DK950828
Clone id TST38A01NGRL0009_L21
Library
Length 632
Definition Adiantum capillus-veneris mRNA. clone: TST38A01NGRL0009_L21. 5' end sequence.
Accession
Tissue type prothallia
Developmental stage gametophyte
Contig ID -
Sequence
GTTGTGACAGAAGCGACAGCAGCAATTTGTCGAGAATGTTGGCGAAGAAAGCTCTGCTGA
GCAAGAGCACAGACCTTTGCAAGCATCGCAGGCTACTGCTTGCATCGCGCTTCTCCTCCA
AAGCTGGCGATGGAGCTCCAAATGTCACCCTTGACGAACGCCCTAAACCTCTCCTTCGCC
AAACCAGAAACTACTCCTCCGGTGGGTCCGCTCCCCCTGGGTCCCAAGCTCCTGCAGCTG
CCCCCGGCACAGACTACCTCTCTCTTTTCCAACCGGCTACAGCTGGCGGCCTTGCTCCTT
TTTCTCCAGGAAGTGTCCTGAAAATCTATCCTCTACCTCGTTATGTATTGAAGGAGGACA
TAGTCCATCATTTGGAGGGGGTCAATGTGAAACCAGAGAATGTAAAGTTTGTCTACACAC
CTCACTTCAGGCCAGACTATGCGCAGTTCAATGTTGAGTCTTCTTCTGCCCAGAAGAGCA
TCATGAGACGGCTGCAGGAAAGAGGCCGTTTAGGCTATCGTATCTTGAGAGCAGAAATGT
CACAACCAATGCCGTGGACTGTTGTTGATGCAGCACTCANAGACTCTCCACGAGGAAGAA
CGCTTCTCATGTACAATGCGAGTATAAACACG
■■Homology search results ■■ -
sp_hit_id O88623
Definition sp|O88623|UBP2_MOUSE Ubiquitin carboxyl-terminal hydrolase 2 OS=Mus musculus
Align length 71
Score (bit) 32.0
E-value 2.7
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= DK950828|Adiantum capillus-veneris mRNA, clone:
TST38A01NGRL0009_L21, 5'
(632 letters)

Database: uniprot_sprot.fasta
412,525 sequences; 148,809,765 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

sp|O88623|UBP2_MOUSE Ubiquitin carboxyl-terminal hydrolase 2 OS=... 32 2.7
sp|Q7M8Y8|SYFB_WOLSU Phenylalanyl-tRNA synthetase beta chain OS=... 31 6.1
sp|A6VLY4|MNMA_ACTSZ tRNA-specific 2-thiouridylase mnmA OS=Actin... 31 6.1
sp|Q5TJG6|BRD2_CANFA Bromodomain-containing protein 2 OS=Canis f... 31 6.1
sp|A4J5P4|LEXA_DESRM LexA repressor OS=Desulfotomaculum reducens... 30 7.9

>sp|O88623|UBP2_MOUSE Ubiquitin carboxyl-terminal hydrolase 2 OS=Mus
musculus GN=Usp2 PE=1 SV=2
Length = 613

Score = 32.0 bits (71), Expect = 2.7
Identities = 18/71 (25%), Positives = 34/71 (47%)
Frame = +3

Query: 396 ENVKFVYTPHFRPDYAQFNVESSSAQKSIMRRLQERGRLGYRILRAEMSQPMPWTVVDAA 575
E+ ++ P+ +P Y + S A ++ E+ +LG++ + P P T ++
Sbjct: 13 ESSRYTDAPYAKPGYGTYTPSSYGA--NLAASFLEKEKLGFKPVSPTSFLPRPRTYGPSS 70

Query: 576 LXDSPRGRTLL 608
+ D RGR LL
Sbjct: 71 ILDCDRGRPLL 81


>sp|Q7M8Y8|SYFB_WOLSU Phenylalanyl-tRNA synthetase beta chain
OS=Wolinella succinogenes GN=pheT PE=3 SV=1
Length = 786

Score = 30.8 bits (68), Expect = 6.1
Identities = 22/69 (31%), Positives = 32/69 (46%), Gaps = 6/69 (8%)
Frame = -1

Query: 194 VVSGLAKERFRAFVKGDIWS------SIASFGGEARCKQ*PAMLAKVCALAQQSFLRQHS 33
V SGL KE + KG+ WS IAS GE +Q K+ AQ +++ Q
Sbjct: 591 VASGLKKEAIYPYPKGEKWSLFGFAEEIASVIGEFSLEQRAPQSEKLFHPAQCAYIIQKG 650

Query: 32 RQIAAVASV 6
+I +A +
Sbjct: 651 ERIGTIAKL 659


>sp|A6VLY4|MNMA_ACTSZ tRNA-specific 2-thiouridylase mnmA
OS=Actinobacillus succinogenes (strain ATCC 55618 /
130Z) GN=mnmA PE=3 SV=1
Length = 389

Score = 30.8 bits (68), Expect = 6.1
Identities = 16/52 (30%), Positives = 26/52 (50%)
Frame = -3

Query: 378 PPNDGLCPPSIHNEVEDRFSGHFLEKKEQGRQL*PVGKERGSLCRGQLQELG 223
P +D + N + + H L KK+ G+ L PVG+ ++ R +ELG
Sbjct: 159 PDHDAHLLRGLDNNKDQSYFLHALSKKQVGQSLFPVGEVEKTVVRAVAEELG 210


>sp|Q5TJG6|BRD2_CANFA Bromodomain-containing protein 2 OS=Canis
familiaris GN=BRD2 PE=3 SV=1
Length = 803

Score = 30.8 bits (68), Expect = 6.1
Identities = 19/44 (43%), Positives = 24/44 (54%)
Frame = -1

Query: 302 KRSKAASCSRLEKREVVCAGGSCRSLGPRGSGPTGGVVSGLAKE 171
K+SK AS S GGS +LGP G GP+GG + L K+
Sbjct: 586 KKSKKASGS---------GGGSAATLGPPGFGPSGGSGTKLPKK 620


>sp|A4J5P4|LEXA_DESRM LexA repressor OS=Desulfotomaculum reducens
(strain MI-1) GN=lexA PE=3 SV=1
Length = 214

Score = 30.4 bits (67), Expect = 7.9
Identities = 24/78 (30%), Positives = 37/78 (47%), Gaps = 1/78 (1%)
Frame = +3

Query: 375 EGVNVKPENVKFV-YTPHFRPDYAQFNVESSSAQKSIMRRLQERGRLGYRILRAEMSQPM 551
E +NV ENVK Y P R + SSS S ++RL+++G LR + ++P
Sbjct: 8 EVLNVIIENVKLKGYPPSVREIGEAVGLSSSSTVHSYLKRLEQKG-----YLRRDPTKPR 62

Query: 552 PWTVVDAALXDSPRGRTL 605
V+ + L +P L
Sbjct: 63 AIEVIMSELSKNPSSHPL 80


tr_hit_id B8LNR0
Definition tr|B8LNR0|B8LNR0_PICSI Putative uncharacterized protein OS=Picea sitchensis
Align length 97
Score (bit) 47.0
E-value 0.001
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= DK950828|Adiantum capillus-veneris mRNA, clone:
TST38A01NGRL0009_L21, 5'
(632 letters)

Database: uniprot_trembl.fasta
7,341,751 sequences; 2,391,615,440 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

tr|B8LNR0|B8LNR0_PICSI Putative uncharacterized protein OS=Picea... 47 0.001
tr|A9NUG3|A9NUG3_PICSI Putative uncharacterized protein OS=Picea... 44 0.008
tr|Q6T8C7|Q6T8C7_HELAN Putative uncharacterized protein OS=Helia... 37 1.3
tr|Q97Y13|Q97Y13_SULSO Putative uncharacterized protein OS=Sulfo... 36 1.7
tr|Q4JSD7|Q4JSD7_CORJK TRNA nucleotidyltransferase OS=Corynebact... 35 4.9
tr|B6KY29|B6KY29_BRAFL Putative uncharacterized protein (Fragmen... 35 4.9
tr|Q3E9M7|Q3E9M7_ARATH Uncharacterized protein At5g02740.2 OS=Ar... 34 6.4
tr|Q0WNI6|Q0WNI6_ARATH Putative uncharacterized protein At5g0274... 34 6.4
tr|Q014H5|Q014H5_OSTTA Cobyrinic acid a,c-diamide synthase CbiA ... 34 6.4
tr|A0JQ00|A0JQ00_ARATH At5g02740 OS=Arabidopsis thaliana PE=2 SV=1 34 6.4
tr|B8B123|B8B123_ORYSI Putative uncharacterized protein OS=Oryza... 34 8.3
tr|Q55GF6|Q55GF6_DICDI Putative uncharacterized protein OS=Dicty... 34 8.3
tr|A9V8M9|A9V8M9_MONBE Predicted protein OS=Monosiga brevicollis... 34 8.3

>tr|B8LNR0|B8LNR0_PICSI Putative uncharacterized protein OS=Picea
sitchensis PE=2 SV=1
Length = 261

Score = 47.0 bits (110), Expect = 0.001
Identities = 31/97 (31%), Positives = 48/97 (49%)
Frame = +3

Query: 339 RYVLKEDIVHHLEGVNVKPENVKFVYTPHFRPDYAQFNVESSSAQKSIMRRLQERGRLGY 518
R LK DIVH EG N+KPE++KF Y ++ P S +A R +GR Y
Sbjct: 105 RSTLKMDIVHFFEGCNLKPEDMKFAYNRNYAPLGMILQFSSRAAYGIAQRLTAIKGRY-Y 163

Query: 519 RILRAEMSQPMPWTVVDAALXDSPRGRTLLMYNASIN 629
R++ + SQ W+ +++ G+ LL++ N
Sbjct: 164 RMMEVDRSQ---WSNLESPFD----GKVLLLHGVPQN 193


>tr|A9NUG3|A9NUG3_PICSI Putative uncharacterized protein OS=Picea
sitchensis PE=2 SV=1
Length = 261

Score = 43.9 bits (102), Expect = 0.008
Identities = 26/69 (37%), Positives = 35/69 (50%)
Frame = +3

Query: 339 RYVLKEDIVHHLEGVNVKPENVKFVYTPHFRPDYAQFNVESSSAQKSIMRRLQERGRLGY 518
R LK DIVH EG N+KPE++KF Y + P S +A R +GR Y
Sbjct: 105 RSTLKMDIVHFFEGCNLKPEDMKFAYNRTYAPLGMILQFSSRAAYGIAQRFTAIKGRY-Y 163

Query: 519 RILRAEMSQ 545
R++ + SQ
Sbjct: 164 RMMEVDRSQ 172


>tr|Q6T8C7|Q6T8C7_HELAN Putative uncharacterized protein
OS=Helianthus annuus PE=2 SV=1
Length = 225

Score = 36.6 bits (83), Expect = 1.3
Identities = 25/81 (30%), Positives = 40/81 (49%), Gaps = 3/81 (3%)
Frame = +3

Query: 303 SPGSVL---KIYPLPRYVLKEDIVHHLEGVNVKPENVKFVYTPHFRPDYAQFNVESSSAQ 473
SP S L K+ + + LK D++ LE + +++K Y P + P S SA
Sbjct: 58 SPSSGLVYGKLSGITKTTLKSDVLSLLEECKLSVDDLKVDYNPSYTPMGMMXQFPSRSAY 117

Query: 474 KSIMRRLQERGRLGYRILRAE 536
+R + +GRL YR+ RA+
Sbjct: 118 DXALRAVARKGRL-YRLERAD 137


>tr|Q97Y13|Q97Y13_SULSO Putative uncharacterized protein
OS=Sulfolobus solfataricus GN=SSO1537 PE=4 SV=1
Length = 269

Score = 36.2 bits (82), Expect = 1.7
Identities = 21/106 (19%), Positives = 50/106 (47%)
Frame = +3

Query: 252 DYLSLFQPATAGGLAPFSPGSVLKIYPLPRYVLKEDIVHHLEGVNVKPENVKFVYTPHFR 431
D + LF ++ P L ++P+ +Y + + + L+ + KPE++ F+ H
Sbjct: 53 DGVILFDTGIPDNVSGKWPQIALSVFPVTKYSEENKMENQLKKIGYKPEDIHFIILSHLH 112

Query: 432 PDYAQFNVESSSAQKSIMRRLQERGRLGYRILRAEMSQPMPWTVVD 569
D+ +++ ++ +E L Y +L +++P+P+ + D
Sbjct: 113 LDHTGSLELFKNSKPDVIVHEKE---LKYALLNLWLNKPVPYLLRD 155


>tr|Q4JSD7|Q4JSD7_CORJK TRNA nucleotidyltransferase
OS=Corynebacterium jeikeium (strain K411) GN=cca PE=4
SV=1
Length = 547

Score = 34.7 bits (78), Expect = 4.9
Identities = 24/60 (40%), Positives = 30/60 (50%), Gaps = 16/60 (26%)
Frame = -2

Query: 178 RRRGLGRSSRVTFGAPSPALEEK----------------RDASSSLRCLQRSVLLLSRAF 47
RRRGL S VT APSPA E ++A +SLR L R +L L++AF
Sbjct: 13 RRRGLVESGSVTKSAPSPANSESAQAAASEKPRTIEGMLQEAFTSLRALDRDLLPLTQAF 72


>tr|B6KY29|B6KY29_BRAFL Putative uncharacterized protein (Fragment)
OS=Branchiostoma floridae GN=BRAFLDRAFT_63808 PE=4 SV=1
Length = 615

Score = 34.7 bits (78), Expect = 4.9
Identities = 26/82 (31%), Positives = 38/82 (46%), Gaps = 7/82 (8%)
Frame = +2

Query: 341 LCIEGGHS------PSFGGGQCETRECKVCLHTSLQARLCAVQC*VFFCPEEHHETAAGK 502
+C+E H PSF G + +T EC+ C H S+ +R V CP + +A GK
Sbjct: 228 VCVEDCHPECIGCIPSFPGSKLDT-ECRACKHLSMYSRC------VSECPADTEPSADGK 280

Query: 503 R-PFRLSYLESRNVTTNAVDCC 565
R + +E + TT V C
Sbjct: 281 RCVCKGLAVELKEGTTQCVSSC 302


>tr|Q3E9M7|Q3E9M7_ARATH Uncharacterized protein At5g02740.2
OS=Arabidopsis thaliana GN=At5g02740 PE=4 SV=1
Length = 185

Score = 34.3 bits (77), Expect = 6.4
Identities = 29/100 (29%), Positives = 47/100 (47%), Gaps = 8/100 (8%)
Frame = +3

Query: 270 QPATAGGLAPFSPGS------VLKIYPLPRYVLKEDIVHHLEGVNVKPENVKFVYT--PH 425
QP A L P GS K ++ LK DI++ LEG ++ +++KF Y +
Sbjct: 42 QPPPASPLPPPPGGSPGEGRFYGKFSGFSKHALKTDIMNVLEGCSLTSDDLKFNYPRGGN 101

Query: 426 FRPDYAQFNVESSSAQKSIMRRLQERGRLGYRILRAEMSQ 545
P S SA +R + ++G+L YR+ +A +Q
Sbjct: 102 LTPAAVFVQFPSLSAYDKALRNIAKKGKL-YRLEKAARAQ 140


>tr|Q0WNI6|Q0WNI6_ARATH Putative uncharacterized protein At5g02740
OS=Arabidopsis thaliana GN=At5g02740 PE=2 SV=1
Length = 228

Score = 34.3 bits (77), Expect = 6.4
Identities = 29/100 (29%), Positives = 47/100 (47%), Gaps = 8/100 (8%)
Frame = +3

Query: 270 QPATAGGLAPFSPGS------VLKIYPLPRYVLKEDIVHHLEGVNVKPENVKFVYT--PH 425
QP A L P GS K ++ LK DI++ LEG ++ +++KF Y +
Sbjct: 42 QPPPASPLPPPPGGSPGEGRFYGKFSGFSKHALKTDIMNVLEGCSLTSDDLKFNYPRGGN 101

Query: 426 FRPDYAQFNVESSSAQKSIMRRLQERGRLGYRILRAEMSQ 545
P S SA +R + ++G+L YR+ +A +Q
Sbjct: 102 LTPAAVFVQFPSLSAYDKALRNIAKKGKL-YRLEKAARAQ 140


>tr|Q014H5|Q014H5_OSTTA Cobyrinic acid a,c-diamide synthase CbiA
(ISS) OS=Ostreococcus tauri GN=Ot07g04310 PE=4 SV=1
Length = 1022

Score = 34.3 bits (77), Expect = 6.4
Identities = 20/67 (29%), Positives = 32/67 (47%), Gaps = 4/67 (5%)
Frame = +3

Query: 285 GGLAPFSPGSVLKIYPLPRYVLKEDIVHHLEGVNVKPENVKFVYTPH----FRPDYAQFN 452
G L P S G+V + Y +ED+ L V+ PE +K V P D+ +++
Sbjct: 506 GPLTPISSGNVSRYYEGNTRAFEEDVHRALSAVSDSPEKIKHVLPPRRSRATSRDFREYS 565

Query: 453 VESSSAQ 473
V+ SA+
Sbjct: 566 VDLDSAE 572


>tr|A0JQ00|A0JQ00_ARATH At5g02740 OS=Arabidopsis thaliana PE=2 SV=1
Length = 228

Score = 34.3 bits (77), Expect = 6.4
Identities = 29/100 (29%), Positives = 47/100 (47%), Gaps = 8/100 (8%)
Frame = +3

Query: 270 QPATAGGLAPFSPGS------VLKIYPLPRYVLKEDIVHHLEGVNVKPENVKFVYT--PH 425
QP A L P GS K ++ LK DI++ LEG ++ +++KF Y +
Sbjct: 42 QPPPASPLPPPPGGSPGEGRFYGKFSGFSKHALKTDIMNVLEGCSLTSDDLKFNYPRGGN 101

Query: 426 FRPDYAQFNVESSSAQKSIMRRLQERGRLGYRILRAEMSQ 545
P S SA +R + ++G+L YR+ +A +Q
Sbjct: 102 LTPAAVFVQFPSLSAYDKALRNIAKKGKL-YRLEKAARAQ 140