DK950877
Clone id TST38A01NGRL0009_O01
Library
Length 369
Definition Adiantum capillus-veneris mRNA. clone: TST38A01NGRL0009_O01. 5' end sequence.
Accession
Tissue type prothallia
Developmental stage gametophyte
Contig ID -
Sequence
TCTGCTTTAAGCATAACCCCATGATCGAGCTTCTCACGGTGGCTATGGCGGGGGCCCATT
TAGCAAGCTCAGCACTCTCTCGAACTTTGGTCTTTTCTCTTTACATTTGTAAAATACTTT
CGCGCATTGCTTTTCCCAATTCTCTTGCTTTCGTGCTACGATACTCCACAGAGGATGATC
ACCTTGAGACAAAAGTGAAAACTGGCTGACCCATGCATGGCCATAGTACTGGCATGTTCT
GACTTGGGATCATCCGTACAACCTCATCATACGCCTCATGCTTTTCTGCTGCGACTTCGC
CTTCTCCTCGCAAGACCACCATTGCGATTTCTTTGAAATTCAGGAGGAACGTATCCATCT
TTTTTTTTT
■■Homology search results ■■ -
sp_hit_id Q969J2
Definition sp|Q969J2|ZKSC4_HUMAN Zinc finger protein with KRAB and SCAN domains 4 OS=Homo sapiens
Align length 81
Score (bit) 31.6
E-value 1.3
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= DK950877|Adiantum capillus-veneris mRNA, clone:
TST38A01NGRL0009_O01, 5'
(369 letters)

Database: uniprot_sprot.fasta
412,525 sequences; 148,809,765 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

sp|Q969J2|ZKSC4_HUMAN Zinc finger protein with KRAB and SCAN dom... 32 1.3
sp|Q81HT3|QOX2_BACCR Quinol oxidase subunit 2 OS=Bacillus cereus... 30 3.7
sp|Q73DE0|QOX2_BACC1 Quinol oxidase subunit 2 OS=Bacillus cereus... 30 3.7
sp|Q81V01|QOX2_BACAN Quinol oxidase subunit 2 OS=Bacillus anthra... 30 3.7
sp|Q9TT94|ACOD_BOVIN Acyl-CoA desaturase OS=Bos taurus GN=SCD PE... 30 4.9
sp|Q80WQ4|K1456_MOUSE Putative methyltransferase KIAA1456 OS=Mus... 29 8.3

>sp|Q969J2|ZKSC4_HUMAN Zinc finger protein with KRAB and SCAN
domains 4 OS=Homo sapiens GN=ZKSCAN4 PE=1 SV=1
Length = 545

Score = 31.6 bits (70), Expect = 1.3
Identities = 23/81 (28%), Positives = 33/81 (40%)
Frame = -1

Query: 303 KAKSQQKSMRRMMRLYG*SQVRTCQYYGHAWVSQFSLLSQGDHPLWSIVARKQENWEKQC 124
KA + + R R++G V+ ++ G +W SQ R + WE
Sbjct: 439 KAFRRNSHLLRHQRIHGDKNVQNPEH-GESWESQ---------------GRTESQWENTE 482

Query: 123 AKVFYKCKEKRPKFERVLSLL 61
A V YKC E F R SL+
Sbjct: 483 APVSYKCNECERSFTRNRSLI 503


>sp|Q81HT3|QOX2_BACCR Quinol oxidase subunit 2 OS=Bacillus cereus
(strain ATCC 14579 / DSM 31) GN=qoxA PE=1 SV=1
Length = 291

Score = 30.0 bits (66), Expect = 3.7
Identities = 14/44 (31%), Positives = 27/44 (61%), Gaps = 1/44 (2%)
Frame = +1

Query: 49 RGPI*QAQHSLELWSF-LFTFVKYFRALLFPILLLSCYDTPQRM 177
+GP+ +AQ+ L +WSF L + + +LF ++L+ + P+ M
Sbjct: 35 QGPVAKAQYDLIVWSFLLMSLIIAIVFILFTVILIRYREKPENM 78


>sp|Q73DE0|QOX2_BACC1 Quinol oxidase subunit 2 OS=Bacillus cereus
(strain ATCC 10987) GN=qoxA PE=3 SV=1
Length = 291

Score = 30.0 bits (66), Expect = 3.7
Identities = 14/44 (31%), Positives = 27/44 (61%), Gaps = 1/44 (2%)
Frame = +1

Query: 49 RGPI*QAQHSLELWSF-LFTFVKYFRALLFPILLLSCYDTPQRM 177
+GP+ +AQ+ L +WSF L + + +LF ++L+ + P+ M
Sbjct: 35 QGPVAKAQYDLIVWSFLLMSLIIAIVFILFTVILIRYREKPENM 78


>sp|Q81V01|QOX2_BACAN Quinol oxidase subunit 2 OS=Bacillus anthracis
GN=qoxA PE=3 SV=1
Length = 291

Score = 30.0 bits (66), Expect = 3.7
Identities = 14/44 (31%), Positives = 27/44 (61%), Gaps = 1/44 (2%)
Frame = +1

Query: 49 RGPI*QAQHSLELWSF-LFTFVKYFRALLFPILLLSCYDTPQRM 177
+GP+ +AQ+ L +WSF L + + +LF ++L+ + P+ M
Sbjct: 35 QGPVAKAQYDLIVWSFLLMSLIIAIVFILFTVILIRYREKPENM 78


>sp|Q9TT94|ACOD_BOVIN Acyl-CoA desaturase OS=Bos taurus GN=SCD PE=2
SV=2
Length = 359

Score = 29.6 bits (65), Expect = 4.9
Identities = 15/45 (33%), Positives = 24/45 (53%), Gaps = 5/45 (11%)
Frame = -1

Query: 282 SMRRMMRLYG*SQVRTCQYYGHAWVSQFSL-----LSQGDHPLWS 163
S+ + LYG + + TC+ Y + WV + L ++ G H LWS
Sbjct: 80 SLLHLGALYGITLIPTCKIYTYIWVLFYYLMGALGITAGAHRLWS 124


>sp|Q80WQ4|K1456_MOUSE Putative methyltransferase KIAA1456 OS=Mus
musculus GN=Kiaa1456 PE=2 SV=1
Length = 447

Score = 28.9 bits (63), Expect = 8.3
Identities = 12/27 (44%), Positives = 18/27 (66%), Gaps = 1/27 (3%)
Frame = -1

Query: 210 VSQFSLLSQG-DHPLWSIVARKQENWE 133
VS+ +LS G DH W I+A K+ +W+
Sbjct: 421 VSELQVLSSGNDHGNWCIIAEKKRSWD 447


tr_hit_id B1MIG8
Definition tr|B1MIG8|B1MIG8_MYCA9 Putative membrane protein, MmpL OS=Mycobacterium abscessus (strain ATCC 19977 / DSM 44196)
Align length 31
Score (bit) 32.7
E-value 9.3
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= DK950877|Adiantum capillus-veneris mRNA, clone:
TST38A01NGRL0009_O01, 5'
(369 letters)

Database: uniprot_trembl.fasta
7,341,751 sequences; 2,391,615,440 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

tr|B1MIG8|B1MIG8_MYCA9 Putative membrane protein, MmpL OS=Mycoba... 33 9.3
tr|A5A9S7|A5A9S7_MYCAB Mmpl4a protein OS=Mycobacterium abscessus... 33 9.3

>tr|B1MIG8|B1MIG8_MYCA9 Putative membrane protein, MmpL
OS=Mycobacterium abscessus (strain ATCC 19977 / DSM
44196) GN=MAB_4116c PE=4 SV=1
Length = 959

Score = 32.7 bits (73), Expect = 9.3
Identities = 12/31 (38%), Positives = 21/31 (67%)
Frame = -3

Query: 340 NFKEIAMVVLRGEGEVAAEKHEAYDEVVRMI 248
N + +A++VL GEG + + H+ YD V+R +
Sbjct: 77 NSESVAVIVLEGEGTLGDDAHKYYDAVIRQL 107


>tr|A5A9S7|A5A9S7_MYCAB Mmpl4a protein OS=Mycobacterium abscessus
GN=mmpl4a PE=4 SV=1
Length = 959

Score = 32.7 bits (73), Expect = 9.3
Identities = 12/31 (38%), Positives = 21/31 (67%)
Frame = -3

Query: 340 NFKEIAMVVLRGEGEVAAEKHEAYDEVVRMI 248
N + +A++VL GEG + + H+ YD V+R +
Sbjct: 77 NSESVAVIVLEGEGTLGDDAHKYYDAVIRQL 107