DK950906
Clone id TST38A01NGRL0009_P09
Library
Length 656
Definition Adiantum capillus-veneris mRNA. clone: TST38A01NGRL0009_P09. 5' end sequence.
Accession
Tissue type prothallia
Developmental stage gametophyte
Contig ID -
Sequence
ATGTGAGTGTGCTTATCCTTCCCCTTTTTACAAGGGTTATCAAAGCCATGGATGCTCGGG
GCATGAAGCCTGAATGCATCCCAAGAGCACTAATGCACTTTGCAAAGAAGCATCTTCCTG
CACTAAACAATAGGCGGCAAGGTACTCGTGCGGAGAGCTCTAATGTTGGCTTAGGCTCCT
CAGAAGTGGAGCAAAAGCATGTGCTAGAGACAGTTGAAAGGCTTCTTCCAACCCAGAAGG
GCGTTGTATCAACCAAATATCTGTCAGGTTTGCTGCGAAGTGCGATGCTATTGCATGTGG
GTCTTGATTGCAAGAGTAGTTTGGAAAGGAGACTTGGTCTACAGCTTGAGCAGGCAAGCT
TGGAGGACTTGCTTTCCCCCCCTTTGTCGTACAACATGGAGACTTTAAAAAACAGAGAGT
GCATCCAGAGAATTGTTGAGCATTTTCTGCTGTTAGACCAATCGGCAGTGGGTATGGTGT
CATCTCCAGGCTCAATTTTTGATGGGGCTTTGATGAGCCCTCCTACTCTGACACCAGTTA
TGATGGTGGCAAGGTTGCTGGATGCGTACCTTGCTGAGGTTGCTCCTGACGTGAATCTGA
AACCCCTCAAATTTTTGTCACTTGCAGAAGCTCTTCCTGAATTCGCAAGGATCTCT
■■Homology search results ■■ -
sp_hit_id Q9S9Q9
Definition sp|Q9S9Q9|Y1044_ARATH BTB/POZ domain-containing protein At1g30440 OS=Arabidopsis thaliana
Align length 223
Score (bit) 192.0
E-value 1.0e-48
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= DK950906|Adiantum capillus-veneris mRNA, clone:
TST38A01NGRL0009_P09, 5'
(656 letters)

Database: uniprot_sprot.fasta
412,525 sequences; 148,809,765 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

sp|Q9S9Q9|Y1044_ARATH BTB/POZ domain-containing protein At1g3044... 192 1e-48
sp|Q9FKB6|Y5880_ARATH BTB/POZ domain-containing protein At5g4880... 127 4e-29
sp|Q5KS50|NPH3_ORYSJ Coleoptile phototropism protein 1 OS=Oryza ... 117 5e-26
sp|Q9FMF5|RPT3_ARATH Root phototropism protein 3 OS=Arabidopsis ... 109 1e-23
sp|Q682S0|RPT2_ARATH Root phototropism protein 2 OS=Arabidopsis ... 107 4e-23
sp|Q13400|PM2L8_HUMAN Postmeiotic segregation increased 2-like p... 33 1.3
sp|O13339|TERT_SCHPO Telomerase reverse transcriptase OS=Schizos... 32 2.9
sp|A4D2C0|PMS4L_HUMAN Postmeiotic segregation increased 4-like p... 31 5.0
sp|A4D2B8|PM2L1_HUMAN Postmeiotic segregation increased 2-like p... 31 5.0
sp|Q8N1G0|ZN687_HUMAN Zinc finger protein 687 OS=Homo sapiens GN... 31 6.5
sp|Q5B4D1|GRC3_EMENI Protein grc3 OS=Emericella nidulans GN=grc3... 31 6.5
sp|Q04338|VTI1_YEAST t-SNARE VTI1 OS=Saccharomyces cerevisiae GN... 30 8.5
sp|P00457|NIFH1_ANASP Nitrogenase iron protein 1 OS=Anabaena sp.... 30 8.5
sp|B0CF30|MUTS_ACAM1 DNA mismatch repair protein mutS OS=Acaryoc... 30 8.5

>sp|Q9S9Q9|Y1044_ARATH BTB/POZ domain-containing protein At1g30440
OS=Arabidopsis thaliana GN=At1g30440 PE=1 SV=2
Length = 665

Score = 192 bits (488), Expect = 1e-48
Identities = 106/223 (47%), Positives = 155/223 (69%), Gaps = 7/223 (3%)
Frame = +3

Query: 6 SVLILPLFTRVIKAMDARGMKPECIPRALMHFAKKHLPALNNRRQGTRAE---SSNVGLG 176
S+L PLF R+I M++RG++ + I +L ++ +KHLP L RR G + S+ +G G
Sbjct: 221 SMLSFPLFKRLITVMESRGIREDIIAGSLTYYTRKHLPGLKRRRGGPESSGRFSTPLGSG 280

Query: 177 S--SEVEQKHVLETVERLLPTQKGVVSTKYLSGLLRSAMLLHVGLDCKSSLERRLGLQLE 350
+ SE EQK++LE ++ LL QKG+V TK+ +LR A +L DC ++LE+R+G+QL+
Sbjct: 281 NVLSEEEQKNLLEEIQELLRMQKGLVPTKFFVDMLRIAKILKASPDCIANLEKRIGMQLD 340

Query: 351 QASLEDLLSPPLSYNMETLKNRECIQRIVEHFLLLDQSAVGMVSSP-GSIFDGALM-SPP 524
QA+LEDL+ P S+ METL + + +QRI++HFL DQ G V SP S+ DG L+ SP
Sbjct: 341 QAALEDLVMPSFSHTMETLYDVDSVQRILDHFLGTDQIMPGGVGSPCSSVDDGNLIGSPQ 400

Query: 525 TLTPVMMVARLLDAYLAEVAPDVNLKPLKFLSLAEALPEFARI 653
++TP+ VA+L+D YLAEVAPDVNLK KF +LA ++PE+AR+
Sbjct: 401 SITPMTAVAKLIDGYLAEVAPDVNLKLPKFQALAASIPEYARL 443


>sp|Q9FKB6|Y5880_ARATH BTB/POZ domain-containing protein At5g48800
OS=Arabidopsis thaliana GN=At5g48800 PE=1 SV=1
Length = 614

Score = 127 bits (320), Expect = 4e-29
Identities = 82/216 (37%), Positives = 121/216 (56%)
Frame = +3

Query: 3 VSVLILPLFTRVIKAMDARGMKPECIPRALMHFAKKHLPALNNRRQGTRAESSNVGLGSS 182
+SVL + L+ RV+ AM RG++PE I +L+ +A++ L S
Sbjct: 225 LSVLRIDLYQRVMNAMKCRGVRPESIGASLVSYAERELTK------------------RS 266

Query: 183 EVEQKHVLETVERLLPTQKGVVSTKYLSGLLRSAMLLHVGLDCKSSLERRLGLQLEQASL 362
E EQ ++ET+ LLP + VV +L GLLR A++L + C+ LERRLG QL+ A+L
Sbjct: 267 EHEQT-IVETIVTLLPVENLVVPISFLFGLLRRAVILDTSVSCRLDLERRLGSQLDMATL 325

Query: 363 EDLLSPPLSYNMETLKNRECIQRIVEHFLLLDQSAVGMVSSPGSIFDGALMSPPTLTPVM 542
+DLL P + +TL + + + RI+ +F Q S+F+ P+ T +
Sbjct: 326 DDLLIPSFRHAGDTLFDIDTVHRILVNF---SQQGGDDSEDEESVFECDSPHSPSQTAMF 382

Query: 543 MVARLLDAYLAEVAPDVNLKPLKFLSLAEALPEFAR 650
VA+L+D+YLAE+APD NL KFL +AEALP AR
Sbjct: 383 KVAKLVDSYLAEIAPDANLDLSKFLLIAEALPPHAR 418


>sp|Q5KS50|NPH3_ORYSJ Coleoptile phototropism protein 1 OS=Oryza
sativa subsp. japonica GN=CPT1 PE=2 SV=1
Length = 762

Score = 117 bits (293), Expect = 5e-26
Identities = 92/272 (33%), Positives = 135/272 (49%), Gaps = 56/272 (20%)
Frame = +3

Query: 3 VSVLILPLFTRVIKAMDARGMKPECIPRALMHFAKKHLPALNN------RRQGTRAESSN 164
VSVL + F RV+ A+ +GM+ + I A+ H+A K LP L A++S
Sbjct: 274 VSVLRIDHFVRVVTAIKVKGMRFDLIGAAITHYASKWLPGLTKDAPLGATHDEPWAQASA 333

Query: 165 VGLGSSEV------------------------EQKHVLETVERLLPTQKGVVSTKYLSGL 272
G+G + EQ+ V+E++ + P Q+ VS +L L
Sbjct: 334 AGVGGGGLHMMIISGAGGGKDDVLAACSAPSREQRMVVESIISITPPQRDSVSCGFLLRL 393

Query: 273 LRSAMLLHVGLDCKSSLERRLGLQLEQASLEDLLSPPLSYN---METLKNRECIQRIVEH 443
LR A++L + LE+R+G+QLEQA+L DLL P SY +T + + +QR+VEH
Sbjct: 394 LRLAIMLRAAPALVTELEKRVGMQLEQAALADLLIP--SYGGRAADTAYDVDLVQRLVEH 451

Query: 444 FLLLDQSAVGMVSSPG----------SIFDGALMSPPT-------------LTPVMMVAR 554
FL+ +Q+ + + SSPG + G + PP+ L VAR
Sbjct: 452 FLVQEQTEMAVASSPGRGDPPPPPQPEYYSGRM--PPSSAAAASASASTGGLNAKARVAR 509

Query: 555 LLDAYLAEVAPDVNLKPLKFLSLAEALPEFAR 650
LLD+YL+EV+ D NL KF LAE+LPE AR
Sbjct: 510 LLDSYLSEVSRDRNLSLTKFQVLAESLPESAR 541


>sp|Q9FMF5|RPT3_ARATH Root phototropism protein 3 OS=Arabidopsis
thaliana GN=RPT3 PE=1 SV=1
Length = 745

Score = 109 bits (272), Expect = 1e-23
Identities = 91/284 (32%), Positives = 134/284 (47%), Gaps = 68/284 (23%)
Frame = +3

Query: 3 VSVLILPLFTRVIKAMDARGMKPECIPRALMHFAKKHL------------PALNNRRQG- 143
VS+L + F RVI A+ +GM+ E + +MH+A K L PA+++ G
Sbjct: 255 VSILRIDHFVRVITAIKVKGMRFELLGAVIMHYAGKWLPGLIKEGGVAIAPAMSSAIGGG 314

Query: 144 -------------------------------------TRAESSNV----GLGSSEVEQKH 200
T +V GLG S +Q+
Sbjct: 315 LGLGGDEMSISCGSNSSGGSSGPDWKGGLHMVLSAGKTNGHQDSVACLAGLGISPKDQRM 374

Query: 201 VLETVERLLPTQKGVVSTKYLSGLLRSAMLLHVGLDCKSSLERRLGLQLEQASLEDLLSP 380
++E++ ++P QK V+ +L LLR+A +L V + LE+R+G+Q EQA+L+DLL P
Sbjct: 375 IVESLISIIPPQKDSVTCSFLLRLLRAANMLKVAPALITELEKRVGMQFEQATLQDLLIP 434

Query: 381 PLSYNMETLKNRECIQRIVEHFLLLDQ----SAVGMVSSP----------GSIFDGALMS 518
+ ET+ + + +QR++EHFL+ +Q S M SP G+ +G
Sbjct: 435 GYNNKGETMYDVDLVQRLLEHFLVQEQTEGSSPSRMSPSPSQSMYADIPRGNNNNGGGGG 494

Query: 519 PPTLTPVMMVARLLDAYLAEVAPDVNLKPLKFLSLAEALPEFAR 650
M VARL+D+YL EVA D NL KF LAEALPE AR
Sbjct: 495 GNNQNAKMRVARLVDSYLTEVARDRNLPLTKFQVLAEALPESAR 538


>sp|Q682S0|RPT2_ARATH Root phototropism protein 2 OS=Arabidopsis
thaliana GN=RPT2 PE=1 SV=2
Length = 593

Score = 107 bits (268), Expect = 4e-23
Identities = 68/218 (31%), Positives = 124/218 (56%), Gaps = 2/218 (0%)
Frame = +3

Query: 9 VLILPLFTRVIKAMDARGMKPECIPRALMHFAKKHLPALNNRRQGTRAESSNVGLGSSEV 188
+L + F+ V+ +M RG+KP + A++ + +K L L G + S+ G S+
Sbjct: 195 ILDVDFFSDVVSSMKQRGVKPSSLASAIITYTEKSLRDLVRDHSGRGVKYSDPGDNESDE 254

Query: 189 --EQKHVLETVERLLPTQKGVVSTKYLSGLLRSAMLLHVGLDCKSSLERRLGLQLEQASL 362
+Q+ +++++ LLP+ KG+ +L LLR A+ L L CK+ LE+R+ + LE S+
Sbjct: 255 RSQQRDLVQSIVSLLPSDKGLFPVNFLCSLLRCAVFLDTSLTCKNELEKRISVVLEHVSV 314

Query: 363 EDLLSPPLSYNMETLKNRECIQRIVEHFLLLDQSAVGMVSSPGSIFDGALMSPPTLTPVM 542
+DLL P +Y+ E L + + ++RI+ F+ +++ VG+ + G F+ + S +
Sbjct: 315 DDLLIPSFTYDGERLLDLDSVRRIISAFVEKEKN-VGVFN--GGDFNRGVCS----VSLQ 367

Query: 543 MVARLLDAYLAEVAPDVNLKPLKFLSLAEALPEFARIS 656
VA+ +D+YLAE+A +L KF ++A +P+ AR S
Sbjct: 368 RVAKTVDSYLAEIATYGDLTISKFNAIANLVPKSARKS 405


>sp|Q13400|PM2L8_HUMAN Postmeiotic segregation increased 2-like
protein 8 OS=Homo sapiens GN=PMS2L8 PE=2 SV=1
Length = 389

Score = 33.1 bits (74), Expect = 1.3
Identities = 25/88 (28%), Positives = 37/88 (42%), Gaps = 16/88 (18%)
Frame = -3

Query: 504 HQKLSLEMTPYPLPIGLTAENAQQFSGCTL--------------CFLKSPCCTTKGGKAS 367
H ++ TPYP P G+T Q FS + CF + C + +AS
Sbjct: 288 HYGKIIQKTPYPRPRGMTVSVKQLFSTLPVHHKEFQRNIKKKRACFPFAFCRDCQFPEAS 347

Query: 366 PPSLPAQAVDQV--SFPNYSCNQDPHAI 289
P LP Q V+ S P + C+ + + I
Sbjct: 348 PAMLPVQPVELTPRSTPPHPCSLEDNVI 375


>sp|O13339|TERT_SCHPO Telomerase reverse transcriptase
OS=Schizosaccharomyces pombe GN=trt1 PE=1 SV=1
Length = 988

Score = 32.0 bits (71), Expect = 2.9
Identities = 22/80 (27%), Positives = 32/80 (40%)
Frame = -3

Query: 297 HAIASHFAANLTDIWLIQRPSGLEEAFQLSLAHAFAPLLRSLSQH*SSPHEYLAAYCLVQ 118
H+I ++ W+ R GL AFQ+ H PL +SQ P L Y L++
Sbjct: 247 HSICDRNTVHMWLQWIFPRQFGLINAFQVKQLHKVIPL---VSQSTVVPKRLLKVYPLIE 303

Query: 117 EDASLQSALVLLGCIQASCP 58
+ A + L CP
Sbjct: 304 QTAKRLHRISLSKVYNHYCP 323


>sp|A4D2C0|PMS4L_HUMAN Postmeiotic segregation increased 4-like
protein OS=Homo sapiens GN=PMS4L PE=3 SV=1
Length = 255

Score = 31.2 bits (69), Expect = 5.0
Identities = 24/88 (27%), Positives = 36/88 (40%), Gaps = 16/88 (18%)
Frame = -3

Query: 504 HQKLSLEMTPYPLPIGLTAENAQQFSGCTL--------------CFLKSPCCTTKGGKAS 367
H ++ TPYP P G+T Q FS + CF + C + +AS
Sbjct: 154 HYGKIIQKTPYPHPRGMTVSVKQLFSTLPVHHKEFQRNIKKKRACFPFAFCRDCQFPEAS 213

Query: 366 PPSLPAQAVDQV--SFPNYSCNQDPHAI 289
P LP Q + S P + C+ + + I
Sbjct: 214 PAMLPVQPAELTPRSTPPHPCSLEDNVI 241


>sp|A4D2B8|PM2L1_HUMAN Postmeiotic segregation increased 2-like
protein 1 OS=Homo sapiens GN=PMS2L1 PE=2 SV=1
Length = 440

Score = 31.2 bits (69), Expect = 5.0
Identities = 24/88 (27%), Positives = 36/88 (40%), Gaps = 16/88 (18%)
Frame = -3

Query: 504 HQKLSLEMTPYPLPIGLTAENAQQFSGCTL--------------CFLKSPCCTTKGGKAS 367
H ++ TPYP P G+T Q FS + CF + C + +AS
Sbjct: 339 HYGKIIQKTPYPHPRGMTVSVKQLFSTLPVHHKEFQRNIKKKRACFPFAFCRDCQFPEAS 398

Query: 366 PPSLPAQAVDQV--SFPNYSCNQDPHAI 289
P LP Q + S P + C+ + + I
Sbjct: 399 PAMLPVQPAELTPRSTPPHPCSLEDNVI 426


>sp|Q8N1G0|ZN687_HUMAN Zinc finger protein 687 OS=Homo sapiens
GN=ZNF687 PE=1 SV=1
Length = 1237

Score = 30.8 bits (68), Expect = 6.5
Identities = 24/65 (36%), Positives = 28/65 (43%), Gaps = 1/65 (1%)
Frame = -3

Query: 600 SDSRQEQPQQGTHPATLPPS*LVSE*EGSSKPHQKLSLEMTPYPLPIGLTAEN-AQQFSG 424
SDS E+P T PA P G P + S T L +GL E+ AQQ
Sbjct: 1083 SDSCSEEPDSTTPPAKSPRG---GPGSGGHGPLRYRSSSSTEQSLMMGLRVEDGAQQCLD 1139

Query: 423 CTLCF 409
C LCF
Sbjct: 1140 CGLCF 1144


tr_hit_id A7Q1C4
Definition tr|A7Q1C4|A7Q1C4_VITVI Chromosome chr10 scaffold_43, whole genome shotgun sequence OS=Vitis vinifera
Align length 220
Score (bit) 227.0
E-value 4.0e-58
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= DK950906|Adiantum capillus-veneris mRNA, clone:
TST38A01NGRL0009_P09, 5'
(656 letters)

Database: uniprot_trembl.fasta
7,341,751 sequences; 2,391,615,440 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

tr|A7Q1C4|A7Q1C4_VITVI Chromosome chr10 scaffold_43, whole genom... 227 4e-58
tr|A5B9R9|A5B9R9_VITVI Putative uncharacterized protein OS=Vitis... 225 2e-57
tr|A2Q365|A2Q365_MEDTR BTB/POZ; Superoxide dismutase, copper/zin... 211 2e-53
tr|B8LPD8|B8LPD8_PICSI Putative uncharacterized protein OS=Picea... 206 1e-51
tr|B8BAG6|B8BAG6_ORYSI Putative uncharacterized protein OS=Oryza... 202 2e-50
tr|Q8W0R6|Q8W0R6_SORBI Putative photoreceptor-interacting protei... 201 2e-50
tr|A7PT38|A7PT38_VITVI Chromosome chr8 scaffold_29, whole genome... 201 3e-50
tr|Q7EZR6|Q7EZR6_ORYSJ Os08g0130600 protein OS=Oryza sativa subs... 201 4e-50
tr|A3BPC3|A3BPC3_ORYSJ Putative uncharacterized protein OS=Oryza... 201 4e-50
tr|Q6AST7|Q6AST7_ORYSJ NPH3 family protein OS=Oryza sativa subsp... 197 5e-49
tr|Q10G69|Q10G69_ORYSJ Transposon protein, putative, Mutator sub... 197 5e-49
tr|Q10G68|Q10G68_ORYSJ Transposon protein, putative, Mutator sub... 197 5e-49
tr|B8AN49|B8AN49_ORYSI Putative uncharacterized protein OS=Oryza... 197 5e-49
tr|A3AKR6|A3AKR6_ORYSJ Putative uncharacterized protein OS=Oryza... 197 5e-49
tr|Q2QM90|Q2QM90_ORYSJ Transposon protein, putative, Mutator sub... 197 6e-49
tr|B8Q8A3|B8Q8A3_ORYSI SKIP interacting protein 17 OS=Oryza sati... 197 6e-49
tr|B8BMZ7|B8BMZ7_ORYSI Putative uncharacterized protein OS=Oryza... 197 6e-49
tr|A3CJE3|A3CJE3_ORYSJ Putative uncharacterized protein OS=Oryza... 197 6e-49
tr|Q1EPH5|Q1EPH5_MUSAC Nonphototropic hypocotyl 3 (NPH3) family ... 194 3e-48
tr|A9SSW2|A9SSW2_PHYPA Predicted protein OS=Physcomitrella paten... 191 3e-47
tr|A9T7K0|A9T7K0_PHYPA Predicted protein (Fragment) OS=Physcomit... 190 6e-47
tr|A7PI35|A7PI35_VITVI Chromosome chr13 scaffold_17, whole genom... 189 1e-46
tr|B4FCV5|B4FCV5_MAIZE Putative uncharacterized protein OS=Zea m... 187 6e-46
tr|Q5ZCG0|Q5ZCG0_ORYSJ Putative non-phototropic hypocotyl 3 OS=O... 182 1e-44
tr|B8AAF3|B8AAF3_ORYSI Putative uncharacterized protein OS=Oryza... 182 1e-44
tr|A2ZYF5|A2ZYF5_ORYSJ Putative uncharacterized protein OS=Oryza... 182 1e-44
tr|B6U264|B6U264_MAIZE Transposon protein Mutator sub-class OS=Z... 173 7e-42
tr|B4FAN5|B4FAN5_MAIZE Putative uncharacterized protein OS=Zea m... 173 7e-42
tr|Q9LYW0|Q9LYW0_ARATH Photoreceptor-interacting protein-like (P... 171 5e-41
tr|Q7XND4|Q7XND4_ORYSA OSJNBb0034I13.5 protein OS=Oryza sativa G... 170 8e-41

>tr|A7Q1C4|A7Q1C4_VITVI Chromosome chr10 scaffold_43, whole genome
shotgun sequence OS=Vitis vinifera GN=GSVIVT00028396001
PE=4 SV=1
Length = 632

Score = 227 bits (579), Expect = 4e-58
Identities = 122/220 (55%), Positives = 159/220 (72%), Gaps = 4/220 (1%)
Frame = +3

Query: 3 VSVLILPLFTRVIKAMDARGMKPECIPRALMHFAKKHLPALNNRR----QGTRAESSNVG 170
VS L L L+ R++ M++RG+K E I +L +AKK+LP LN R+ TR E +G
Sbjct: 220 VSTLSLSLYKRLVSVMESRGIKQEIIAGSLTFYAKKYLPGLNRRQVASESSTRLEPVALG 279

Query: 171 LGSSEVEQKHVLETVERLLPTQKGVVSTKYLSGLLRSAMLLHVGLDCKSSLERRLGLQLE 350
SE +QK +LE ++RLLP QKG +STK L GLLR+AM+L C S+LERR+G+QL+
Sbjct: 280 APPSEEDQKLLLEEIDRLLPMQKGAISTKVLFGLLRTAMILRASPPCISNLERRIGMQLD 339

Query: 351 QASLEDLLSPPLSYNMETLKNRECIQRIVEHFLLLDQSAVGMVSSPGSIFDGALMSPPTL 530
QA+LEDLL P SY+METL N EC+QRI+EHFL +DQ+ G +SP SI DG LM P+L
Sbjct: 340 QATLEDLLMPNFSYSMETLYNVECVQRILEHFLAMDQATGG--ASPCSIDDGQLMGSPSL 397

Query: 531 TPVMMVARLLDAYLAEVAPDVNLKPLKFLSLAEALPEFAR 650
TP+ MVA+L+D YLAEVAPDVNLK KF SLA ++P++AR
Sbjct: 398 TPITMVAKLIDGYLAEVAPDVNLKLPKFQSLAASIPDYAR 437


>tr|A5B9R9|A5B9R9_VITVI Putative uncharacterized protein OS=Vitis
vinifera GN=VITISV_002335 PE=4 SV=1
Length = 668

Score = 225 bits (574), Expect = 2e-57
Identities = 121/220 (55%), Positives = 159/220 (72%), Gaps = 4/220 (1%)
Frame = +3

Query: 3 VSVLILPLFTRVIKAMDARGMKPECIPRALMHFAKKHLPALNNRRQGT----RAESSNVG 170
VS L L L+ R++ M++RG+K E I +L +AKK+LP LN R+ + R E +G
Sbjct: 220 VSTLSLSLYKRLVSVMESRGIKQEIIAGSLTFYAKKYLPGLNRRQVASESSMRLEPVALG 279

Query: 171 LGSSEVEQKHVLETVERLLPTQKGVVSTKYLSGLLRSAMLLHVGLDCKSSLERRLGLQLE 350
SE +QK +LE ++RLLP QKG +STK L GLLR+AM+L C S+LERR+G+QL+
Sbjct: 280 APPSEEDQKLLLEEIDRLLPMQKGAISTKVLFGLLRTAMILRASPSCISNLERRIGMQLD 339

Query: 351 QASLEDLLSPPLSYNMETLKNRECIQRIVEHFLLLDQSAVGMVSSPGSIFDGALMSPPTL 530
QA+LEDLL P SY+METL N EC+QRI+EHFL +DQ+ G +SP SI DG LM P+L
Sbjct: 340 QATLEDLLMPNFSYSMETLYNVECVQRILEHFLAMDQATGG--ASPCSIDDGQLMGSPSL 397

Query: 531 TPVMMVARLLDAYLAEVAPDVNLKPLKFLSLAEALPEFAR 650
TP+ MVA+L+D YLAEVAPDVNLK KF SLA ++P++AR
Sbjct: 398 TPITMVAKLIDGYLAEVAPDVNLKLPKFQSLAASIPDYAR 437


>tr|A2Q365|A2Q365_MEDTR BTB/POZ; Superoxide dismutase, copper/zinc
binding; NPH3 OS=Medicago truncatula
GN=MtrDRAFT_AC154867g27v2 PE=4 SV=1
Length = 647

Score = 211 bits (538), Expect = 2e-53
Identities = 116/221 (52%), Positives = 159/221 (71%), Gaps = 5/221 (2%)
Frame = +3

Query: 3 VSVLILPLFTRVIKAMDARGMKPECIPRALMHFAKKHLPALNNRR----QGTRAESSNVG 170
V+ L LP++ R+I M++RG++ E I +L +AK +LP LN R+ TR + +
Sbjct: 219 VANLSLPIYKRLIAVMESRGIRQEIIAGSLAFYAKTYLPGLNRRKVSGESSTRLTQAALL 278

Query: 171 LGSSEVEQKHVLETVERLLPTQKGVVSTKYLSGLLRSAMLLHVGLDCKSSLERRLGLQLE 350
SE +QK +LE +++LLP QKG+V TK+L GLLR+AM+L V C SSLE+R+G+QL+
Sbjct: 279 SPPSEEDQKILLEEIDQLLPMQKGLVQTKFLFGLLRTAMILRVNPSCISSLEKRIGMQLD 338

Query: 351 QASLEDLLSPPLSYNMETLKNRECIQRIVEHFLLLDQSAVGMVSSPGSI-FDGALMSPPT 527
QA+LEDLL P SY+METL N +C+QRI++HFL +DQ G +SP SI DG L+ P+
Sbjct: 339 QAALEDLLMPNFSYSMETLYNVDCVQRILDHFLAMDQITGG--ASPCSIDEDGQLIGSPS 396

Query: 528 LTPVMMVARLLDAYLAEVAPDVNLKPLKFLSLAEALPEFAR 650
LTP+ MVA+L+D YLAEVAPDVNLK KF +LA A+PE+AR
Sbjct: 397 LTPITMVAKLIDGYLAEVAPDVNLKLPKFQALAAAVPEYAR 437


>tr|B8LPD8|B8LPD8_PICSI Putative uncharacterized protein OS=Picea
sitchensis PE=2 SV=1
Length = 648

Score = 206 bits (524), Expect = 1e-51
Identities = 107/217 (49%), Positives = 153/217 (70%)
Frame = +3

Query: 3 VSVLILPLFTRVIKAMDARGMKPECIPRALMHFAKKHLPALNNRRQGTRAESSNVGLGSS 182
V+ L LP + RVI AM+A+G++ E I A+M++AKK +P L RRQG A++ ++
Sbjct: 225 VAELSLPFYKRVISAMEAKGIRQESIAGAVMYYAKKFIPGLT-RRQGI-AKTLSLTSAPC 282

Query: 183 EVEQKHVLETVERLLPTQKGVVSTKYLSGLLRSAMLLHVGLDCKSSLERRLGLQLEQASL 362
E +Q+ +LET+E LLP + +TK+L GLLR+A +L+ CK SLERR+GLQLE A+L
Sbjct: 283 EADQRELLETIESLLPDHRAGNTTKFLFGLLRTANILNASDSCKKSLERRIGLQLEHATL 342

Query: 363 EDLLSPPLSYNMETLKNRECIQRIVEHFLLLDQSAVGMVSSPGSIFDGALMSPPTLTPVM 542
+DLL P SY +ETL + +C+QRI++HF+ Q A + +P +G M P++TP+M
Sbjct: 343 DDLLIPSYSYTVETLYDIDCVQRILQHFMAGQQGAESTLVNPHGFEEGGFMGSPSMTPIM 402

Query: 543 MVARLLDAYLAEVAPDVNLKPLKFLSLAEALPEFARI 653
MV +L+D YLAEVAPD NLKP KF SLA+ALP++AR+
Sbjct: 403 MVGKLVDGYLAEVAPDGNLKPAKFHSLADALPDYARL 439


>tr|B8BAG6|B8BAG6_ORYSI Putative uncharacterized protein OS=Oryza
sativa subsp. indica GN=OsI_27703 PE=4 SV=1
Length = 641

Score = 202 bits (513), Expect = 2e-50
Identities = 111/221 (50%), Positives = 156/221 (70%), Gaps = 5/221 (2%)
Frame = +3

Query: 3 VSVLILPLFTRVIKAMDARGMKPECIPRALMHFAKKHLPALNNRRQGTRAESSNVGLGS- 179
VS L LPL+ +VI AM+ RG+ + I +L H+AK+ LP LN RR+ SS + + S
Sbjct: 220 VSCLSLPLYKKVISAMEYRGINQDIIVGSLNHYAKRRLPGLN-RRKSISDVSSCLSISSL 278

Query: 180 ----SEVEQKHVLETVERLLPTQKGVVSTKYLSGLLRSAMLLHVGLDCKSSLERRLGLQL 347
SE EQK++LE ++RLLP Q+GV S K L GLLR+A++L C S+LERR+G+QL
Sbjct: 279 TSIPSEEEQKYLLEEIDRLLPFQRGVTSCKLLFGLLRTAIILKASPSCVSNLERRIGMQL 338

Query: 348 EQASLEDLLSPPLSYNMETLKNRECIQRIVEHFLLLDQSAVGMVSSPGSIFDGALMSPPT 527
++A+LEDLL P +S ++ETL + +C+ RI++HFL +DQ G +SPG D +++ P+
Sbjct: 339 DKATLEDLLIPNISESVETLYDVDCVHRILDHFLAMDQETGG--ASPGLGEDAQMLASPS 396

Query: 528 LTPVMMVARLLDAYLAEVAPDVNLKPLKFLSLAEALPEFAR 650
L P+ MVA+L+D YLAEVAPDVNLK KF SLA A+P++AR
Sbjct: 397 LMPITMVAKLIDGYLAEVAPDVNLKLPKFRSLAAAIPDYAR 437


>tr|Q8W0R6|Q8W0R6_SORBI Putative photoreceptor-interacting protein
OS=Sorghum bicolor GN=S250_18C08.32 PE=4 SV=1
Length = 658

Score = 201 bits (512), Expect = 2e-50
Identities = 112/221 (50%), Positives = 157/221 (71%), Gaps = 5/221 (2%)
Frame = +3

Query: 3 VSVLILPLFTRVIKAMDARGMKPECIPRALMHFAKKHLPALNNRRQGTRAESSNVGLGS- 179
VS L LPL+ ++I AM+ RG+ E I +L H+AK+ LP LN RR+ S+ + + S
Sbjct: 220 VSCLSLPLYKKLISAMEYRGISQEIIVGSLNHYAKRRLPGLN-RRKSIGDVSNCLSMTSL 278

Query: 180 ----SEVEQKHVLETVERLLPTQKGVVSTKYLSGLLRSAMLLHVGLDCKSSLERRLGLQL 347
SE +QK++LE ++RLLP Q+GV S K L GLLR+A+ L C S+LERR+G+QL
Sbjct: 279 TSIPSEDDQKYLLEEIDRLLPFQRGVTSCKLLFGLLRTAIFLKASPSCVSNLERRIGMQL 338

Query: 348 EQASLEDLLSPPLSYNMETLKNRECIQRIVEHFLLLDQSAVGMVSSPGSIFDGALMSPPT 527
++ASLEDLL P +S ++ETL + +C QRI++HFL +DQ G +SPG DG +++ P+
Sbjct: 339 DKASLEDLLIPNVSDSVETLYDVDCAQRILDHFLAMDQETGG--ASPGIGEDGQMLASPS 396

Query: 528 LTPVMMVARLLDAYLAEVAPDVNLKPLKFLSLAEALPEFAR 650
L P+MMVA+L+D YLAEVAPD+NLK KF SLA A+P++AR
Sbjct: 397 LMPIMMVAKLIDGYLAEVAPDMNLKLPKFRSLAAAIPDYAR 437


>tr|A7PT38|A7PT38_VITVI Chromosome chr8 scaffold_29, whole genome
shotgun sequence OS=Vitis vinifera GN=GSVIVT00023199001
PE=4 SV=1
Length = 624

Score = 201 bits (511), Expect = 3e-50
Identities = 110/222 (49%), Positives = 160/222 (72%), Gaps = 6/222 (2%)
Frame = +3

Query: 3 VSVLILPLFTRVIKAMDARGMKPECIPRALMHFAKKHLPALNNRRQGTRAESSNVGLGS- 179
VS L LP + R+++A++ RGMKPE + +L+ +AK++LP +N RQ + ++++V G+
Sbjct: 217 VSFLSLPFYKRMMQAVELRGMKPERVAGSLIFYAKRYLPLMN--RQSSFKDTNHVNPGTT 274

Query: 180 ----SEVEQKHVLETVERLLPTQKGVVSTKYLSGLLRSAMLLHVGLDCKSSLERRLGLQL 347
SE +Q+ +LE + LLP QKGV STK+L LLR+AM+LH C+ +LERR+G QL
Sbjct: 275 IPTPSEADQRALLEDIVDLLPNQKGVTSTKFLLRLLRTAMILHTSSLCRENLERRVGAQL 334

Query: 348 EQASLEDLLSPPLSYNMETLKNRECIQRIVEHFLLLDQSAVGMVSSPGSIFDGALM-SPP 524
+QA LEDLL P + Y++ETL + +C+QRI++HF+ ++ +AV +SP + +G LM P
Sbjct: 335 DQAVLEDLLIPNMGYSVETLYDIDCVQRILDHFMSVENTAVA-TASPCIVEEGKLMDGPD 393

Query: 525 TLTPVMMVARLLDAYLAEVAPDVNLKPLKFLSLAEALPEFAR 650
LTPVM+VA L+D YLAEVAPDVNLK KF SLA A+P++AR
Sbjct: 394 FLTPVMLVANLVDGYLAEVAPDVNLKLPKFQSLAAAVPDYAR 435


>tr|Q7EZR6|Q7EZR6_ORYSJ Os08g0130600 protein OS=Oryza sativa subsp.
japonica GN=P0582D05.131 PE=4 SV=1
Length = 641

Score = 201 bits (510), Expect = 4e-50
Identities = 110/221 (49%), Positives = 156/221 (70%), Gaps = 5/221 (2%)
Frame = +3

Query: 3 VSVLILPLFTRVIKAMDARGMKPECIPRALMHFAKKHLPALNNRRQGTRAESSNVGLGS- 179
VS L LPL+ +VI AM+ RG+ + I +L H+AK+ LP LN RR+ SS + + S
Sbjct: 220 VSCLSLPLYKKVISAMEYRGINQDIIVGSLNHYAKRRLPGLN-RRKSISDVSSCLSISSL 278

Query: 180 ----SEVEQKHVLETVERLLPTQKGVVSTKYLSGLLRSAMLLHVGLDCKSSLERRLGLQL 347
SE EQK++LE ++RLLP Q+GV S K L GLLR+A++L C S+LERR+G+QL
Sbjct: 279 TSIPSEEEQKYLLEEIDRLLPFQRGVTSCKLLFGLLRTAIILKASPSCVSNLERRIGMQL 338

Query: 348 EQASLEDLLSPPLSYNMETLKNRECIQRIVEHFLLLDQSAVGMVSSPGSIFDGALMSPPT 527
++A+LEDLL P +S ++ETL + +C+ +I++HFL +DQ G +SPG D +++ P+
Sbjct: 339 DKATLEDLLIPNISESVETLYDVDCVHKILDHFLAMDQETGG--ASPGLGEDAQMLASPS 396

Query: 528 LTPVMMVARLLDAYLAEVAPDVNLKPLKFLSLAEALPEFAR 650
L P+ MVA+L+D YLAEVAPDVNLK KF SLA A+P++AR
Sbjct: 397 LMPITMVAKLIDGYLAEVAPDVNLKLPKFRSLAAAIPDYAR 437


>tr|A3BPC3|A3BPC3_ORYSJ Putative uncharacterized protein OS=Oryza
sativa subsp. japonica GN=OsJ_024895 PE=4 SV=1
Length = 582

Score = 201 bits (510), Expect = 4e-50
Identities = 110/221 (49%), Positives = 156/221 (70%), Gaps = 5/221 (2%)
Frame = +3

Query: 3 VSVLILPLFTRVIKAMDARGMKPECIPRALMHFAKKHLPALNNRRQGTRAESSNVGLGS- 179
VS L LPL+ +VI AM+ RG+ + I +L H+AK+ LP LN RR+ SS + + S
Sbjct: 231 VSCLSLPLYKKVISAMEYRGINQDIIVGSLNHYAKRRLPGLN-RRKSISDVSSCLSISSL 289

Query: 180 ----SEVEQKHVLETVERLLPTQKGVVSTKYLSGLLRSAMLLHVGLDCKSSLERRLGLQL 347
SE EQK++LE ++RLLP Q+GV S K L GLLR+A++L C S+LERR+G+QL
Sbjct: 290 TSIPSEEEQKYLLEEIDRLLPFQRGVTSCKLLFGLLRTAIILKASPSCVSNLERRIGMQL 349

Query: 348 EQASLEDLLSPPLSYNMETLKNRECIQRIVEHFLLLDQSAVGMVSSPGSIFDGALMSPPT 527
++A+LEDLL P +S ++ETL + +C+ +I++HFL +DQ G +SPG D +++ P+
Sbjct: 350 DKATLEDLLIPNISESVETLYDVDCVHKILDHFLAMDQETGG--ASPGLGEDAQMLASPS 407

Query: 528 LTPVMMVARLLDAYLAEVAPDVNLKPLKFLSLAEALPEFAR 650
L P+ MVA+L+D YLAEVAPDVNLK KF SLA A+P++AR
Sbjct: 408 LMPITMVAKLIDGYLAEVAPDVNLKLPKFRSLAAAIPDYAR 448


>tr|Q6AST7|Q6AST7_ORYSJ NPH3 family protein OS=Oryza sativa subsp.
japonica GN=B1394A07.4 PE=4 SV=1
Length = 650

Score = 197 bits (501), Expect = 5e-49
Identities = 107/215 (49%), Positives = 149/215 (69%)
Frame = +3

Query: 6 SVLILPLFTRVIKAMDARGMKPECIPRALMHFAKKHLPALNNRRQGTRAESSNVGLGSSE 185
S L ++ R+I M++RG++PE I +L ++AKK+LP LN RR A L SE
Sbjct: 245 SALSFHMYKRLISTMESRGIRPEIIAGSLTYYAKKYLPGLN-RRHSMGAVPLTATL--SE 301

Query: 186 VEQKHVLETVERLLPTQKGVVSTKYLSGLLRSAMLLHVGLDCKSSLERRLGLQLEQASLE 365
VEQK++LE ++RLLP QKG+ ST+ L GLLR+AM+L C S+LE+R+G+QL+ A+LE
Sbjct: 302 VEQKNLLEEIDRLLPVQKGLASTRVLLGLLRTAMILKASPTCISNLEKRIGMQLDHATLE 361

Query: 366 DLLSPPLSYNMETLKNRECIQRIVEHFLLLDQSAVGMVSSPGSIFDGALMSPPTLTPVMM 545
DLL P SY METL N EC+QRI++HFL +DQ+ + S +M+ P+L P+
Sbjct: 362 DLLLPNFSYTMETLYNVECVQRILDHFLAMDQA-----NGAASPCLDDVMASPSLAPITT 416

Query: 546 VARLLDAYLAEVAPDVNLKPLKFLSLAEALPEFAR 650
VA+L+D YLAE+APD+NLK KF +LA A+PE+AR
Sbjct: 417 VAKLIDGYLAEIAPDINLKLPKFQALASAVPEYAR 451