DK950805
Clone id TST38A01NGRL0009_K22
Library
Length 634
Definition Adiantum capillus-veneris mRNA. clone: TST38A01NGRL0009_K22. 5' end sequence.
Accession
Tissue type prothallia
Developmental stage gametophyte
Contig ID -
Sequence
GTGCCGCTCTACCTAGGTGCTTGGCGAACAGAGGAGAGCAAGGACCAAGAAAACTATATC
CTCCTCCTCTCAACATTACTTGTGTATCGTCACAGCAAGAGGCCGTCGAAATGAGCTCGA
CAGTCATGGAGATGAGCAGCAGCGCCATGAATGCTCTCTCCTGTGCGAGCCTCTCTGTGC
CAGTTATCCCTCGGGCGCTGGTCCTCCTCTCCTCTGTTCGCCAATCACCTGGCTATGCCC
AGCTTTGAGCTTTCTTTGTGCCGCTCTACCTAGGTGCTTCCTCCTCTCCTTCAAAGCCCC
TCACCATAGCGAACTCATACAACCCTAGGCAACCTTTTGATAGAAGCTTTAGAAGGGACC
AGCCAGATCGATATGGATCCCAACAAGATGCTACAGCCTAGAGAGCCCAATTCTATGCAG
ACCATTATTACGGATGTCATGCTTGTAGGTTACTTAGTCTCTTTGCCCACACACAGAGAT
GGGTATCTTCCAGCAGATGACTTCGGCTTTACGGGTGGATTTTCTATTCTGTGCAAACTT
TTCAAGGAGGGTCGAGAGAGTACTGTGCGCATTGTATCTCGTGGTGGGGCAGTAAGGGAG
ATTGTTTCTGTGAAAAAGCCTAAGTTTGCCCCTC
■■Homology search results ■■ -
sp_hit_id Q9ULF5
Definition sp|Q9ULF5|S39AA_HUMAN Zinc transporter ZIP10 OS=Homo sapiens
Align length 77
Score (bit) 32.0
E-value 2.7
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= DK950805|Adiantum capillus-veneris mRNA, clone:
TST38A01NGRL0009_K22, 5'
(634 letters)

Database: uniprot_sprot.fasta
412,525 sequences; 148,809,765 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

sp|Q9ULF5|S39AA_HUMAN Zinc transporter ZIP10 OS=Homo sapiens GN=... 32 2.7
sp|A2A5X5|KR10D_MOUSE Putative keratin-associated protein 10-lik... 31 4.7
sp|P21671|PLCD4_BOVIN 1-phosphatidylinositol-4,5-bisphosphate ph... 30 8.0
sp|A2ARV4|LRP2_MOUSE Low-density lipoprotein receptor-related pr... 30 8.0

>sp|Q9ULF5|S39AA_HUMAN Zinc transporter ZIP10 OS=Homo sapiens
GN=SLC39A10 PE=1 SV=2
Length = 831

Score = 32.0 bits (71), Expect = 2.7
Identities = 25/77 (32%), Positives = 33/77 (42%)
Frame = +2

Query: 23 GEQRRARTKKTISSSSQHYLCIVTARGRRNELDSHGDEQQRHECSLLCEPLCASYPSGAG 202
GE R R ++ + I++ R NE D H HEC L L Y GA
Sbjct: 303 GELRHTRKREAPHVKNN---AIISLRKDLNEDDHH------HEC-LNVTQLLKYYGHGAN 352

Query: 203 PPLLCSPITWLCPALSF 253
P+ T+LCPAL +
Sbjct: 353 SPISTDLFTYLCPALLY 369


>sp|A2A5X5|KR10D_MOUSE Putative keratin-associated protein 10-like
ENSP00000375147 homolog OS=Mus musculus PE=3 SV=1
Length = 502

Score = 31.2 bits (69), Expect = 4.7
Identities = 28/93 (30%), Positives = 38/93 (40%)
Frame = +2

Query: 164 CEPLCASYPSGAGPPLLCSPITWLCPALSFLCAALPRCFLLSFKAPHHSELIQP*ATF** 343
C+P C Y + C PI+ CP+ S P C A S + QP
Sbjct: 318 CQPSC--YIVKRCRSVSCEPIS--CPSPS----CQPACCRPGSSA---SAICQPAC---- 362

Query: 344 KL*KGPARSIWIPTRCYSLESPILCRPLLRMSC 442
P R+ +IP+ C SP+ CRP+ R C
Sbjct: 363 -----PPRTFYIPSSCKPPCSPVSCRPICRPIC 390


>sp|P21671|PLCD4_BOVIN 1-phosphatidylinositol-4,5-bisphosphate
phosphodiesterase delta-4 OS=Bos taurus GN=PLCD4 PE=1
SV=2
Length = 791

Score = 30.4 bits (67), Expect = 8.0
Identities = 23/61 (37%), Positives = 27/61 (44%), Gaps = 7/61 (11%)
Frame = +2

Query: 131 DEQQRHECSLLCEPLCASYPSGA---GPPLLC----SPITWLCPALSFLCAALPRCFLLS 289
D+++ C LLC PLC + A P LL P LCPALS L L S
Sbjct: 477 DKKKVVMCPLLCRPLCCQIMAQAPISKPGLLLFPKQKPKAILCPALSALVVYLKAVTFYS 536

Query: 290 F 292
F
Sbjct: 537 F 537


>sp|A2ARV4|LRP2_MOUSE Low-density lipoprotein receptor-related protein
2 OS=Mus musculus GN=Lrp2 PE=1 SV=1
Length = 4660

Score = 30.4 bits (67), Expect = 8.0
Identities = 18/55 (32%), Positives = 25/55 (45%), Gaps = 1/55 (1%)
Frame = +2

Query: 77 YLCIVTARGRRNELDSHGDEQQ-RHECSLLCEPLCASYPSGAGPPLLCSPITWLC 238
+LC++ A GR + D Q + LC P+C+S G C PI W C
Sbjct: 3480 HLCLIKAGGRGFTCECPDDFQTVQLRDRTLCMPMCSSTQFLCGNNEKCIPIWWKC 3534


tr_hit_id Q69NC7
Definition tr|Q69NC7|Q69NC7_ORYSJ Putative uncharacterized protein OJ1742_G01.31 OS=Oryza sativa subsp. japonica
Align length 69
Score (bit) 35.4
E-value 2.9
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= DK950805|Adiantum capillus-veneris mRNA, clone:
TST38A01NGRL0009_K22, 5'
(634 letters)

Database: uniprot_trembl.fasta
7,341,751 sequences; 2,391,615,440 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

tr|Q69NC7|Q69NC7_ORYSJ Putative uncharacterized protein OJ1742_G... 35 2.9
tr|A8L003|A8L003_FRASN Putative uncharacterized protein OS=Frank... 34 6.4
tr|A7SUX5|A7SUX5_NEMVE Predicted protein (Fragment) OS=Nematoste... 34 6.5

>tr|Q69NC7|Q69NC7_ORYSJ Putative uncharacterized protein
OJ1742_G01.31 OS=Oryza sativa subsp. japonica
GN=OJ1742_G01.31 PE=4 SV=1
Length = 124

Score = 35.4 bits (80), Expect = 2.9
Identities = 22/69 (31%), Positives = 33/69 (47%), Gaps = 5/69 (7%)
Frame = +2

Query: 83 CIVTARGRRNELDSHGDEQQRHECSLLCEPLCASYP---SGAG--PPLLCSPITWLCPAL 247
C T+R R +++ + DE+ L + L P SG G P L PIT+ C +
Sbjct: 30 CATTSRHRAMQIEPNDDEEASSRAEALHKNLITRLPVQISGEGVVPEALLVPITYCCISA 89

Query: 248 SFLCAALPR 274
+CAA P+
Sbjct: 90 KTMCAAGPK 98


>tr|A8L003|A8L003_FRASN Putative uncharacterized protein OS=Frankia
sp. (strain EAN1pec) GN=Franean1_0779 PE=3 SV=1
Length = 268

Score = 34.3 bits (77), Expect = 6.4
Identities = 23/67 (34%), Positives = 32/67 (47%)
Frame = -3

Query: 629 ANLGFFTETISLTAPPRDTMRTVLSRPSLKSLHRIENPPVKPKSSAGRYPSLCVGKETK* 450
A L E+ L PPR + T RP +S H + PPV P S++ PSL +
Sbjct: 149 ARLARRVESFDLLRPPRLMLTTSSERPGRRSGHGLIAPPVSP-SASSMSPSLSSVSTSTS 207

Query: 449 PTSMTSV 429
P S +S+
Sbjct: 208 PVSASSL 214


>tr|A7SUX5|A7SUX5_NEMVE Predicted protein (Fragment) OS=Nematostella
vectensis GN=v1g133066 PE=4 SV=1
Length = 185

Score = 34.3 bits (77), Expect = 6.5
Identities = 18/38 (47%), Positives = 20/38 (52%)
Frame = +2

Query: 158 LLCEPLCASYPSGAGPPLLCSPITWLCPALSFLCAALP 271
LLC+PL PLLC P+ LC LS LC LP
Sbjct: 77 LLCQPL----------PLLCHPLPLLCHPLSLLCHPLP 104