct: 5 PLEKASVISKLFFSWTRPILRKG 27


>sp|Q2QL83|CFTR_MICMU Cystic fibrosis transmembrane conductance
regulator OS=Microcebus murinus GN=CFTR PE=3 SV=1
Length = 1481

Score = 40.8 bits (94), Expect(2) = 3e-04
Identities = 20/71 (28%), Positives = 35/71 (49%)
Frame = +2

Query: 425 LELTDVPGIPAQDRAQKNVQDFLKAWNARKAQKRTPSVCRALLQCYWRDVLWTGFLAFLK 604
LEL+D+ IP+ D A + + W+ A K+ P + AL +C++ ++ G L +L
Sbjct: 32 LELSDIYQIPSADSADNLSEKLEREWDRELASKKNPKLINALRRCFFWRFMFYGILLYLG 91

Query: 605 GAGTVAGPIFL 637
P+ L
Sbjct: 92 EVTKAVQPLLL 102



Score = 23.5 bits (49), Expect(2) = 3e-04
Identities = 8/23 (34%), Positives = 15/23 (65%)
Frame = +3

Query: 345 PMQQANCFFRLAFHWVQPLLYIG 413
P+++A+ +L F W +P+L G
Sbjct: 5 PLEKASVLSKLFFSWTRPILRKG 27


>sp|Q9TSP5|CFTR_PAPAN Cystic fibrosis transmembrane conductance
regulator OS=Papio anubis GN=CFTR PE=3 SV=1
Length = 1481

Score = 40.8 bits (94), Expect(2) = 4e-04
Identities = 20/71 (28%), Positives = 35/71 (49%)
Frame = +2

Query: 425 LELTDVPGIPAQDRAQKNVQDFLKAWNARKAQKRTPSVCRALLQCYWRDVLWTGFLAFLK 604
LEL+D+ IP+ D A + + W+ A K+ P + AL +C++ ++ G L +L
Sbjct: 32 LELSDIYQIPSADSADNLSEKLEREWDRELASKKNPKLINALRRCFFWRFMFYGILLYLG 91

Query: 605 GAGTVAGPIFL 637
P+ L
Sbjct: 92 EVTKAVQPLLL 102



Score = 23.1 bits (48), Expect(2) = 4e-04
Identities = 8/23 (34%), Positives = 15/23 (65%)
Frame = +3

Query: 345 PMQQANCFFRLAFHWVQPLLYIG 413
P+++A+ +L F W +P+L G
Sbjct: 5 PLEKASVVSKLFFSWTRPILRKG 27


tr_hit_id A9U4V1
Definition tr|A9U4V1|A9U4V1_PHYPA ATP-binding cassette transporter, subfamily C, member 12, group MRP protein PpABCC12 OS=Physcomitrella patens subsp. patens
Align length 77
Score (bit) 53.9
E-value 5.0e-08
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= DK950796|Adiantum capillus-veneris mRNA, clone:
TST38A01NGRL0009_K11, 5'
(655 letters)

Database: uniprot_trembl.fasta
7,341,751 sequences; 2,391,615,440 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

tr|A9U4V1|A9U4V1_PHYPA ATP-binding cassette transporter, subfami... 54 5e-08
tr|A9RQ24|A9RQ24_PHYPA ATP-binding cassette transporter, subfami... 58 6e-07
tr|Q6QMG6|Q6QMG6_RAT Multidrug resistance-associated protein 4 O... 44 7e-06
tr|A7QTS7|A7QTS7_VITVI Chromosome undetermined scaffold_171, who... 47 1e-05
tr|A0JND8|A0JND8_BOVIN ABCC4 protein (Fragment) OS=Bos taurus GN... 47 1e-05
tr|A7P6T7|A7P6T7_VITVI Chromosome chr9 scaffold_7, whole genome ... 54 1e-05
tr|B6PNY8|B6PNY8_BRAFL Putative uncharacterized protein (Fragmen... 44 1e-05
tr|A7P6T6|A7P6T6_VITVI Chromosome chr9 scaffold_7, whole genome ... 53 1e-05
tr|A7QTU6|A7QTU6_VITVI Chromosome undetermined scaffold_171, who... 49 2e-05
tr|A5AYR5|A5AYR5_VITVI Putative uncharacterized protein OS=Vitis... 49 2e-05
tr|Q3TZN9|Q3TZN9_MOUSE Putative uncharacterized protein OS=Mus m... 44 2e-05
tr|B6LTD4|B6LTD4_BRAFL Putative uncharacterized protein OS=Branc... 43 2e-05
tr|Q53WJ5|Q53WJ5_ORYSJ Os05g0196100 protein OS=Oryza sativa subs... 44 3e-05
tr|A2Y198|A2Y198_ORYSI Putative uncharacterized protein OS=Oryza... 44 3e-05
tr|A3C8S2|A3C8S2_ORYSJ Putative uncharacterized protein OS=Oryza... 47 3e-05
tr|Q53QH6|Q53QH6_ORYSJ ABC transporter, putative OS=Oryza sativa... 47 3e-05
tr|B8BJ66|B8BJ66_ORYSI Putative uncharacterized protein OS=Oryza... 47 3e-05
tr|Q8IVZ4|Q8IVZ4_HUMAN ABCC4 protein OS=Homo sapiens PE=2 SV=1 43 5e-05
tr|A8K2Q2|A8K2Q2_HUMAN cDNA FLJ77042, highly similar to Homo sap... 43 5e-05
tr|B7Z5H4|B7Z5H4_HUMAN cDNA FLJ58088, highly similar to Multidru... 43 5e-05
tr|Q59DL1|Q59DL1_RAT ATP-binding cassette protein C4 OS=Rattus n... 42 6e-05
tr|A7QND2|A7QND2_VITVI Chromosome chr2 scaffold_132, whole genom... 48 8e-05
tr|A7Q1J8|A7Q1J8_VITVI Chromosome chr7 scaffold_44, whole genome... 50 9e-05
tr|Q8GU64|Q8GU64_ORYSJ cDNA, clone: J075142E09, full insert sequ... 50 1e-04
tr|Q0JMW1|Q0JMW1_ORYSJ Os01g0356400 protein OS=Oryza sativa subs... 50 1e-04
tr|A7QND7|A7QND7_VITVI Chromosome chr2 scaffold_132, whole genom... 50 1e-04
tr|A2ZSZ9|A2ZSZ9_ORYSJ Putative uncharacterized protein OS=Oryza... 50 1e-04
tr|A2WPT3|A2WPT3_ORYSI Putative uncharacterized protein OS=Oryza... 50 1e-04
tr|Q6Y3I1|Q6Y3I1_MAIZE Multidrug resistance associated protein 1... 50 2e-04
tr|A9TW55|A9TW55_PHYPA ATP-binding cassette transporter, subfami... 49 2e-04

>tr|A9U4V1|A9U4V1_PHYPA ATP-binding cassette transporter, subfamily
C, member 12, group MRP protein PpABCC12
OS=Physcomitrella patens subsp. patens GN=ppabcc12 PE=3
SV=1
Length = 1397

Score = 53.9 bits (128), Expect(2) = 5e-08
Identities = 27/77 (35%), Positives = 41/77 (53%)
Frame = +2

Query: 425 LELTDVPGIPAQDRAQKNVQDFLKAWNARKAQKRTPSVCRALLQCYWRDVLWTGFLAFLK 604
LE D+P + +D AQKN + F +A +K+ R SV AL CY++ +++ G A K
Sbjct: 168 LEQADIPLLGKEDEAQKNYEKFAQALRDQKSNNRQVSVFWALSSCYYKPMVYNGLYALGK 227

Query: 605 GAGTVAGPIFLYFFVDY 655
GP+ L F+ Y
Sbjct: 228 SITVSLGPVVLNTFIQY 244



Score = 26.9 bits (58), Expect(2) = 5e-08
Identities = 11/27 (40%), Positives = 15/27 (55%)
Frame = +3

Query: 333 EKEVPMQQANCFFRLAFHWVQPLLYIG 413
EK P A + R++F W+ PLL G
Sbjct: 137 EKVTPFATAGFYSRMSFSWLNPLLSSG 163


>tr|A9RQ24|A9RQ24_PHYPA ATP-binding cassette transporter, subfamily
C, member 13, group MRP protein PpABCC13
OS=Physcomitrella patens subsp. patens GN=ppabcc13 PE=3
SV=1
Length = 1361

Score = 57.8 bits (138), Expect = 6e-07
Identities = 32/79 (40%), Positives = 45/79 (56%), Gaps = 2/79 (2%)
Frame = +2

Query: 425 LELTDVPGIPAQDRAQKNVQDFLKAWNARKAQ--KRTPSVCRALLQCYWRDVLWTGFLAF 598
L L DVP + +AQ VQ FL AWN++K + + SV AL YW+ + + GF A
Sbjct: 144 LGLKDVPYLNKDLQAQSAVQKFLAAWNSQKERHPQEEQSVFWALATVYWKTMAFNGFCAL 203

Query: 599 LKGAGTVAGPIFLYFFVDY 655
K +GPIFL+FF+ +
Sbjct: 204 GKTLTLASGPIFLHFFIKF 222


>tr|Q6QMG6|Q6QMG6_RAT Multidrug resistance-associated protein 4
OS=Rattus norvegicus GN=Abcc4 PE=1 SV=1
Length = 1325

Score = 43.9 bits (102), Expect(2) = 7e-06
Identities = 23/81 (28%), Positives = 40/81 (49%), Gaps = 4/81 (4%)
Frame = +2

Query: 425 LELTDVPGIPAQDRAQKNVQDFLKAWNAR----KAQKRTPSVCRALLQCYWRDVLWTGFL 592
LE D+ + +DR++ ++ W+ K R PS+ +A+++CYW+ L G
Sbjct: 39 LEEDDMFSVLPEDRSKHLGEELQGYWDKEVLRAKKDARKPSLTKAIVKCYWKSYLILGIF 98

Query: 593 AFLKGAGTVAGPIFLYFFVDY 655
++ V PIFL +DY
Sbjct: 99 TLIEETTRVVQPIFLGKIIDY 119



Score = 29.6 bits (65), Expect(2) = 7e-06
Identities = 14/31 (45%), Positives = 16/31 (51%)
Frame = +3

Query: 321 VHNVEKEVPMQQANCFFRLAFHWVQPLLYIG 413
VH K P+Q AN RL F W+ PL G
Sbjct: 4 VHTEVKPNPLQDANLCSRLFFWWLNPLFKAG 34


>tr|A7QTS7|A7QTS7_VITVI Chromosome undetermined scaffold_171, whole
genome shotgun sequence OS=Vitis vinifera
GN=GSVIVT00006470001 PE=3 SV=1
Length = 1483

Score = 47.4 bits (111), Expect(2) = 1e-05
Identities = 24/80 (30%), Positives = 45/80 (56%), Gaps = 3/80 (3%)
Frame = +2

Query: 422 VLELTDVPGIPAQDRAQKNVQDFLKAWNARKAQKRT---PSVCRALLQCYWRDVLWTGFL 592
+LE D+P + D+A+ FL+ + ++ Q +T S+ R ++ C+W+++ +GF
Sbjct: 260 ILEEEDIPKLREVDQAKNCYLQFLEQLH-KQQQNQTLSHASILRTIISCHWKEIFISGFF 318

Query: 593 AFLKGAGTVAGPIFLYFFVD 652
A LK + GP+ L FV+
Sbjct: 319 ALLKTLSLLTGPLLLKAFVE 338



Score = 25.8 bits (55), Expect(2) = 1e-05
Identities = 19/68 (27%), Positives = 28/68 (41%), Gaps = 1/68 (1%)
Frame = +3

Query: 213 LLDALPISSRSDDPAWKQLKGGGS-TSGQPQHDLQSEVHNVEKEVPMQQANCFFRLAFHW 389
LL A DD + + + G G T + + SE + P A F R+ F W
Sbjct: 189 LLIACVFKDYKDDESEETVNGSGLYTPLKEETPGNSEADSGSFATPFATAGFFSRMFFWW 248

Query: 390 VQPLLYIG 413
+ PL+ G
Sbjct: 249 LNPLMRKG 256


>tr|A0JND8|A0JND8_BOVIN ABCC4 protein (Fragment) OS=Bos taurus
GN=ABCC4 PE=2 SV=1
Length = 501

Score = 47.4 bits (111), Expect(2) = 1e-05
Identities = 27/81 (33%), Positives = 45/81 (55%), Gaps = 4/81 (4%)
Frame = +2

Query: 425 LELTDVPGIPAQDRAQKNVQDFLKAWN--ARKAQKRT--PSVCRALLQCYWRDVLWTGFL 592
LE D+ + +DR+Q+ ++ W+ ++AQK + PS+ +A+++CYW+ L G
Sbjct: 39 LEPDDMYSVFPEDRSQRLGEELQGHWDQEVKRAQKDSHEPSLMKAIVKCYWKSYLIWGMF 98

Query: 593 AFLKGAGTVAGPIFLYFFVDY 655
FL+ V PIFL V Y
Sbjct: 99 TFLEEGTKVVQPIFLGKMVSY 119



Score = 25.8 bits (55), Expect(2) = 1e-05
Identities = 12/26 (46%), Positives = 15/26 (57%)
Frame = +3

Query: 336 KEVPMQQANCFFRLAFHWVQPLLYIG 413
K P+Q+AN RL W+ PL IG
Sbjct: 9 KTSPVQKANFCSRLFVWWLNPLFKIG 34


>tr|A7P6T7|A7P6T7_VITVI Chromosome chr9 scaffold_7, whole genome
shotgun sequence OS=Vitis vinifera GN=GSVIVT00034197001
PE=3 SV=1
Length = 1307

Score = 53.5 bits (127), Expect = 1e-05
Identities = 27/81 (33%), Positives = 39/81 (48%), Gaps = 4/81 (4%)
Frame = +2

Query: 425 LELTDVPGIPAQDRAQKNVQDFLKAWNARKAQKRTPSVCRALLQC----YWRDVLWTGFL 592
L L D+P + ++D A+ Q F AW + +K + C +LQ YW++ L G
Sbjct: 73 LVLEDIPSLVSEDGAELAYQKFAHAWEQLQKEKTPNNSCNLVLQALARVYWKETLSAGIF 132

Query: 593 AFLKGAGTVAGPIFLYFFVDY 655
A K V P+ LY FV Y
Sbjct: 133 ALFKTISVVVSPLLLYAFVKY 153


>tr|B6PNY8|B6PNY8_BRAFL Putative uncharacterized protein (Fragment)
OS=Branchiostoma floridae GN=BRAFLDRAFT_254173 PE=4 SV=1
Length = 1308

Score = 43.9 bits (102), Expect(2) = 1e-05
Identities = 24/80 (30%), Positives = 40/80 (50%), Gaps = 3/80 (3%)
Frame = +2

Query: 425 LELTDVPGIPAQDRAQKNVQDFLKAWNA---RKAQKRTPSVCRALLQCYWRDVLWTGFLA 595
LE D+ + +D +QK D + WN + + + PS+ RA ++CY G +A
Sbjct: 39 LEEKDMYNVKYEDSSQKQCDDLEREWNKELQKVGRSQKPSLLRAAIRCYAPGWSLLGIIA 98

Query: 596 FLKGAGTVAGPIFLYFFVDY 655
F++ A V P+ L V+Y
Sbjct: 99 FIEEATKVVSPVLLGKLVEY 118



Score = 28.9 bits (63), Expect(2) = 1e-05
Identities = 11/28 (39%), Positives = 17/28 (60%)
Frame = +3

Query: 330 VEKEVPMQQANCFFRLAFHWVQPLLYIG 413
+ K P+++AN +L F W+ PL Y G
Sbjct: 7 IVKPNPIEKANVLSKLFFWWLNPLFYTG 34


>tr|A7P6T6|A7P6T6_VITVI Chromosome chr9 scaffold_7, whole genome
shotgun sequence OS=Vitis vinifera GN=GSVIVT00034196001
PE=3 SV=1
Length = 1456

Score = 53.1 bits (126), Expect = 1e-05
Identities = 25/81 (30%), Positives = 43/81 (53%), Gaps = 4/81 (4%)
Frame = +2

Query: 425 LELTDVPGIPAQDRAQKNVQDFLKAWNARKAQKRTPS----VCRALLQCYWRDVLWTGFL 592
L L D+P + +D A+ ++F AW + +K + + V RAL + YW++ ++
Sbjct: 218 LVLEDIPSLTPEDEAELAYKNFAHAWELLQREKNSTNTSNLVLRALAKVYWKETVFVAIC 277

Query: 593 AFLKGAGTVAGPIFLYFFVDY 655
A L+ V P+ LY FV+Y
Sbjct: 278 ALLRTISVVVSPLLLYAFVNY 298


>tr|A7QTU6|A7QTU6_VITVI Chromosome undetermined scaffold_171, whole
genome shotgun sequence OS=Vitis vinifera
GN=GSVIVT00006491001 PE=3 SV=1
Length = 1480

Score = 49.3 bits (116), Expect(2) = 2e-05
Identities = 25/77 (32%), Positives = 42/77 (54%), Gaps = 2/77 (2%)
Frame = +2

Query: 425 LELTDVPGIPAQDRAQKNVQDFLKAWNARKAQKRT--PSVCRALLQCYWRDVLWTGFLAF 598
LE D+P + +DRA+ FL+ +K + + PS+ R ++ CYW+D+ +GF A
Sbjct: 259 LENEDIPKLREEDRAESCYLQFLEELIKQKQIEPSSQPSILRVIILCYWKDIFISGFFAL 318

Query: 599 LKGAGTVAGPIFLYFFV 649
+K GP+ L F+
Sbjct: 319 VKILTLSTGPLLLNAFI 335



Score = 23.1 bits (48), Expect(2) = 2e-05
Identities = 10/36 (27%), Positives = 18/36 (50%)
Frame = +3

Query: 306 DLQSEVHNVEKEVPMQQANCFFRLAFHWVQPLLYIG 413
D ++ +V P +A F ++F W+ PL+ G
Sbjct: 219 DGSAKTDSVGDVTPFAKAGFFSSMSFWWLNPLMKRG 254


>tr|A5AYR5|A5AYR5_VITVI Putative uncharacterized protein OS=Vitis
vinifera GN=VITISV_018996 PE=3 SV=1
Length = 1480

Score = 49.3 bits (116), Expect(2) = 2e-05
Identities = 25/77 (32%), Positives = 42/77 (54%), Gaps = 2/77 (2%)
Frame = +2

Query: 425 LELTDVPGIPAQDRAQKNVQDFLKAWNARKAQKRT--PSVCRALLQCYWRDVLWTGFLAF 598
LE D+P + +DRA+ FL+ +K + + PS+ R ++ CYW+D+ +GF A
Sbjct: 259 LENEDIPKLREEDRAESCYLQFLEELIKQKQIEPSSQPSILRVIILCYWKDIFISGFFAL 318

Query: 599 LKGAGTVAGPIFLYFFV 649
+K GP+ L F+
Sbjct: 319 VKILTLSTGPLLLNAFI 335



Score = 23.1 bits (48), Expect(2) = 2e-05
Identities = 10/36 (27%), Positives = 18/36 (50%)
Frame = +3

Query: 306 DLQSEVHNVEKEVPMQQANCFFRLAFHWVQPLLYIG 413
D ++ +V P +A F ++F W+ PL+ G
Sbjct: 219 DGSAKTDSVGDVTPFAKAGFFSSMSFWWLNPLMKRG 254