DK950837
Clone id TST38A01NGRL0009_M06
Library
Length 662
Definition Adiantum capillus-veneris mRNA. clone: TST38A01NGRL0009_M06. 5' end sequence.
Accession
Tissue type prothallia
Developmental stage gametophyte
Contig ID -
Sequence
CGCTGGATCGAGGTTTTCTCATCTTGATGATGCCCATGCACAAAGCTGCGGGCTGCGATG
GTGGGCAGTGTCGTTCGTCCGCCCCCAGCCCTCCCTTTGCCTTTTCCTGCTCGCCCATAT
GTACATAACTCGCAACCCTTGAACGCTCTCGCCAGATAATGACGACAATTTTTACTCATA
TAATTTTTCGGTTCATGGAACAGCGGTTTCATCTCAGCACAAGTATCACGTCTGAGGCAC
ATTCGAATTAGCATTTAAGGTAGCCTGAGTTTCCATGGCTGCAGCTTGTTTAAAGAAGCT
GAGTGATATAGTCTCTCATGGCAGGCCTGCTGCATCTGCTCTCAACATGAGCTCTGGTTT
TACAAGCTCCAGCTATGGCATTTCTTTGGCGATGCACATAGACAATGAACCCTCAACAGC
AAGGCACCATCCATCCTTACTGCAGAGCCCTTGCAAATTTCATTGTTCACCATTCAACTC
ATCATCTGATAAGGATGGTGGTACGGATGGCCCCAATGCAGATGAGCGCGATGCAAAAAC
AAAGCGTTCAGTGAATGAAGACATGGGAGGGGTTGCCTTGGGGGGTGTAGAGCCTTCTCA
GGAGCATGAATGCAAGCCCCCCATTCGAAAGGATGTAAGATGGCCTCAAATCTTACCACC
AG
■■Homology search results ■■ -
sp_hit_id P10220
Definition sp|P10220|TEGU_HHV11 Large tegument protein OS=Human herpesvirus 1 (strain 17)
Align length 79
Score (bit) 36.6
E-value 0.12
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= DK950837|Adiantum capillus-veneris mRNA, clone:
TST38A01NGRL0009_M06, 5'
(662 letters)

Database: uniprot_sprot.fasta
412,525 sequences; 148,809,765 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

sp|P10220|TEGU_HHV11 Large tegument protein OS=Human herpesvirus... 37 0.12
sp|Q7TN02|MED26_MOUSE Mediator of RNA polymerase II transcriptio... 33 1.3
sp|P39881|CUX1_CANFA Homeobox protein cut-like 1 (Fragment) OS=C... 33 1.8
sp|P70512|HNF6_RAT Hepatocyte nuclear factor 6 OS=Rattus norvegi... 32 3.0
sp|O08755|HNF6_MOUSE Hepatocyte nuclear factor 6 OS=Mus musculus... 32 3.0
sp|Q9UBC0|HNF6_HUMAN Hepatocyte nuclear factor 6 OS=Homo sapiens... 32 3.0
sp|O88879|APAF_MOUSE Apoptotic protease-activating factor 1 OS=M... 32 3.0
sp|O42097|FOXA2_ORYLA Hepatocyte nuclear factor 3-beta OS=Oryzia... 32 3.9
sp|O14727|APAF_HUMAN Apoptotic protease-activating factor 1 OS=H... 32 3.9

>sp|P10220|TEGU_HHV11 Large tegument protein OS=Human herpesvirus 1
(strain 17) GN=UL36 PE=1 SV=1
Length = 3164

Score = 36.6 bits (83), Expect = 0.12
Identities = 24/79 (30%), Positives = 35/79 (44%)
Frame = +2

Query: 425 HHPSLLQSPCKFHCSPFNSSSDKDGGTDGPNADERDAKTKRSVNEDMGGVALGGVEPSQE 604
H P+ QSP + +S+ GT GP+A + +AK +D+ VAL G P+
Sbjct: 310 HPPTAAQSPPPTRARRDDRASETSRGTAGPSA-KPEAKRPNRAPDDVWAVALKGTPPTDP 368

Query: 605 HECKPPIRKDVRWPQILPP 661
PP P +PP
Sbjct: 369 PSADPPSADP---PSAIPP 384


>sp|Q7TN02|MED26_MOUSE Mediator of RNA polymerase II transcription
subunit 26 OS=Mus musculus GN=Med26 PE=2 SV=1
Length = 588

Score = 33.1 bits (74), Expect = 1.3
Identities = 27/84 (32%), Positives = 40/84 (47%), Gaps = 7/84 (8%)
Frame = +2

Query: 410 PSTARHHPSLLQSPCKFHCSPFNSSSDKDGGTDGPNADERDAKTKR----SVNEDMGGVA 577
P + HP L C+ SP +S +D D + G +D + K R +VN D G VA
Sbjct: 342 PEQSEGHPRLTGPACRAGFSPDSSKADSDATSSG-GSDSKKKKRYRPRDYTVNLD-GQVA 399

Query: 578 LGGVEPSQEHECK---PPIRKDVR 640
GV+P + E K P+ + +R
Sbjct: 400 EAGVKPVRLKERKLTFDPMTRQIR 423


>sp|P39881|CUX1_CANFA Homeobox protein cut-like 1 (Fragment)
OS=Canis familiaris GN=CUX1 PE=2 SV=1
Length = 975

Score = 32.7 bits (73), Expect = 1.8
Identities = 22/79 (27%), Positives = 31/79 (39%), Gaps = 2/79 (2%)
Frame = +2

Query: 419 ARHHPSLLQSPCKFHCSPFNSSSDKDG--GTDGPNADERDAKTKRSVNEDMGGVALGGVE 592
ARH PS S +P + DG +GP A + + + + GG A V
Sbjct: 758 ARHSPSARSSGA----APSSEGDSCDGVEAAEGPGAADAEESAPAAAAKSQGGPAEAAVA 813

Query: 593 PSQEHECKPPIRKDVRWPQ 649
P + E P K R P+
Sbjct: 814 PEEREEAPRPAEKRSRRPR 832


>sp|P70512|HNF6_RAT Hepatocyte nuclear factor 6 OS=Rattus norvegicus
GN=Onecut1 PE=1 SV=1
Length = 465

Score = 32.0 bits (71), Expect = 3.0
Identities = 19/56 (33%), Positives = 27/56 (48%), Gaps = 6/56 (10%)
Frame = -1

Query: 638 LHPFEWGACIHAPEKALHP------PRQPLPCLHSLNALFLHRAHLHWGHPYHHPY 489
LHP AC P ++ P QPLP + +++ F H H H H +HHP+
Sbjct: 83 LHPTMTMACETPPGMSMPTTYTTLTPLQPLPPISTVSDKFPHHHHHH--HHHHHPH 136


>sp|O08755|HNF6_MOUSE Hepatocyte nuclear factor 6 OS=Mus musculus
GN=Onecut1 PE=1 SV=1
Length = 465

Score = 32.0 bits (71), Expect = 3.0
Identities = 19/56 (33%), Positives = 27/56 (48%), Gaps = 6/56 (10%)
Frame = -1

Query: 638 LHPFEWGACIHAPEKALHP------PRQPLPCLHSLNALFLHRAHLHWGHPYHHPY 489
LHP AC P ++ P QPLP + +++ F H H H H +HHP+
Sbjct: 83 LHPTMTMACETPPGMSMPTTYTTLTPLQPLPPISTVSDKFPHHHHHH--HHHHHPH 136


>sp|Q9UBC0|HNF6_HUMAN Hepatocyte nuclear factor 6 OS=Homo sapiens
GN=ONECUT1 PE=2 SV=1
Length = 465

Score = 32.0 bits (71), Expect = 3.0
Identities = 19/56 (33%), Positives = 27/56 (48%), Gaps = 6/56 (10%)
Frame = -1

Query: 638 LHPFEWGACIHAPEKALHP------PRQPLPCLHSLNALFLHRAHLHWGHPYHHPY 489
LHP AC P ++ P QPLP + +++ F H H H H +HHP+
Sbjct: 83 LHPTMTMACETPPGMSMPTTYTTLTPLQPLPPISTVSDKFPHHHHHH--HHHHHPH 136


>sp|O88879|APAF_MOUSE Apoptotic protease-activating factor 1 OS=Mus
musculus GN=Apaf1 PE=1 SV=2
Length = 1249

Score = 32.0 bits (71), Expect = 3.0
Identities = 14/29 (48%), Positives = 18/29 (62%)
Frame = +2

Query: 137 P*TLSPDNDDNFYSYNFSVHGTAVSSQHK 223
P TLSPD +D Y YNF + A ++ HK
Sbjct: 470 PHTLSPDQEDCMYWYNFLAYHMASANMHK 498


>sp|O42097|FOXA2_ORYLA Hepatocyte nuclear factor 3-beta OS=Oryzias
latipes GN=foxa2 PE=2 SV=1
Length = 415

Score = 31.6 bits (70), Expect = 3.9
Identities = 17/50 (34%), Positives = 26/50 (52%)
Frame = +2

Query: 476 NSSSDKDGGTDGPNADERDAKTKRSVNEDMGGVALGGVEPSQEHECKPPI 625
NSSSD G + P+++ + KRS+++ G AL S EH P+
Sbjct: 268 NSSSDSCNGNESPHSNSSSGEHKRSLSDMKGSQAL-----SPEHTAPSPV 312


>sp|O14727|APAF_HUMAN Apoptotic protease-activating factor 1 OS=Homo
sapiens GN=APAF1 PE=1 SV=2
Length = 1248

Score = 31.6 bits (70), Expect = 3.9
Identities = 14/29 (48%), Positives = 17/29 (58%)
Frame = +2

Query: 137 P*TLSPDNDDNFYSYNFSVHGTAVSSQHK 223
P TLSPD +D Y YNF + A + HK
Sbjct: 470 PHTLSPDQEDCMYWYNFLAYHMASAKMHK 498


tr_hit_id Q8PR08
Definition tr|Q8PR08|Q8PR08_XANAC 2-keto-4-pentenoate hydratase OS=Xanthomonas axonopodis pv. citri
Align length 45
Score (bit) 38.1
E-value 0.49
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= DK950837|Adiantum capillus-veneris mRNA, clone:
TST38A01NGRL0009_M06, 5'
(662 letters)

Database: uniprot_trembl.fasta
7,341,751 sequences; 2,391,615,440 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

tr|Q8PR08|Q8PR08_XANAC 2-keto-4-pentenoate hydratase OS=Xanthomo... 38 0.49
tr|Q09I97|Q09I97_HHV1 UL36 OS=Human herpesvirus 1 PE=4 SV=1 37 1.4
tr|B3XVZ0|B3XVZ0_ORYLA Transcription facter 19 OS=Oryzias latipe... 35 3.2
tr|Q16WW9|Q16WW9_AEDAE Lupus la ribonucleoprotein OS=Aedes aegyp... 35 3.2
tr|Q8PE38|Q8PE38_XANCP 2-keto-4-pentenoate hydratase OS=Xanthomo... 35 5.4
tr|Q4V0D2|Q4V0D2_XANC8 2-keto-4-pentenoate hydratase OS=Xanthomo... 35 5.4
tr|Q3BZD6|Q3BZD6_XANC5 Putative 2-keto-4-pentenoate hydratase OS... 35 5.4
tr|B0RLC4|B0RLC4_XANCB MhpD protein OS=Xanthomonas campestris pv... 35 5.4
tr|Q380V8|Q380V8_9TRYP Variant surface glycoprotein (VSG, atypic... 34 7.1
tr|A8N986|A8N986_COPC7 Putative uncharacterized protein OS=Copri... 34 7.1
tr|A5DUV6|A5DUV6_LODEL Sorting nexin-41 OS=Lodderomyces elongisp... 34 7.1
tr|Q6PHC9|Q6PHC9_DANRE One cut domain, family member 1 OS=Danio ... 34 9.2
tr|Q6NYT7|Q6NYT7_DANRE Onecut1 protein OS=Danio rerio GN=onecut1... 34 9.2
tr|Q5MD20|Q5MD20_DANRE Onecut-1 isoform a OS=Danio rerio GN=onec... 34 9.2
tr|Q5MD19|Q5MD19_DANRE Onecut-1 isoform b OS=Danio rerio GN=onec... 34 9.2

>tr|Q8PR08|Q8PR08_XANAC 2-keto-4-pentenoate hydratase OS=Xanthomonas
axonopodis pv. citri GN=mhpD PE=4 SV=1
Length = 273

Score = 38.1 bits (87), Expect = 0.49
Identities = 17/45 (37%), Positives = 26/45 (57%)
Frame = -3

Query: 597 EGSTPPKATPPMSSFTERFVFASRSSALGPSVPPSLSDDELNGEQ 463
+ +TPP +TP +S+ +RFV A R+ A P P + DD + Q
Sbjct: 4 DAATPPSSTPALSAIAQRFVEARRAGASLPDFPGQIPDDLVTAYQ 48


>tr|Q09I97|Q09I97_HHV1 UL36 OS=Human herpesvirus 1 PE=4 SV=1
Length = 3153

Score = 36.6 bits (83), Expect = 1.4
Identities = 22/69 (31%), Positives = 32/69 (46%)
Frame = +2

Query: 416 TARHHPSLLQSPCKFHCSPFNSSSDKDGGTDGPNADERDAKTKRSVNEDMGGVALGGVEP 595
T H P+ QSP + +S+ GT GP+A + +AK +D+ VAL G P
Sbjct: 307 TGPHPPTAAQSPPPTRARRDDRASETSRGTAGPSA-KPEAKRPNRAPDDVWAVALKGTPP 365

Query: 596 SQEHECKPP 622
+ PP
Sbjct: 366 TDPPSADPP 374


>tr|B3XVZ0|B3XVZ0_ORYLA Transcription facter 19 OS=Oryzias latipes
GN=TCF19 PE=4 SV=1
Length = 562

Score = 35.4 bits (80), Expect = 3.2
Identities = 23/76 (30%), Positives = 33/76 (43%)
Frame = +2

Query: 422 RHHPSLLQSPCKFHCSPFNSSSDKDGGTDGPNADERDAKTKRSVNEDMGGVALGGVEPSQ 601
R HP PC F SP +SSS + ++ + + E+ G V G VEP
Sbjct: 458 RKHPL---PPCPFPPSPSSSSSSSSTSSASSSSGSSTSSSSSDEEEEEGAVG-GVVEPCA 513

Query: 602 EHECKPPIRKDVRWPQ 649
C+ P + V+W Q
Sbjct: 514 APRCRLPQQDTVQWIQ 529


>tr|Q16WW9|Q16WW9_AEDAE Lupus la ribonucleoprotein OS=Aedes aegypti
GN=AAEL009073 PE=4 SV=1
Length = 1515

Score = 35.4 bits (80), Expect = 3.2
Identities = 22/72 (30%), Positives = 30/72 (41%)
Frame = +2

Query: 407 EPSTARHHPSLLQSPCKFHCSPFNSSSDKDGGTDGPNADERDAKTKRSVNEDMGGVALGG 586
+P A P + +P K P SSD TD P D + A++K+ E A+
Sbjct: 280 QPKPAPEQPKPVPAPAKEKKRPSQKSSDLSSNTDWPTLDSKSAESKKQGTE-QAPAAVSA 338

Query: 587 VEPSQEHECKPP 622
EP KPP
Sbjct: 339 TEPE-----KPP 345


>tr|Q8PE38|Q8PE38_XANCP 2-keto-4-pentenoate hydratase OS=Xanthomonas
campestris pv. campestris GN=mhpD PE=4 SV=1
Length = 273

Score = 34.7 bits (78), Expect = 5.4
Identities = 16/45 (35%), Positives = 24/45 (53%)
Frame = -3

Query: 597 EGSTPPKATPPMSSFTERFVFASRSSALGPSVPPSLSDDELNGEQ 463
+ +TPP +T +S +RFV A R+ A P P + DD + Q
Sbjct: 4 DAATPPSSTSTLSKIAQRFVEARRAGASLPDFPGEIPDDLVTAYQ 48


>tr|Q4V0D2|Q4V0D2_XANC8 2-keto-4-pentenoate hydratase OS=Xanthomonas
campestris pv. campestris (strain 8004) GN=XC_0154 PE=4
SV=1
Length = 273

Score = 34.7 bits (78), Expect = 5.4
Identities = 16/45 (35%), Positives = 24/45 (53%)
Frame = -3

Query: 597 EGSTPPKATPPMSSFTERFVFASRSSALGPSVPPSLSDDELNGEQ 463
+ +TPP +T +S +RFV A R+ A P P + DD + Q
Sbjct: 4 DAATPPSSTSTLSKIAQRFVEARRAGASLPDFPGEIPDDLVTAYQ 48


>tr|Q3BZD6|Q3BZD6_XANC5 Putative 2-keto-4-pentenoate hydratase
OS=Xanthomonas campestris pv. vesicatoria (strain 85-10)
GN=XCV0146 PE=4 SV=1
Length = 273

Score = 34.7 bits (78), Expect = 5.4
Identities = 16/45 (35%), Positives = 25/45 (55%)
Frame = -3

Query: 597 EGSTPPKATPPMSSFTERFVFASRSSALGPSVPPSLSDDELNGEQ 463
+ +TPP +T +S+ +RFV A R+ A P P + DD + Q
Sbjct: 4 DAATPPPSTSTLSAIAQRFVEARRAGASLPDFPGQIPDDLVTAYQ 48


>tr|B0RLC4|B0RLC4_XANCB MhpD protein OS=Xanthomonas campestris pv.
campestris (strain B100) GN=mhpD PE=4 SV=1
Length = 308

Score = 34.7 bits (78), Expect = 5.4
Identities = 16/45 (35%), Positives = 24/45 (53%)
Frame = -3

Query: 597 EGSTPPKATPPMSSFTERFVFASRSSALGPSVPPSLSDDELNGEQ 463
+ +TPP +T +S +RFV A R+ A P P + DD + Q
Sbjct: 39 DAATPPSSTSTLSKIAQRFVEARRAGASLPDFPGEIPDDLVTAYQ 83


>tr|Q380V8|Q380V8_9TRYP Variant surface glycoprotein (VSG,
atypical), putative OS=Trypanosoma brucei
GN=Tb11.14.0019 PE=4 SV=1
Length = 484

Score = 34.3 bits (77), Expect = 7.1
Identities = 19/48 (39%), Positives = 25/48 (52%)
Frame = +2

Query: 440 LQSPCKFHCSPFNSSSDKDGGTDGPNADERDAKTKRSVNEDMGGVALG 583
L + K HC + S +KD TD NAD ++A T +V G ALG
Sbjct: 159 LDAALKAHCVGQDDSREKDSSTDDHNADHKNAITIVTVTPTPPGSALG 206


>tr|A8N986|A8N986_COPC7 Putative uncharacterized protein
OS=Coprinopsis cinerea (strain Okayama-7 / 130 / FGSC
9003) GN=CC1G_00961 PE=4 SV=1
Length = 774

Score = 34.3 bits (77), Expect = 7.1
Identities = 20/62 (32%), Positives = 29/62 (46%)
Frame = +2

Query: 476 NSSSDKDGGTDGPNADERDAKTKRSVNEDMGGVALGGVEPSQEHECKPPIRKDVRWPQIL 655
N S D + G + DE K +R EDMGG A + ++H+ + K + PQ
Sbjct: 499 NKSEDAEEGDETMQVDESPPKKERR-EEDMGGQAEEDIPGWKDHDVDESLNKSIFAPQGS 557

Query: 656 PP 661
PP
Sbjct: 558 PP 559