DK950825
Clone id TST38A01NGRL0009_L18
Library
Length 677
Definition Adiantum capillus-veneris mRNA. clone: TST38A01NGRL0009_L18. 5' end sequence.
Accession
Tissue type prothallia
Developmental stage gametophyte
Contig ID
Sequence
CGATCGCGCAAGCTGCTGACAGATTCTCGCCCTCCGTTAACACTTTGGCTATGGAGAAGT
TCATCCGCAGACAGCAGGTTTTGTTGGAGCATCTGCGTCCTTCCGAAAGTCCCTCTACAA
ACTTGGTGGCATCACCTTGCGCAGCTGGTGACAGTGCTGCATATGAGAGAACAACCGATT
TCTATGATGATGTTGTCATTGTCGCGGCTTACCGAACACCTGTCTGCAAAGCAAAGAGAG
GTGGATTTAAGGACACCTATCCTGATGATTTGTTAGCTCCAGTACTCAAGGCAGTGGTTG
AGAGAACTGGGGTAAACCCTGCAGAGGTTGGGGATATTGTTGTTGGCACAGTGCTTGCTC
CAGGATCACAACGTGCAAATGAGTGCCGCATGGCTTCATTTTATGCTGGATTTCCAGAAA
CTGTGCCTGTTCACACTGTCAACAGACAATGCTCCTCTGGTCTGCAGGCTGTAGCTGCTG
TTGCTGCATCCATCAAAGCAGGATATTATGATATAGGCATTGGAGCTGGGCTGGAGTCTA
TGACTGCTAATCCCATGGCCTGGGAAGGATCTGTCAATCCTAGGGTTGAGACTATTCAGA
AGGTTCAGGATTGCCTTTTACCAATGGGCGTCACATCCAAGAATGTTGCTGAGCGGTTTG
ATGTGTCACGAAAAGCT
■■Homology search results ■■ -
sp_hit_id Q56WD9
Definition sp|Q56WD9|THIK2_ARATH 3-ketoacyl-CoA thiolase 2, peroxisomal OS=Arabidopsis thaliana
Align length 212
Score (bit) 313.0
E-value 7.0e-85
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= DK950825|Adiantum capillus-veneris mRNA, clone:
TST38A01NGRL0009_L18, 5'
(677 letters)

Database: uniprot_sprot.fasta
412,525 sequences; 148,809,765 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

sp|Q56WD9|THIK2_ARATH 3-ketoacyl-CoA thiolase 2, peroxisomal OS=... 313 7e-85
sp|Q8LF48|THIK1_ARATH 3-ketoacyl-CoA thiolase 1, peroxisomal OS=... 284 3e-76
sp|Q570C8|THIK5_ARATH 3-ketoacyl-CoA thiolase 5, peroxisomal OS=... 247 5e-65
sp|Q8VCH0|THIKB_MOUSE 3-ketoacyl-CoA thiolase B, peroxisomal OS=... 176 1e-43
sp|P07871|THIKB_RAT 3-ketoacyl-CoA thiolase B, peroxisomal OS=Ra... 175 2e-43
sp|Q921H8|THIKA_MOUSE 3-ketoacyl-CoA thiolase A, peroxisomal OS=... 173 9e-43
sp|P09110|THIK_HUMAN 3-ketoacyl-CoA thiolase, peroxisomal OS=Hom... 170 7e-42
sp|P21775|THIKA_RAT 3-ketoacyl-CoA thiolase A, peroxisomal OS=Ra... 169 2e-41
sp|Q05493|THIK_YARLI 3-ketoacyl-CoA thiolase, peroxisomal OS=Yar... 138 2e-32
sp|P33291|THIKB_CANTR 3-ketoacyl-CoA thiolase B, peroxisomal OS=... 112 2e-24
sp|P33290|THIKA_CANTR 3-ketoacyl-CoA thiolase A, peroxisomal OS=... 110 9e-24
sp|Q2YVF5|THLA_STAAB Probable acetyl-CoA acyltransferase OS=Stap... 105 2e-22
sp|Q5HIU0|THLA_STAAC Probable acetyl-CoA acyltransferase OS=Stap... 105 3e-22
sp|O32177|FADA_BACSU 3-ketoacyl-CoA thiolase OS=Bacillus subtili... 105 3e-22
sp|Q6GJW4|THLA_STAAR Probable acetyl-CoA acyltransferase OS=Stap... 103 6e-22
sp|Q8NY95|THLA_STAAW Probable acetyl-CoA acyltransferase OS=Stap... 103 8e-22
sp|Q6GCB8|THLA_STAAS Probable acetyl-CoA acyltransferase OS=Stap... 103 8e-22
sp|Q7A7L2|THLA_STAAN Probable acetyl-CoA acyltransferase OS=Stap... 103 8e-22
sp|Q99WM3|THLA_STAAM Probable acetyl-CoA acyltransferase OS=Stap... 103 8e-22
sp|Q2G124|THLA_STAA8 Probable acetyl-CoA acyltransferase OS=Stap... 103 8e-22
sp|Q2FJQ9|THLA_STAA3 Probable acetyl-CoA acyltransferase OS=Stap... 103 8e-22
sp|Q8CQN7|THLA_STAES Probable acetyl-CoA acyltransferase OS=Stap... 98 4e-20
sp|Q5HS07|THLA_STAEQ Probable acetyl-CoA acyltransferase OS=Stap... 98 4e-20
sp|P27796|THIK_YEAST 3-ketoacyl-CoA thiolase, peroxisomal OS=Sac... 98 5e-20
sp|P14611|THIL_RALEH Acetyl-CoA acetyltransferase OS=Ralstonia e... 94 9e-19
sp|Q1QUW9|FADA_CHRSD 3-ketoacyl-CoA thiolase OS=Chromohalobacter... 91 7e-18
sp|P45359|THLA_CLOAB Acetyl-CoA acetyltransferase OS=Clostridium... 90 1e-17
sp|Q9ZHI1|THIL_CHRVO Acetyl-CoA acetyltransferase OS=Chromobacte... 88 4e-17
sp|Q66FR9|FADA_YERPS 3-ketoacyl-CoA thiolase OS=Yersinia pseudot... 84 9e-16
sp|A4TR28|FADA_YERPP 3-ketoacyl-CoA thiolase OS=Yersinia pestis ... 84 9e-16

>sp|Q56WD9|THIK2_ARATH 3-ketoacyl-CoA thiolase 2, peroxisomal
OS=Arabidopsis thaliana GN=PED1 PE=1 SV=2
Length = 462

Score = 313 bits (801), Expect = 7e-85
Identities = 157/212 (74%), Positives = 180/212 (84%), Gaps = 4/212 (1%)
Frame = +3

Query: 51 MEKFIRRQQVLLEHLRPSESPSTN----LVASPCAAGDSAAYERTTDFYDDVVIVAAYRT 218
MEK I RQ+VLLEHLRPS S S N L AS C AGDSAAY+RT+ + DDVVIVAA+RT
Sbjct: 1 MEKAIERQRVLLEHLRPSSSSSHNYEASLSASACLAGDSAAYQRTSLYGDDVVIVAAHRT 60

Query: 219 PVCKAKRGGFKDTYPDDLLAPVLKAVVERTGVNPAEVGDIVVGTVLAPGSQRANECRMAS 398
P+CK+KRG FKDTYPDDLLAPVL+A++E+T +NP+EVGDIVVGTVLAPGSQRA+ECRMA+
Sbjct: 61 PLCKSKRGNFKDTYPDDLLAPVLRALIEKTNLNPSEVGDIVVGTVLAPGSQRASECRMAA 120

Query: 399 FYAGFPETVPVHTVNRQCSSGLQXXXXXXXSIKAGYYDIGIGAGLESMTANPMAWEGSVN 578
FYAGFPETV V TVNRQCSSGLQ +IKAG+YDIGIGAGLESMT NPMAWEGSVN
Sbjct: 121 FYAGFPETVAVRTVNRQCSSGLQAVADVAAAIKAGFYDIGIGAGLESMTTNPMAWEGSVN 180

Query: 579 PRVETIQKVQDCLLPMGVTSKNVAERFDVSRK 674
P V+ + Q+CLLPMGVTS+NVA+RF VSR+
Sbjct: 181 PAVKKFAQAQNCLLPMGVTSENVAQRFGVSRQ 212


>sp|Q8LF48|THIK1_ARATH 3-ketoacyl-CoA thiolase 1, peroxisomal
OS=Arabidopsis thaliana GN=KAT1 PE=1 SV=2
Length = 443

Score = 284 bits (727), Expect = 3e-76
Identities = 139/208 (66%), Positives = 168/208 (80%)
Frame = +3

Query: 51 MEKFIRRQQVLLEHLRPSESPSTNLVASPCAAGDSAAYERTTDFYDDVVIVAAYRTPVCK 230
MEK RQ++LL HL+PS S +L AS C + DSAAY+ + DDVVIVAA RT +CK
Sbjct: 1 MEKATERQRILLRHLQPSSSSDASLSASACLSKDSAAYQ----YGDDVVIVAAQRTALCK 56

Query: 231 AKRGGFKDTYPDDLLAPVLKAVVERTGVNPAEVGDIVVGTVLAPGSQRANECRMASFYAG 410
AKRG FKDT+PD+LLA VL+A++E+T VNP+EVGDIVVGTVL PGSQRA+ECRMA+FYAG
Sbjct: 57 AKRGSFKDTFPDELLASVLRALIEKTNVNPSEVGDIVVGTVLGPGSQRASECRMAAFYAG 116

Query: 411 FPETVPVHTVNRQCSSGLQXXXXXXXSIKAGYYDIGIGAGLESMTANPMAWEGSVNPRVE 590
FPETVP+ TVNRQCSSGLQ +IKAG+YDIGIGAGLESMT NP W+GSVNP V+
Sbjct: 117 FPETVPIRTVNRQCSSGLQAVADVAAAIKAGFYDIGIGAGLESMTTNPRGWKGSVNPNVK 176

Query: 591 TIQKVQDCLLPMGVTSKNVAERFDVSRK 674
++ +CLLPMG+TS+NVA RF+VSR+
Sbjct: 177 KFEQAHNCLLPMGITSENVAHRFNVSRE 204


>sp|Q570C8|THIK5_ARATH 3-ketoacyl-CoA thiolase 5, peroxisomal
OS=Arabidopsis thaliana GN=KAT5 PE=2 SV=2
Length = 457

Score = 247 bits (630), Expect = 5e-65
Identities = 126/213 (59%), Positives = 158/213 (74%), Gaps = 5/213 (2%)
Frame = +3

Query: 51 MEKFIRRQQVLLEHLRPSESPSTNLVASPCAAGDSAAYERTTD---FYDDVVIVAAYRTP 221
ME+ + RQ++LL HL P S +++L P + F DD+VIVAAYRT
Sbjct: 1 MERAMERQKILLRHLNPVSSSNSSLKHEPSLLSPVNCVSEVSPMAAFGDDIVIVAAYRTA 60

Query: 222 VCKAKRGGFKDTYPDDLLAPVLKAVVERTGVNPAEVGDIVVGTVLAPGSQRANECRMASF 401
+CKA+RGGFKDT PDDLLA VLKAVVERT ++P+EVGDIVVGTV+APGSQRA ECR+A++
Sbjct: 61 ICKARRGGFKDTLPDDLLASVLKAVVERTSLDPSEVGDIVVGTVIAPGSQRAMECRVAAY 120

Query: 402 YAGFPETVPVHTVNRQCSSGLQXXXXXXXSIKAGYYDIGIGAGLESMTANPMAWEG--SV 575
+AGFP++VPV TVNRQCSSGLQ SI+AGYYDIGIGAG+ESM+ + + G
Sbjct: 121 FAGFPDSVPVRTVNRQCSSGLQAVADVAASIRAGYYDIGIGAGVESMSTDHIPGGGFHGS 180

Query: 576 NPRVETIQKVQDCLLPMGVTSKNVAERFDVSRK 674
NPR + K +DCLLPMG+TS+NVAERF V+R+
Sbjct: 181 NPRAQDFPKARDCLLPMGITSENVAERFGVTRE 213


>sp|Q8VCH0|THIKB_MOUSE 3-ketoacyl-CoA thiolase B, peroxisomal OS=Mus
musculus GN=Acaa1b PE=2 SV=1
Length = 424

Score = 176 bits (446), Expect = 1e-43
Identities = 98/204 (48%), Positives = 131/204 (64%)
Frame = +3

Query: 63 IRRQQVLLEHLRPSESPSTNLVASPCAAGDSAAYERTTDFYDDVVIVAAYRTPVCKAKRG 242
+ R QV+L HL S+ L A+PC+AG A DVV+V RTP+ +A RG
Sbjct: 1 MHRLQVVLGHLAGRPESSSALQAAPCSAGFLQASA------SDVVVVHGRRTPIGRASRG 54

Query: 243 GFKDTYPDDLLAPVLKAVVERTGVNPAEVGDIVVGTVLAPGSQRANECRMASFYAGFPET 422
FKDT PD+LL+ VL AV++ + P ++GDI VG VL PG+ A R+A F +G PET
Sbjct: 55 CFKDTTPDELLSAVLTAVLQDVKLKPEQLGDISVGNVLQPGAG-AIMARIAQFLSGIPET 113

Query: 423 VPVHTVNRQCSSGLQXXXXXXXSIKAGYYDIGIGAGLESMTANPMAWEGSVNPRVETIQK 602
VP+ TVNRQCSSGLQ I+ G YDIG+ G+ESMT + G+++ R+ +K
Sbjct: 114 VPLSTVNRQCSSGLQAVANIAGGIRNGSYDIGMACGVESMTLSQRGNHGNISSRLLENEK 173

Query: 603 VQDCLLPMGVTSKNVAERFDVSRK 674
+DCL+PMG+TS+NVAERF VSR+
Sbjct: 174 ARDCLIPMGITSENVAERFGVSRQ 197


>sp|P07871|THIKB_RAT 3-ketoacyl-CoA thiolase B, peroxisomal
OS=Rattus norvegicus GN=Acaa1b PE=2 SV=2
Length = 424

Score = 175 bits (444), Expect = 2e-43
Identities = 97/204 (47%), Positives = 130/204 (63%)
Frame = +3

Query: 63 IRRQQVLLEHLRPSESPSTNLVASPCAAGDSAAYERTTDFYDDVVIVAAYRTPVCKAKRG 242
+ R QV+L HL S+ L A+PC+AG A DVV+V RTP+ +A RG
Sbjct: 1 MHRLQVVLGHLAGRSESSSALQAAPCSAGFPQASA------SDVVVVHGRRTPIGRAGRG 54

Query: 243 GFKDTYPDDLLAPVLKAVVERTGVNPAEVGDIVVGTVLAPGSQRANECRMASFYAGFPET 422
GFKDT PD+LL+ VL AV++ + P +GDI VG VL PG+ A R+A F +G PET
Sbjct: 55 GFKDTTPDELLSAVLTAVLQDVKLKPECLGDISVGNVLQPGAGAAM-ARIAQFLSGIPET 113

Query: 423 VPVHTVNRQCSSGLQXXXXXXXSIKAGYYDIGIGAGLESMTANPMAWEGSVNPRVETIQK 602
VP+ VNRQCSSGLQ I+ G YDIG+ G+ESMT + G+++ R+ +K
Sbjct: 114 VPLSAVNRQCSSGLQAVANIAGGIRNGSYDIGMACGVESMTLSERGNPGNISSRLLENEK 173

Query: 603 VQDCLLPMGVTSKNVAERFDVSRK 674
+DCL+PMG+TS+NVAERF +SR+
Sbjct: 174 ARDCLIPMGITSENVAERFGISRQ 197


>sp|Q921H8|THIKA_MOUSE 3-ketoacyl-CoA thiolase A, peroxisomal OS=Mus
musculus GN=Acaa1a PE=2 SV=1
Length = 424

Score = 173 bits (438), Expect = 9e-43
Identities = 96/204 (47%), Positives = 131/204 (64%)
Frame = +3

Query: 63 IRRQQVLLEHLRPSESPSTNLVASPCAAGDSAAYERTTDFYDDVVIVAAYRTPVCKAKRG 242
+ R QV+L HL S+ L A+PC+A A DVV+V RTP+ +A RG
Sbjct: 1 MHRLQVVLGHLAGRPESSSALQAAPCSARFPQASA------SDVVVVHGRRTPIGRASRG 54

Query: 243 GFKDTYPDDLLAPVLKAVVERTGVNPAEVGDIVVGTVLAPGSQRANECRMASFYAGFPET 422
GFK+T PD+LL+ VL AV++ + P ++GDI VG VL PG+ A R+A F +G PET
Sbjct: 55 GFKNTTPDELLSAVLTAVLQDVRLKPEQLGDISVGNVLEPGAG-AVMARIAQFLSGIPET 113

Query: 423 VPVHTVNRQCSSGLQXXXXXXXSIKAGYYDIGIGAGLESMTANPMAWEGSVNPRVETIQK 602
VP+ TVNRQCSSGLQ I+ G YDIG+ G+ESM+ + M G+++ R+ +K
Sbjct: 114 VPLSTVNRQCSSGLQAVANIAGGIRNGSYDIGMACGVESMSLSGMGNPGNISSRLLESEK 173

Query: 603 VQDCLLPMGVTSKNVAERFDVSRK 674
+DCL PMG+TS+NVAERF +SR+
Sbjct: 174 ARDCLTPMGMTSENVAERFGISRQ 197


>sp|P09110|THIK_HUMAN 3-ketoacyl-CoA thiolase, peroxisomal OS=Homo
sapiens GN=ACAA1 PE=1 SV=2
Length = 424

Score = 170 bits (430), Expect = 7e-42
Identities = 93/204 (45%), Positives = 127/204 (62%)
Frame = +3

Query: 63 IRRQQVLLEHLRPSESPSTNLVASPCAAGDSAAYERTTDFYDDVVIVAAYRTPVCKAKRG 242
++R QV+L HLR A+PC +G A DVV+V RT +C+A RG
Sbjct: 1 MQRLQVVLGHLRGPADSGWMPQAAPCLSGAPQASAA------DVVVVHGRRTAICRAGRG 54

Query: 243 GFKDTYPDDLLAPVLKAVVERTGVNPAEVGDIVVGTVLAPGSQRANECRMASFYAGFPET 422
GFKDT PD+LL+ V+ AV++ + P ++GDI VG VL PG+ A R+A F + PET
Sbjct: 55 GFKDTTPDELLSAVMTAVLKDVNLRPEQLGDICVGNVLQPGAG-AIMARIAQFLSDIPET 113

Query: 423 VPVHTVNRQCSSGLQXXXXXXXSIKAGYYDIGIGAGLESMTANPMAWEGSVNPRVETIQK 602
VP+ TVNRQCSSGLQ I+ G YDIG+ G+ESM+ G++ R+ +K
Sbjct: 114 VPLSTVNRQCSSGLQAVASIAGGIRNGSYDIGMACGVESMSLADRGNPGNITSRLMEKEK 173

Query: 603 VQDCLLPMGVTSKNVAERFDVSRK 674
+DCL+PMG+TS+NVAERF +SR+
Sbjct: 174 ARDCLIPMGITSENVAERFGISRE 197


>sp|P21775|THIKA_RAT 3-ketoacyl-CoA thiolase A, peroxisomal
OS=Rattus norvegicus GN=Acaa1a PE=2 SV=2
Length = 424

Score = 169 bits (427), Expect = 2e-41
Identities = 95/204 (46%), Positives = 128/204 (62%)
Frame = +3

Query: 63 IRRQQVLLEHLRPSESPSTNLVASPCAAGDSAAYERTTDFYDDVVIVAAYRTPVCKAKRG 242
+ R QV+L HL S+ L A+PC+A A DVV+V RTP+ +A RG
Sbjct: 1 MHRLQVVLGHLAGRPESSSALQAAPCSATFPQASA------SDVVVVHGRRTPIGRAGRG 54

Query: 243 GFKDTYPDDLLAPVLKAVVERTGVNPAEVGDIVVGTVLAPGSQRANECRMASFYAGFPET 422
GFKDT PD+LL+ VL AV++ + P +GDI VG VL PG+ A R+A F +G PET
Sbjct: 55 GFKDTTPDELLSAVLTAVLQDVKLKPECLGDISVGNVLEPGAG-AVMARIAQFLSGIPET 113

Query: 423 VPVHTVNRQCSSGLQXXXXXXXSIKAGYYDIGIGAGLESMTANPMAWEGSVNPRVETIQK 602
VP+ VNRQCSSGLQ I+ G YDIG+ G+ESM+ + G+++ R+ K
Sbjct: 114 VPLSAVNRQCSSGLQAVANIAGGIRNGSYDIGMACGVESMSLSNRGNPGNISSRLLESDK 173

Query: 603 VQDCLLPMGVTSKNVAERFDVSRK 674
+DCL+PMG+TS+NVAERF +SR+
Sbjct: 174 ARDCLIPMGITSENVAERFGISRQ 197


>sp|Q05493|THIK_YARLI 3-ketoacyl-CoA thiolase, peroxisomal
OS=Yarrowia lipolytica GN=POT1 PE=3 SV=1
Length = 414

Score = 138 bits (348), Expect = 2e-32
Identities = 79/167 (47%), Positives = 106/167 (63%), Gaps = 3/167 (1%)
Frame = +3

Query: 186 DDVVIVAAYRTPVCKAKRGGFKDTYPDDLLAPVLKAVVERTGVNPAEVGDIVVGTVLAPG 365
DDVVI AAYRT K +G FKDT +LLA +L+ +V+ + ++P +GD+V G VLA G
Sbjct: 28 DDVVITAAYRTAHTKGGKGLFKDTSSSELLASLLEGLVKESKIDPKLIGDVVCGNVLAAG 87

Query: 366 SQRANECRMASFYAGFPETVPVHTVNRQCSSGLQXXXXXXXSIKAGYYDIGIGAGLESMT 545
+ A E R A AG PETVP +NRQCSSGL I+AG DIGIG G+ESM
Sbjct: 88 A-GATEHRAACLVAGIPETVPFVALNRQCSSGLMAVNDVANKIRAGQIDIGIGCGVESM- 145

Query: 546 ANPMAWEGSVNP---RVETIQKVQDCLLPMGVTSKNVAERFDVSRKA 677
+ SV P + + ++ + CL+PMG+TS+NVA +++VSRKA
Sbjct: 146 -SNQYGPNSVTPFSNKFQNNEEAKKCLIPMGITSENVAAKYNVSRKA 191


>sp|P33291|THIKB_CANTR 3-ketoacyl-CoA thiolase B, peroxisomal
OS=Candida tropicalis PE=3 SV=1
Length = 408

Score = 112 bits (279), Expect = 2e-24
Identities = 61/165 (36%), Positives = 95/165 (57%), Gaps = 2/165 (1%)
Frame = +3

Query: 186 DDVVIVAAYRTPVCKAKRGGFKDTYPDDLLAPVLKAVVERTGVNPAEVGDIVVGTVLAPG 365
DDVVIVAAYRT + K +G F++ + + +L LK +++T ++P+ + D+ +G VL
Sbjct: 25 DDVVIVAAYRTAIGKGFKGSFRNVHSEFILTEFLKEFIKKTNIDPSLIEDVAIGNVLNQA 84

Query: 366 SQRANECRMASFYAGFPETVPVHTVNRQCSSGLQXXXXXXXSIKAGYYDIGIGAGLESMT 545
+ A E R A AG P T VNR CSSGL IK G + G+ G ESM+
Sbjct: 85 A-GATEHRGACLAAGIPYTAAFIAVNRFCSSGLMAISDIANKIKTGEIECGLAGGAESMS 143

Query: 546 AN--PMAWEGSVNPRVETIQKVQDCLLPMGVTSKNVAERFDVSRK 674
N ++P + +++ CL+PMG+T++NVA +F++SR+
Sbjct: 144 TNYRDPRVAPRIDPHLADDAQMEKCLIPMGITNENVANQFNISRE 188


tr_hit_id A9SD50
Definition tr|A9SD50|A9SD50_PHYPA Predicted protein OS=Physcomitrella patens subsp. patens
Align length 210
Score (bit) 324.0
E-value 3.0e-87
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= DK950825|Adiantum capillus-veneris mRNA, clone:
TST38A01NGRL0009_L18, 5'
(677 letters)

Database: uniprot_trembl.fasta
7,341,751 sequences; 2,391,615,440 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

tr|A9SD50|A9SD50_PHYPA Predicted protein OS=Physcomitrella paten... 324 3e-87
tr|Q08375|Q08375_CUCSA Acetyl-CoA acyltransferase (3-ketoacyl-co... 322 2e-86
tr|Q6W6X6|Q6W6X6_HELAN Acetoacetyl CoA thiolase OS=Helianthus an... 317 3e-85
tr|B8LMA1|B8LMA1_PICSI Putative uncharacterized protein OS=Picea... 314 3e-84
tr|P93112|P93112_9ROSI 3-ketoacyl-CoA thiolase OS=Cucurbita cv. ... 314 4e-84
tr|A9S8B1|A9S8B1_PHYPA Predicted protein OS=Physcomitrella paten... 314 4e-84
tr|A5BXL8|A5BXL8_VITVI Putative uncharacterized protein OS=Vitis... 314 4e-84
tr|A7NXT6|A7NXT6_VITVI Chromosome chr5 scaffold_2, whole genome ... 313 6e-84
tr|B8LPR7|B8LPR7_PICSI Putative uncharacterized protein OS=Picea... 311 2e-83
tr|B0M1A9|B0M1A9_SOYBN Peroxisomal 3-ketoacyl-CoA thiolase OS=Gl... 311 2e-83
tr|Q42918|Q42918_MANIN Acetyl-CoA C-acyltransferase (3-ketoacyl-... 309 9e-83
tr|Q43742|Q43742_BRANA Glyoxysomal beta-ketoacyl-thiolase OS=Bra... 306 8e-82
tr|B7FIA4|B7FIA4_MEDTR Putative uncharacterized protein OS=Medic... 306 8e-82
tr|B6TIL6|B6TIL6_MAIZE 3-ketoacyl-CoA thiolase 2, peroxisomal OS... 303 5e-81
tr|B4FBK8|B4FBK8_MAIZE Putative uncharacterized protein OS=Zea m... 303 5e-81
tr|Q84P96|Q84P96_ORYSJ Os02g0817700 protein OS=Oryza sativa subs... 296 6e-79
tr|A2XB19|A2XB19_ORYSI Putative uncharacterized protein OS=Oryza... 296 6e-79
tr|A3ACP9|A3ACP9_ORYSJ Putative uncharacterized protein OS=Oryza... 294 3e-78
tr|Q94LR9|Q94LR9_ORYSJ Os10g0457600 protein OS=Oryza sativa subs... 277 5e-73
tr|B8BH96|B8BH96_ORYSI Putative uncharacterized protein OS=Oryza... 277 5e-73
tr|Q6TXD0|Q6TXD0_SOYBN 3-ketoacyl-CoA thiolase OS=Glycine max PE... 259 1e-67
tr|A8J6J6|A8J6J6_CHLRE Acetyl-CoA acyltransferase OS=Chlamydomon... 233 6e-60
tr|Q0WLJ0|Q0WLJ0_ARATH Peroxisomal-3-keto-acyl-CoA thiolase 1 OS... 231 2e-59
tr|A7QKT2|A7QKT2_VITVI Chromosome undetermined scaffold_114, who... 223 7e-57
tr|B7FIU6|B7FIU6_MEDTR Putative uncharacterized protein OS=Medic... 218 3e-55
tr|Q016C0|Q016C0_OSTTA Dynein 1-alpha heavy chain, flagellar inn... 214 4e-54
tr|A4RZH1|A4RZH1_OSTLU Predicted protein OS=Ostreococcus lucimar... 205 2e-51
tr|B5A4L4|B5A4L4_GYMST Acetyl-CoA acyltransferase (Fragment) OS=... 191 5e-47
tr|Q86IY4|Q86IY4_DICDI Similar to Cucurbita cv. Kurokawa Amakuri... 183 8e-45
tr|B6NUU9|B6NUU9_BRAFL Putative uncharacterized protein OS=Branc... 180 8e-44

>tr|A9SD50|A9SD50_PHYPA Predicted protein OS=Physcomitrella patens
subsp. patens GN=PHYPADRAFT_211002 PE=3 SV=1
Length = 460

Score = 324 bits (831), Expect = 3e-87
Identities = 156/210 (74%), Positives = 179/210 (85%), Gaps = 2/210 (0%)
Frame = +3

Query: 51 MEKFIRRQQVLLEHLRPSES--PSTNLVASPCAAGDSAAYERTTDFYDDVVIVAAYRTPV 224
MEK RQQ+LL+HL+P + N+V S C+A DSA Y RTTDF DDVVIVAAYRTP+
Sbjct: 1 MEKMQMRQQLLLDHLKPETGRRAAANVVTSICSANDSAPYARTTDFLDDVVIVAAYRTPI 60

Query: 225 CKAKRGGFKDTYPDDLLAPVLKAVVERTGVNPAEVGDIVVGTVLAPGSQRANECRMASFY 404
CKAKRGGFKDTYPDDLLAPVL+AVVE+TGVNPAE+GDIV+GTVLAPG+QRANECRMA+FY
Sbjct: 61 CKAKRGGFKDTYPDDLLAPVLRAVVEKTGVNPAEIGDIVIGTVLAPGAQRANECRMAAFY 120

Query: 405 AGFPETVPVHTVNRQCSSGLQXXXXXXXSIKAGYYDIGIGAGLESMTANPMAWEGSVNPR 584
AGFPETVP+ TVNRQCSSGLQ +IKAG+YDIGIG GLESMT NPMAWEG+VNP+
Sbjct: 121 AGFPETVPIRTVNRQCSSGLQAVADVVAAIKAGFYDIGIGGGLESMTVNPMAWEGAVNPK 180

Query: 585 VETIQKVQDCLLPMGVTSKNVAERFDVSRK 674
VE Q+ QDCLLPMG+TS+NVAER+ V R+
Sbjct: 181 VEADQRAQDCLLPMGITSENVAERYGVDRR 210


>tr|Q08375|Q08375_CUCSA Acetyl-CoA acyltransferase (3-ketoacyl-coa
thiolase) OS=Cucumis sativus PE=2 SV=1
Length = 462

Score = 322 bits (824), Expect = 2e-86
Identities = 159/211 (75%), Positives = 183/211 (86%), Gaps = 3/211 (1%)
Frame = +3

Query: 51 MEKFIRRQQVLLEHLRPSESPSTN---LVASPCAAGDSAAYERTTDFYDDVVIVAAYRTP 221
MEK I RQ +LL HLRPS S TN L AS CAAGDSA+Y+RT+ F DDVVIVAAYRT
Sbjct: 1 MEKAINRQSILLHHLRPSSSAYTNESSLSASVCAAGDSASYQRTSVFGDDVVIVAAYRTA 60

Query: 222 VCKAKRGGFKDTYPDDLLAPVLKAVVERTGVNPAEVGDIVVGTVLAPGSQRANECRMASF 401
+CK+KRGGFKDTYPDDLLAPVLKA++E+T +NP+EVGDIVVG+VLAPGSQRA+ECRMA+F
Sbjct: 61 ICKSKRGGFKDTYPDDLLAPVLKALIEKTNLNPSEVGDIVVGSVLAPGSQRASECRMAAF 120

Query: 402 YAGFPETVPVHTVNRQCSSGLQXXXXXXXSIKAGYYDIGIGAGLESMTANPMAWEGSVNP 581
YAGFPETVPV TVNRQCSSGLQ +I+AG+YDIGIGAGLESMT NPMAWEGSVNP
Sbjct: 121 YAGFPETVPVRTVNRQCSSGLQAVADVAAAIRAGFYDIGIGAGLESMTTNPMAWEGSVNP 180

Query: 582 RVETIQKVQDCLLPMGVTSKNVAERFDVSRK 674
RV++I+ Q+CLLPMGVTS+NVA+RF VSR+
Sbjct: 181 RVKSIENAQNCLLPMGVTSENVAQRFGVSRE 211


>tr|Q6W6X6|Q6W6X6_HELAN Acetoacetyl CoA thiolase OS=Helianthus
annuus PE=2 SV=1
Length = 449

Score = 317 bits (813), Expect = 3e-85
Identities = 154/210 (73%), Positives = 183/210 (87%), Gaps = 2/210 (0%)
Frame = +3

Query: 51 MEKFIRRQQVLLEHLRPSESPST--NLVASPCAAGDSAAYERTTDFYDDVVIVAAYRTPV 224
ME+ I RQ+VLLEHLRPS + S+ NL S CAAGDSAAY+R + F DDVVIVAAYR+P+
Sbjct: 1 MERAIERQRVLLEHLRPSSTSSSLENLSVSVCAAGDSAAYQRNSVFGDDVVIVAAYRSPL 60

Query: 225 CKAKRGGFKDTYPDDLLAPVLKAVVERTGVNPAEVGDIVVGTVLAPGSQRANECRMASFY 404
CKAKRGG KDTYPDD+LAPVLKA++E+T +NPAEVGDIVVG+VL GSQRA+ECRMA+FY
Sbjct: 61 CKAKRGGLKDTYPDDILAPVLKALIEKTNINPAEVGDIVVGSVLGAGSQRASECRMAAFY 120

Query: 405 AGFPETVPVHTVNRQCSSGLQXXXXXXXSIKAGYYDIGIGAGLESMTANPMAWEGSVNPR 584
AGFPETVPV TVNRQCSSGLQ +IKAG+YDIGIGAGLESMTANPMAWEGSVNP+
Sbjct: 121 AGFPETVPVRTVNRQCSSGLQAVADVAAAIKAGFYDIGIGAGLESMTANPMAWEGSVNPK 180

Query: 585 VETIQKVQDCLLPMGVTSKNVAERFDVSRK 674
V+T+ + QDCLLPMG+TS+NVA++F ++R+
Sbjct: 181 VKTMAQAQDCLLPMGITSENVAQKFSITRQ 210


>tr|B8LMA1|B8LMA1_PICSI Putative uncharacterized protein OS=Picea
sitchensis PE=2 SV=1
Length = 462

Score = 314 bits (805), Expect = 3e-84
Identities = 156/212 (73%), Positives = 182/212 (85%), Gaps = 2/212 (0%)
Frame = +3

Query: 45 LAMEKFIRRQQVLLEHLRPSESP--STNLVASPCAAGDSAAYERTTDFYDDVVIVAAYRT 218
+ MEK RQQVLL+HLRP+ P S +LVAS CAAGDSAAYER +F DDVVIVAAYRT
Sbjct: 1 MEMEKVRIRQQVLLDHLRPAHFPKASKDLVASVCAAGDSAAYERAAEFGDDVVIVAAYRT 60

Query: 219 PVCKAKRGGFKDTYPDDLLAPVLKAVVERTGVNPAEVGDIVVGTVLAPGSQRANECRMAS 398
P+CKAKRGGFKDT DDLLAPVLKA++++TG+NP EVGDIVVGTVLAPGSQRA+ECRMA+
Sbjct: 61 PICKAKRGGFKDTLADDLLAPVLKALIDKTGLNPVEVGDIVVGTVLAPGSQRASECRMAA 120

Query: 399 FYAGFPETVPVHTVNRQCSSGLQXXXXXXXSIKAGYYDIGIGAGLESMTANPMAWEGSVN 578
FYAGFPETVPV TVNRQCSSGLQ +IKAG+YDIGIGAG+ESM+ P+A+EGSVN
Sbjct: 121 FYAGFPETVPVRTVNRQCSSGLQAVADVAAAIKAGFYDIGIGAGVESMSVAPLAFEGSVN 180

Query: 579 PRVETIQKVQDCLLPMGVTSKNVAERFDVSRK 674
P+VE ++ QDCLLPMG+TS+NVAER+ VSR+
Sbjct: 181 PKVEIFRQAQDCLLPMGITSENVAERYGVSRQ 212


>tr|P93112|P93112_9ROSI 3-ketoacyl-CoA thiolase OS=Cucurbita cv.
Kurokawa Amakuri PE=2 SV=1
Length = 461

Score = 314 bits (804), Expect = 4e-84
Identities = 154/211 (72%), Positives = 182/211 (86%), Gaps = 3/211 (1%)
Frame = +3

Query: 51 MEKFIRRQQVLLEHLRPSESP---STNLVASPCAAGDSAAYERTTDFYDDVVIVAAYRTP 221
MEK I RQ +LL HLRPS S ++L AS CAAGDSA+Y+RT+ F DDVVIVAAYRT
Sbjct: 1 MEKAINRQSILLHHLRPSSSAYSHESSLSASVCAAGDSASYQRTSVFGDDVVIVAAYRTA 60

Query: 222 VCKAKRGGFKDTYPDDLLAPVLKAVVERTGVNPAEVGDIVVGTVLAPGSQRANECRMASF 401
+CK+KRGGFKDTYPDDLLAPVLKA++E+T +NP+EVGDIVVG+VLAPGSQRA+ECRMA+F
Sbjct: 61 LCKSKRGGFKDTYPDDLLAPVLKALIEKTNLNPSEVGDIVVGSVLAPGSQRASECRMATF 120

Query: 402 YAGFPETVPVHTVNRQCSSGLQXXXXXXXSIKAGYYDIGIGAGLESMTANPMAWEGSVNP 581
Y GFPETVPV TVNRQCSSGLQ +I+AG+YDIGIGAGLESMT NPMAW+GSVNP
Sbjct: 121 YPGFPETVPVRTVNRQCSSGLQAVADVAAAIRAGFYDIGIGAGLESMTVNPMAWDGSVNP 180

Query: 582 RVETIQKVQDCLLPMGVTSKNVAERFDVSRK 674
RV++++ Q+CLLPMGVTS+NVA+RF VSR+
Sbjct: 181 RVKSMENAQNCLLPMGVTSENVAQRFGVSRE 211


>tr|A9S8B1|A9S8B1_PHYPA Predicted protein OS=Physcomitrella patens
subsp. patens GN=PHYPADRAFT_125611 PE=3 SV=1
Length = 455

Score = 314 bits (804), Expect = 4e-84
Identities = 153/208 (73%), Positives = 175/208 (84%)
Frame = +3

Query: 51 MEKFIRRQQVLLEHLRPSESPSTNLVASPCAAGDSAAYERTTDFYDDVVIVAAYRTPVCK 230
MEK RQQVLL+HL+P +S C+A DSA Y RTTDF DDVVIVAAYRT +C+
Sbjct: 1 MEKSTMRQQVLLDHLKPETG---RRASSICSANDSAPYARTTDFLDDVVIVAAYRTAICR 57

Query: 231 AKRGGFKDTYPDDLLAPVLKAVVERTGVNPAEVGDIVVGTVLAPGSQRANECRMASFYAG 410
AKRGGFKDTYPDDLLAPVL+AVVE+TGV+PAE+GDIV+G+VLAPG+QRANECRMA+F+AG
Sbjct: 58 AKRGGFKDTYPDDLLAPVLRAVVEKTGVSPAEIGDIVIGSVLAPGAQRANECRMAAFFAG 117

Query: 411 FPETVPVHTVNRQCSSGLQXXXXXXXSIKAGYYDIGIGAGLESMTANPMAWEGSVNPRVE 590
FPETVPV TVNRQCSSGLQ +IKAG+YDIGIG GLESMT NPMAWEGSVNPRVE
Sbjct: 118 FPETVPVRTVNRQCSSGLQAVADVAAAIKAGFYDIGIGGGLESMTVNPMAWEGSVNPRVE 177

Query: 591 TIQKVQDCLLPMGVTSKNVAERFDVSRK 674
Q+ QDCLLPMG+TS+NVAER+ V R+
Sbjct: 178 ADQRAQDCLLPMGITSENVAERYGVGRR 205


>tr|A5BXL8|A5BXL8_VITVI Putative uncharacterized protein OS=Vitis
vinifera GN=VITISV_023191 PE=3 SV=1
Length = 461

Score = 314 bits (804), Expect = 4e-84
Identities = 155/211 (73%), Positives = 181/211 (85%), Gaps = 3/211 (1%)
Frame = +3

Query: 51 MEKFIRRQQVLLEHLRPSESPS---TNLVASPCAAGDSAAYERTTDFYDDVVIVAAYRTP 221
MEK I RQ+VLL+HL PS S + ++L AS C AGDSAAY+RT+ F DDVVIVAAYRT
Sbjct: 1 MEKAINRQRVLLQHLSPSSSAAEDESSLSASVCVAGDSAAYQRTSVFGDDVVIVAAYRTA 60

Query: 222 VCKAKRGGFKDTYPDDLLAPVLKAVVERTGVNPAEVGDIVVGTVLAPGSQRANECRMASF 401
+CK+KRGGFKDTYPDDLLAPVL+A++E+T +NP EVGDIVVGTVLAPGSQRA+ECRMA+F
Sbjct: 61 LCKSKRGGFKDTYPDDLLAPVLRALIEKTNLNPNEVGDIVVGTVLAPGSQRASECRMAAF 120

Query: 402 YAGFPETVPVHTVNRQCSSGLQXXXXXXXSIKAGYYDIGIGAGLESMTANPMAWEGSVNP 581
YAGFPETVPV TVNRQCSSGLQ +IKAG+YDIGIGAGLESMTANPMAWEGS+NP
Sbjct: 121 YAGFPETVPVRTVNRQCSSGLQAVADVAAAIKAGFYDIGIGAGLESMTANPMAWEGSINP 180

Query: 582 RVETIQKVQDCLLPMGVTSKNVAERFDVSRK 674
+V+ + QDCLLPMG+TS+NVA RF V+R+
Sbjct: 181 KVKEFVQAQDCLLPMGITSENVAHRFGVTRQ 211


>tr|A7NXT6|A7NXT6_VITVI Chromosome chr5 scaffold_2, whole genome
shotgun sequence OS=Vitis vinifera GN=GSVIVT00020472001
PE=3 SV=1
Length = 461

Score = 313 bits (802), Expect = 6e-84
Identities = 155/211 (73%), Positives = 181/211 (85%), Gaps = 3/211 (1%)
Frame = +3

Query: 51 MEKFIRRQQVLLEHLRPSESPS---TNLVASPCAAGDSAAYERTTDFYDDVVIVAAYRTP 221
MEK I RQ+VLL+HL PS S + ++L AS C AGDSAAY+RT+ F DDVVIVAAYRT
Sbjct: 1 MEKAINRQRVLLQHLSPSSSAAEDESSLSASVCVAGDSAAYQRTSVFGDDVVIVAAYRTA 60

Query: 222 VCKAKRGGFKDTYPDDLLAPVLKAVVERTGVNPAEVGDIVVGTVLAPGSQRANECRMASF 401
+CK+KRGGFKDTYPDDLLAPVL+A++E+T +NP EVGDIVVGTVLAPGSQRA+ECRMA+F
Sbjct: 61 LCKSKRGGFKDTYPDDLLAPVLRALLEKTNLNPNEVGDIVVGTVLAPGSQRASECRMAAF 120

Query: 402 YAGFPETVPVHTVNRQCSSGLQXXXXXXXSIKAGYYDIGIGAGLESMTANPMAWEGSVNP 581
YAGFPETVPV TVNRQCSSGLQ +IKAG+YDIGIGAGLESMTANPMAWEGS+NP
Sbjct: 121 YAGFPETVPVRTVNRQCSSGLQAVADVAAAIKAGFYDIGIGAGLESMTANPMAWEGSINP 180

Query: 582 RVETIQKVQDCLLPMGVTSKNVAERFDVSRK 674
+V+ + QDCLLPMG+TS+NVA RF V+R+
Sbjct: 181 KVKEFVQAQDCLLPMGITSENVAHRFGVTRQ 211


>tr|B8LPR7|B8LPR7_PICSI Putative uncharacterized protein OS=Picea
sitchensis PE=2 SV=1
Length = 462

Score = 311 bits (797), Expect = 2e-83
Identities = 155/212 (73%), Positives = 180/212 (84%), Gaps = 2/212 (0%)
Frame = +3

Query: 45 LAMEKFIRRQQVLLEHLRPSESP--STNLVASPCAAGDSAAYERTTDFYDDVVIVAAYRT 218
+ MEK RQQV L+HLRP+ P S +LVAS CAAGDSAAYER +F DDVVIVAAYRT
Sbjct: 1 MEMEKVRIRQQVSLDHLRPAHFPKASKDLVASVCAAGDSAAYERAAEFGDDVVIVAAYRT 60

Query: 219 PVCKAKRGGFKDTYPDDLLAPVLKAVVERTGVNPAEVGDIVVGTVLAPGSQRANECRMAS 398
P+CKAKRGGFKDT DDLLAPVLKA++++TG+NP EVGDIVVGTVLAPGSQRA ECRMA+
Sbjct: 61 PICKAKRGGFKDTLADDLLAPVLKALIDKTGLNPVEVGDIVVGTVLAPGSQRAIECRMAA 120

Query: 399 FYAGFPETVPVHTVNRQCSSGLQXXXXXXXSIKAGYYDIGIGAGLESMTANPMAWEGSVN 578
FYAGFPETVPV TVNRQCSSGLQ +IKAG+YDIGIGAG+ESM+ P+A+EGSVN
Sbjct: 121 FYAGFPETVPVRTVNRQCSSGLQAVADVAAAIKAGFYDIGIGAGVESMSVTPLAFEGSVN 180

Query: 579 PRVETIQKVQDCLLPMGVTSKNVAERFDVSRK 674
P+VE ++ QDCLLPMG+TS+NVAER+ VSR+
Sbjct: 181 PKVEIFRQAQDCLLPMGITSENVAERYGVSRQ 212


>tr|B0M1A9|B0M1A9_SOYBN Peroxisomal 3-ketoacyl-CoA thiolase
OS=Glycine max PE=2 SV=1
Length = 463

Score = 311 bits (797), Expect = 2e-83
Identities = 154/212 (72%), Positives = 179/212 (84%), Gaps = 4/212 (1%)
Frame = +3

Query: 51 MEKFIRRQQVLLEHLRPSESP----STNLVASPCAAGDSAAYERTTDFYDDVVIVAAYRT 218
MEK I RQ++LL HL PS S S++L AS C AGDSAAY+RT+ F DDVVIVAAYRT
Sbjct: 1 MEKAINRQKILLHHLNPSSSTHPNESSSLHASACVAGDSAAYQRTSTFGDDVVIVAAYRT 60

Query: 219 PVCKAKRGGFKDTYPDDLLAPVLKAVVERTGVNPAEVGDIVVGTVLAPGSQRANECRMAS 398
CKAKRGGFKDT PDDLLAPVLKAV+E+T VNP+EVGDIVVG+VLAPG+QRA+ECRMA+
Sbjct: 61 AHCKAKRGGFKDTLPDDLLAPVLKAVIEKTNVNPSEVGDIVVGSVLAPGAQRASECRMAA 120

Query: 399 FYAGFPETVPVHTVNRQCSSGLQXXXXXXXSIKAGYYDIGIGAGLESMTANPMAWEGSVN 578
FYAGFPETVPV TVNRQCSSGLQ +I+AG+YDIGIGAGLESMT NPM W+GSVN
Sbjct: 121 FYAGFPETVPVRTVNRQCSSGLQAVADVAAAIRAGFYDIGIGAGLESMTTNPMGWDGSVN 180

Query: 579 PRVETIQKVQDCLLPMGVTSKNVAERFDVSRK 674
P+V+ ++ Q+CLLPMG+TS+NVA+RF VSRK
Sbjct: 181 PKVKMFEQAQNCLLPMGITSENVAQRFGVSRK 212