DK950925
Clone id TST38A01NGRL0010_A07
Library
Length 673
Definition Adiantum capillus-veneris mRNA. clone: TST38A01NGRL0010_A07. 5' end sequence.
Accession
Tissue type prothallia
Developmental stage gametophyte
Contig ID
Sequence
GTTGCGTCTGCCCCAGATCTACACTCTTTGCCATGGCTGCTGAAACCGAAACCTTCGCCT
TCCAGGCCGAGATCAATCAGCTTCTCAGCCTCATTATCAACACCTTTTACAGTAATAAGG
AGATCTTTCTGCGTGAGCTTATCAGTAATTCTTCTGATGCCCTGGACAAGATCCGCTTTG
AGAGCCTGACGGACAAGAGCAAGCTCGATGCCCAACCCGAACTGTTCATCCACATCATCC
CAGACAAGACCACTAACTCGCTGACGATAATAGATAGCGGTATTGGAATGACCAAAGCAG
ATTTGGTCAACAATCTTGGCACTATTGCACGTTCTGGAACTAAAGAGTTCATGGAAGCTC
TTGTTTTTTTTAGCCCCCCCCACCATGATTGGACAGTTTGGTGTAAAAAAAAAGGGGGCC
TACCTGGTTGCTGAGAAAGTGGTGGTGACTACGAAACACAATGATGATGAGCAGTACATC
TGGGAGTCTCAGGCCGGCGGCTCCTTCACGGTGACAAGGGATCCCGGGGAGCCCTTGGGC
AGAGGAACAAAGATCACTTTATTCTTGAAGGAAGACCAGCTTGAATACCTGGAGGAGAGG
AGGCTGAAAGATCTTATCAAGAAGCACTCAGAATTTATCAGCTATCCTATTTCTTTGTGG
GTGGAAAAGACTA
■■Homology search results ■■ -
sp_hit_id P55737
Definition sp|P55737|HSP82_ARATH Heat shock protein 81-2 OS=Arabidopsis thaliana
Align length 97
Score (bit) 182.0
E-value 5.0e-90
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= DK950925|Adiantum capillus-veneris mRNA, clone:
TST38A01NGRL0010_A07, 5'
(673 letters)

Database: uniprot_sprot.fasta
412,525 sequences; 148,809,765 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

sp|P55737|HSP82_ARATH Heat shock protein 81-2 OS=Arabidopsis tha... 182 5e-90
sp|P36181|HSP80_SOLLC Heat shock cognate protein 80 OS=Solanum l... 181 6e-90
sp|P51818|HSP83_ARATH Heat shock protein 81-3 OS=Arabidopsis tha... 182 1e-89
sp|Q0J4P2|HSP81_ORYSJ Heat shock protein 81-1 OS=Oryza sativa su... 179 2e-89
sp|A2YWQ1|HSP81_ORYSI Heat shock protein 81-1 OS=Oryza sativa su... 179 2e-89
sp|Q07078|HSP83_ORYSJ Heat shock protein 81-3 OS=Oryza sativa su... 179 3e-89
sp|Q69QQ6|HSP82_ORYSJ Heat shock protein 81-2 OS=Oryza sativa su... 179 3e-89
sp|P27323|HSP81_ARATH Heat shock protein 81-1 OS=Arabidopsis tha... 173 3e-88
sp|P51819|HSP83_IPONI Heat shock protein 83 OS=Ipomoea nil GN=HS... 172 2e-87
sp|Q08277|HSP82_MAIZE Heat shock protein 82 OS=Zea mays GN=HSP82... 167 8e-84
sp|P82995|HS90A_RAT Heat shock protein HSP 90-alpha OS=Rattus no... 151 8e-75
sp|O02705|HS90A_PIG Heat shock protein HSP 90-alpha OS=Sus scrof... 151 8e-75
sp|Q4R4P1|HS90A_MACFA Heat shock protein HSP 90-alpha OS=Macaca ... 151 8e-75
sp|Q76LV2|HS90A_BOVIN Heat shock protein HSP 90-alpha OS=Bos tau... 151 8e-75
sp|P07900|HS90A_HUMAN Heat shock protein HSP 90-alpha OS=Homo sa... 151 8e-75
sp|Q9GKX7|HS90A_HORSE Heat shock protein HSP 90-alpha (Fragment)... 151 8e-75
sp|P07901|HS90A_MOUSE Heat shock protein HSP 90-alpha OS=Mus mus... 151 1e-74
sp|P46633|HS90A_CRIGR Heat shock protein HSP 90-alpha OS=Cricetu... 152 1e-74
sp|P11501|HS90A_CHICK Heat shock protein HSP 90-alpha OS=Gallus ... 150 2e-74
sp|A5A6K9|HS90A_PANTR Heat shock protein HSP 90-alpha OS=Pan tro... 151 5e-74
sp|Q7PT10|HSP83_ANOGA Heat shock protein 83 OS=Anopheles gambiae... 153 1e-73
sp|Q76LV1|HS90B_BOVIN Heat shock protein HSP 90-beta OS=Bos taur... 149 3e-73
sp|O44001|HSP90_EIMTE Heat shock protein 90 OS=Eimeria tenella G... 153 3e-73
sp|Q04619|HS90B_CHICK Heat shock cognate protein HSP 90-beta OS=... 152 3e-73
sp|P34058|HS90B_RAT Heat shock protein HSP 90-beta OS=Rattus nor... 149 3e-73
sp|Q5R710|HS90B_PONAB Heat shock protein HSP 90-beta OS=Pongo ab... 149 3e-73
sp|Q4R4T5|HS90B_MACFA Heat shock protein HSP 90-beta OS=Macaca f... 149 3e-73
sp|P08238|HS90B_HUMAN Heat shock protein HSP 90-beta OS=Homo sap... 149 3e-73
sp|Q9GKX8|HS90B_HORSE Heat shock protein HSP 90-beta OS=Equus ca... 149 3e-73
sp|P11499|HS90B_MOUSE Heat shock protein HSP 90-beta OS=Mus musc... 149 6e-73

>sp|P55737|HSP82_ARATH Heat shock protein 81-2 OS=Arabidopsis
thaliana GN=HSP81-2 PE=1 SV=1
Length = 699

Score = 182 bits (463), Expect(2) = 5e-90
Identities = 94/97 (96%), Positives = 95/97 (97%)
Frame = +3

Query: 72 INQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQPELFIHIIPDKT 251
INQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLD QPELFIHIIPDKT
Sbjct: 13 INQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDGQPELFIHIIPDKT 72

Query: 252 TNSLTIIDSGIGMTKADLVNNLGTIARSGTKEFMEAL 362
N+LTIIDSGIGMTKADLVNNLGTIARSGTKEFMEAL
Sbjct: 73 NNTLTIIDSGIGMTKADLVNNLGTIARSGTKEFMEAL 109



Score = 169 bits (429), Expect(2) = 5e-90
Identities = 84/101 (83%), Positives = 91/101 (90%), Gaps = 1/101 (0%)
Frame = +1

Query: 373 APPTMIGQFGVKKKGAYLVAEKVVVTTKHNDDEQYIWESQAGGSFTVTRDP-GEPLGRGT 549
A +MIGQFGV AYLVA+KVVVTTKHNDDEQY+WESQAGGSFTVTRD GE LGRGT
Sbjct: 113 ADVSMIGQFGVGFYSAYLVADKVVVTTKHNDDEQYVWESQAGGSFTVTRDTSGETLGRGT 172

Query: 550 KITLFLKEDQLEYLEERRLKDLIKKHSEFISYPISLWVEKT 672
K+ L+LKEDQLEYLEERRLKDL+KKHSEFISYPISLW+EKT
Sbjct: 173 KMVLYLKEDQLEYLEERRLKDLVKKHSEFISYPISLWIEKT 213


>sp|P36181|HSP80_SOLLC Heat shock cognate protein 80 OS=Solanum
lycopersicum GN=HSC80 PE=2 SV=1
Length = 699

Score = 181 bits (458), Expect(2) = 6e-90
Identities = 93/97 (95%), Positives = 94/97 (96%)
Frame = +3

Query: 72 INQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQPELFIHIIPDKT 251
INQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLD QPELFIHIIPDK
Sbjct: 13 INQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDGQPELFIHIIPDKA 72

Query: 252 TNSLTIIDSGIGMTKADLVNNLGTIARSGTKEFMEAL 362
N+LTIIDSGIGMTKADLVNNLGTIARSGTKEFMEAL
Sbjct: 73 NNTLTIIDSGIGMTKADLVNNLGTIARSGTKEFMEAL 109



Score = 171 bits (433), Expect(2) = 6e-90
Identities = 87/101 (86%), Positives = 91/101 (90%), Gaps = 1/101 (0%)
Frame = +1

Query: 373 APPTMIGQFGVKKKGAYLVAEKVVVTTKHNDDEQYIWESQAGGSFTVTRDP-GEPLGRGT 549
A +MIGQFGV AYLVAEKVVVTTKHNDDEQY+WESQAGGSFTVTRD GE LGRGT
Sbjct: 113 ADVSMIGQFGVGFYSAYLVAEKVVVTTKHNDDEQYVWESQAGGSFTVTRDTSGENLGRGT 172

Query: 550 KITLFLKEDQLEYLEERRLKDLIKKHSEFISYPISLWVEKT 672
K+ L+LKEDQLEYLEERRLKDLIKKHSEFISYPISLWVEKT
Sbjct: 173 KMVLYLKEDQLEYLEERRLKDLIKKHSEFISYPISLWVEKT 213


>sp|P51818|HSP83_ARATH Heat shock protein 81-3 OS=Arabidopsis
thaliana GN=HSP81-3 PE=2 SV=2
Length = 699

Score = 182 bits (463), Expect(2) = 1e-89
Identities = 94/97 (96%), Positives = 95/97 (97%)
Frame = +3

Query: 72 INQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQPELFIHIIPDKT 251
INQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLD QPELFIHIIPDKT
Sbjct: 13 INQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDGQPELFIHIIPDKT 72

Query: 252 TNSLTIIDSGIGMTKADLVNNLGTIARSGTKEFMEAL 362
N+LTIIDSGIGMTKADLVNNLGTIARSGTKEFMEAL
Sbjct: 73 NNTLTIIDSGIGMTKADLVNNLGTIARSGTKEFMEAL 109



Score = 168 bits (425), Expect(2) = 1e-89
Identities = 82/101 (81%), Positives = 91/101 (90%), Gaps = 1/101 (0%)
Frame = +1

Query: 373 APPTMIGQFGVKKKGAYLVAEKVVVTTKHNDDEQYIWESQAGGSFTVTRDP-GEPLGRGT 549
A +MIGQFGV AYLVA+KVVVTTKHNDDEQY+WESQAGGSFTVTRD GE LGRGT
Sbjct: 113 ADVSMIGQFGVGFYSAYLVADKVVVTTKHNDDEQYVWESQAGGSFTVTRDTSGEALGRGT 172

Query: 550 KITLFLKEDQLEYLEERRLKDLIKKHSEFISYPISLWVEKT 672
K+ L+LKEDQ+EY+EERRLKDL+KKHSEFISYPISLW+EKT
Sbjct: 173 KMVLYLKEDQMEYIEERRLKDLVKKHSEFISYPISLWIEKT 213


>sp|Q0J4P2|HSP81_ORYSJ Heat shock protein 81-1 OS=Oryza sativa
subsp. japonica GN=HSP81-1 PE=2 SV=2
Length = 699

Score = 179 bits (455), Expect(2) = 2e-89
Identities = 91/97 (93%), Positives = 96/97 (98%)
Frame = +3

Query: 72 INQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQPELFIHIIPDKT 251
INQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQPELFIHI+PDK
Sbjct: 14 INQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQPELFIHIVPDKA 73

Query: 252 TNSLTIIDSGIGMTKADLVNNLGTIARSGTKEFMEAL 362
+N+L+IIDSGIGMTK+DLVNNLGTIARSGTKEFMEAL
Sbjct: 74 SNTLSIIDSGIGMTKSDLVNNLGTIARSGTKEFMEAL 110



Score = 171 bits (432), Expect(2) = 2e-89
Identities = 86/101 (85%), Positives = 91/101 (90%), Gaps = 1/101 (0%)
Frame = +1

Query: 373 APPTMIGQFGVKKKGAYLVAEKVVVTTKHNDDEQYIWESQAGGSFTVTRDP-GEPLGRGT 549
A +MIGQFGV AYLVAE+VVVTTKHNDDEQY+WESQAGGSFTVTRD GE LGRGT
Sbjct: 114 ADVSMIGQFGVGFYSAYLVAERVVVTTKHNDDEQYVWESQAGGSFTVTRDTSGEQLGRGT 173

Query: 550 KITLFLKEDQLEYLEERRLKDLIKKHSEFISYPISLWVEKT 672
KITL+LK+DQLEYLEERRLKDLIKKHSEFISYPISLW EKT
Sbjct: 174 KITLYLKDDQLEYLEERRLKDLIKKHSEFISYPISLWTEKT 214


>sp|A2YWQ1|HSP81_ORYSI Heat shock protein 81-1 OS=Oryza sativa
subsp. indica GN=HSP81-1 PE=2 SV=1
Length = 699

Score = 179 bits (455), Expect(2) = 2e-89
Identities = 91/97 (93%), Positives = 96/97 (98%)
Frame = +3

Query: 72 INQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQPELFIHIIPDKT 251
INQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQPELFIHI+PDK
Sbjct: 14 INQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQPELFIHIVPDKA 73

Query: 252 TNSLTIIDSGIGMTKADLVNNLGTIARSGTKEFMEAL 362
+N+L+IIDSGIGMTK+DLVNNLGTIARSGTKEFMEAL
Sbjct: 74 SNTLSIIDSGIGMTKSDLVNNLGTIARSGTKEFMEAL 110



Score = 171 bits (432), Expect(2) = 2e-89
Identities = 86/101 (85%), Positives = 91/101 (90%), Gaps = 1/101 (0%)
Frame = +1

Query: 373 APPTMIGQFGVKKKGAYLVAEKVVVTTKHNDDEQYIWESQAGGSFTVTRDP-GEPLGRGT 549
A +MIGQFGV AYLVAE+VVVTTKHNDDEQY+WESQAGGSFTVTRD GE LGRGT
Sbjct: 114 ADVSMIGQFGVGFYSAYLVAERVVVTTKHNDDEQYVWESQAGGSFTVTRDTSGEQLGRGT 173

Query: 550 KITLFLKEDQLEYLEERRLKDLIKKHSEFISYPISLWVEKT 672
KITL+LK+DQLEYLEERRLKDLIKKHSEFISYPISLW EKT
Sbjct: 174 KITLYLKDDQLEYLEERRLKDLIKKHSEFISYPISLWTEKT 214


>sp|Q07078|HSP83_ORYSJ Heat shock protein 81-3 OS=Oryza sativa
subsp. japonica GN=HSP81-3 PE=2 SV=2
Length = 699

Score = 179 bits (454), Expect(2) = 3e-89
Identities = 90/97 (92%), Positives = 96/97 (98%)
Frame = +3

Query: 72 INQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQPELFIHIIPDKT 251
INQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQPELFIHI+PDK
Sbjct: 14 INQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQPELFIHIVPDKA 73

Query: 252 TNSLTIIDSGIGMTKADLVNNLGTIARSGTKEFMEAL 362
+N+L+IIDSG+GMTK+DLVNNLGTIARSGTKEFMEAL
Sbjct: 74 SNTLSIIDSGVGMTKSDLVNNLGTIARSGTKEFMEAL 110



Score = 170 bits (431), Expect(2) = 3e-89
Identities = 85/101 (84%), Positives = 91/101 (90%), Gaps = 1/101 (0%)
Frame = +1

Query: 373 APPTMIGQFGVKKKGAYLVAEKVVVTTKHNDDEQYIWESQAGGSFTVTRDP-GEPLGRGT 549
A +MIGQFGV AYLVAE+VVVTTKHNDDEQY+WESQAGGSFTVTRD GE LGRGT
Sbjct: 114 ADVSMIGQFGVGFYSAYLVAERVVVTTKHNDDEQYVWESQAGGSFTVTRDTSGEQLGRGT 173

Query: 550 KITLFLKEDQLEYLEERRLKDLIKKHSEFISYPISLWVEKT 672
KITL+LK+DQLEYLEERRLKDL+KKHSEFISYPISLW EKT
Sbjct: 174 KITLYLKDDQLEYLEERRLKDLVKKHSEFISYPISLWTEKT 214


>sp|Q69QQ6|HSP82_ORYSJ Heat shock protein 81-2 OS=Oryza sativa
subsp. japonica GN=HSP81-2 PE=2 SV=1
Length = 699

Score = 179 bits (454), Expect(2) = 3e-89
Identities = 90/97 (92%), Positives = 96/97 (98%)
Frame = +3

Query: 72 INQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQPELFIHIIPDKT 251
INQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQPELFIHI+PDK
Sbjct: 14 INQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQPELFIHIVPDKA 73

Query: 252 TNSLTIIDSGIGMTKADLVNNLGTIARSGTKEFMEAL 362
+N+L+IIDSG+GMTK+DLVNNLGTIARSGTKEFMEAL
Sbjct: 74 SNTLSIIDSGVGMTKSDLVNNLGTIARSGTKEFMEAL 110



Score = 170 bits (431), Expect(2) = 3e-89
Identities = 85/101 (84%), Positives = 91/101 (90%), Gaps = 1/101 (0%)
Frame = +1

Query: 373 APPTMIGQFGVKKKGAYLVAEKVVVTTKHNDDEQYIWESQAGGSFTVTRDP-GEPLGRGT 549
A +MIGQFGV AYLVAE+VVVTTKHNDDEQY+WESQAGGSFTVTRD GE LGRGT
Sbjct: 114 ADVSMIGQFGVGFYSAYLVAERVVVTTKHNDDEQYVWESQAGGSFTVTRDTSGEQLGRGT 173

Query: 550 KITLFLKEDQLEYLEERRLKDLIKKHSEFISYPISLWVEKT 672
KITL+LK+DQLEYLEERRLKDL+KKHSEFISYPISLW EKT
Sbjct: 174 KITLYLKDDQLEYLEERRLKDLVKKHSEFISYPISLWTEKT 214


>sp|P27323|HSP81_ARATH Heat shock protein 81-1 OS=Arabidopsis
thaliana GN=HSP81-1 PE=2 SV=3
Length = 700

Score = 173 bits (439), Expect(2) = 3e-88
Identities = 87/101 (86%), Positives = 91/101 (90%), Gaps = 1/101 (0%)
Frame = +1

Query: 373 APPTMIGQFGVKKKGAYLVAEKVVVTTKHNDDEQYIWESQAGGSFTVTRD-PGEPLGRGT 549
A +MIGQFGV AYLVAEKVVVTTKHNDDEQY+WESQAGGSFTVTRD GEPLGRGT
Sbjct: 113 ADVSMIGQFGVGFYSAYLVAEKVVVTTKHNDDEQYVWESQAGGSFTVTRDVDGEPLGRGT 172

Query: 550 KITLFLKEDQLEYLEERRLKDLIKKHSEFISYPISLWVEKT 672
KITLFLK+DQLEYLEERRLKDL+KKHSEFISYPI LW EKT
Sbjct: 173 KITLFLKDDQLEYLEERRLKDLVKKHSEFISYPIYLWTEKT 213



Score = 173 bits (438), Expect(2) = 3e-88
Identities = 88/97 (90%), Positives = 93/97 (95%)
Frame = +3

Query: 72 INQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQPELFIHIIPDKT 251
INQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLD QPELFI ++PDK+
Sbjct: 13 INQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDGQPELFIRLVPDKS 72

Query: 252 TNSLTIIDSGIGMTKADLVNNLGTIARSGTKEFMEAL 362
+L+IIDSGIGMTKADLVNNLGTIARSGTKEFMEAL
Sbjct: 73 NKTLSIIDSGIGMTKADLVNNLGTIARSGTKEFMEAL 109


>sp|P51819|HSP83_IPONI Heat shock protein 83 OS=Ipomoea nil
GN=HSP83A PE=2 SV=1
Length = 703

Score = 172 bits (437), Expect(2) = 2e-87
Identities = 87/97 (89%), Positives = 93/97 (95%)
Frame = +3

Query: 72 INQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQPELFIHIIPDKT 251
INQLLSLIINTFYSNKEIFLRELISN+SDALDKIRFESLTDKSKLDAQPELFI ++PDKT
Sbjct: 18 INQLLSLIINTFYSNKEIFLRELISNASDALDKIRFESLTDKSKLDAQPELFIRLVPDKT 77

Query: 252 TNSLTIIDSGIGMTKADLVNNLGTIARSGTKEFMEAL 362
+L+IIDSG+GM KADLVNNLGTIARSGTKEFMEAL
Sbjct: 78 NKTLSIIDSGVGMAKADLVNNLGTIARSGTKEFMEAL 114



Score = 171 bits (432), Expect(2) = 2e-87
Identities = 86/101 (85%), Positives = 90/101 (89%), Gaps = 1/101 (0%)
Frame = +1

Query: 373 APPTMIGQFGVKKKGAYLVAEKVVVTTKHNDDEQYIWESQAGGSFTVTRD-PGEPLGRGT 549
A +MIGQFGV AYLVAEKV+VTTKHNDDEQYIWESQAGGSFTVTRD GE LGRGT
Sbjct: 118 ADVSMIGQFGVGFYSAYLVAEKVIVTTKHNDDEQYIWESQAGGSFTVTRDVDGEQLGRGT 177

Query: 550 KITLFLKEDQLEYLEERRLKDLIKKHSEFISYPISLWVEKT 672
KITLFLKEDQLEYLEERR+KDL+KKHSEFISYPI LW EKT
Sbjct: 178 KITLFLKEDQLEYLEERRIKDLVKKHSEFISYPIYLWTEKT 218


>sp|Q08277|HSP82_MAIZE Heat shock protein 82 OS=Zea mays GN=HSP82
PE=3 SV=1
Length = 715

Score = 167 bits (422), Expect(2) = 8e-84
Identities = 83/97 (85%), Positives = 93/97 (95%)
Frame = +3

Query: 72 INQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQPELFIHIIPDKT 251
INQLLSLIINTFYSNKEIFLRELISN+SDALDKIRFESLTDKS ++AQPELFI ++PDK
Sbjct: 23 INQLLSLIINTFYSNKEIFLRELISNASDALDKIRFESLTDKSNVNAQPELFIRLVPDKA 82

Query: 252 TNSLTIIDSGIGMTKADLVNNLGTIARSGTKEFMEAL 362
+ +L+IIDSG+GMTK+DLVNNLGTIARSGTKEFMEAL
Sbjct: 83 SKTLSIIDSGVGMTKSDLVNNLGTIARSGTKEFMEAL 119



Score = 164 bits (416), Expect(2) = 8e-84
Identities = 81/98 (82%), Positives = 88/98 (89%), Gaps = 1/98 (1%)
Frame = +1

Query: 382 TMIGQFGVKKKGAYLVAEKVVVTTKHNDDEQYIWESQAGGSFTVTRDP-GEPLGRGTKIT 558
+MIGQFGV AYLVA++V+VTTKHNDDEQY+WESQAGGSFTVT D GE LGRGTKIT
Sbjct: 127 SMIGQFGVGFYSAYLVADRVMVTTKHNDDEQYVWESQAGGSFTVTHDTTGEQLGRGTKIT 186

Query: 559 LFLKEDQLEYLEERRLKDLIKKHSEFISYPISLWVEKT 672
LFLK+DQLEYLEERRLKDL+KKHSEFISYPI LW EKT
Sbjct: 187 LFLKDDQLEYLEERRLKDLVKKHSEFISYPIYLWTEKT 224


tr_hit_id Q14TB1
Definition tr|Q14TB1|Q14TB1_TOBAC Heat shock protein 90 OS=Nicotiana tabacum
Align length 97
Score (bit) 185.0
E-value 2.0e-91
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= DK950925|Adiantum capillus-veneris mRNA, clone:
TST38A01NGRL0010_A07, 5'
(673 letters)

Database: uniprot_trembl.fasta
7,341,751 sequences; 2,391,615,440 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

tr|Q14TB1|Q14TB1_TOBAC Heat shock protein 90 OS=Nicotiana tabacu... 185 2e-91
tr|Q6R0J1|Q6R0J1_TOBAC Heat shock protein 90 OS=Nicotiana tabacu... 185 3e-91
tr|Q6UJX6|Q6UJX6_NICBE Molecular chaperone Hsp90-1 OS=Nicotiana ... 185 5e-91
tr|Q6UJX5|Q6UJX5_NICBE Molecular chaperone Hsp90-2 OS=Nicotiana ... 184 1e-90
tr|A5AHA8|A5AHA8_VITVI Putative uncharacterized protein OS=Vitis... 184 1e-90
tr|B6EBD7|B6EBD7_SOYBN Heat shock protein 90-1 OS=Glycine max PE... 182 4e-90
tr|A8WEL7|A8WEL7_9MAGN Heat shock protein 90 OS=Vitis pseudoreti... 184 9e-90
tr|Q6UJX4|Q6UJX4_SOLLC Molecular chaperone Hsp90-1 OS=Solanum ly... 181 1e-89
tr|Q2XTE5|Q2XTE5_SOLTU Hsp90-2-like OS=Solanum tuberosum PE=2 SV=1 183 1e-89
tr|B1Q477|B1Q477_CAPCH Putative Hsp90-2 OS=Capsicum chinense PE=... 182 1e-89
tr|B6EBD6|B6EBD6_SOYBN Heat shock protein 90-2 OS=Glycine max PE... 181 3e-89
tr|Q8H158|Q8H158_ARATH Putative heat shock protein 81-2 (HSP81-2... 182 6e-89
tr|A7R971|A7R971_VITVI Chromosome undetermined scaffold_3427, wh... 184 6e-89
tr|Q53Z32|Q53Z32_SOLLC Molecular chaperone Hsp90-2 OS=Solanum ly... 181 7e-89
tr|A9QVI8|A9QVI8_9ASTR Heat shock protein 90 OS=Ageratina adenop... 179 7e-89
tr|Q8GRU8|Q8GRU8_ARATH Putative heat shock protein 90 OS=Arabido... 182 2e-88
tr|O03986|O03986_ARATH Heat shock protein OS=Arabidopsis thalian... 182 2e-88
tr|Q2PEX3|Q2PEX3_TRIPR Putative HEAT SHOCK PROTEIN 81-2 (Fragmen... 178 2e-88
tr|A3BUJ5|A3BUJ5_ORYSJ Putative uncharacterized protein OS=Oryza... 179 2e-88
tr|A9PGU4|A9PGU4_POPTR Putative uncharacterized protein OS=Popul... 180 4e-88
tr|Q0J0V1|Q0J0V1_ORYSJ Os09g0482100 protein OS=Oryza sativa subs... 179 4e-88
tr|Q0J0U8|Q0J0U8_ORYSJ Os09g0482400 protein OS=Oryza sativa subs... 179 4e-88
tr|A2Z2G1|A2Z2G1_ORYSI Putative uncharacterized protein OS=Oryza... 179 4e-88
tr|Q5YJN5|Q5YJN5_HYAOR Heat shock protein 82 (Fragment) OS=Hyaci... 178 6e-88
tr|Q0Q0I7|Q0Q0I7_WHEAT Heat shock protein 90 OS=Triticum aestivu... 182 8e-88
tr|A9TQU1|A9TQU1_PHYPA Predicted protein OS=Physcomitrella paten... 178 1e-87
tr|Q8H0Z5|Q8H0Z5_ARATH At5g52640/F6N7_13 OS=Arabidopsis thaliana... 173 3e-87
tr|Q7XJ80|Q7XJ80_HORVU Cytosolic heat shock protein 90 OS=Hordeu... 181 3e-87
tr|Q570T4|Q570T4_ARATH Heat-shock protein (Fragment) OS=Arabidop... 173 3e-87
tr|A5ADL7|A5ADL7_VITVI Putative uncharacterized protein OS=Vitis... 174 7e-87

>tr|Q14TB1|Q14TB1_TOBAC Heat shock protein 90 OS=Nicotiana tabacum
GN=hsp90 PE=2 SV=1
Length = 699

Score = 185 bits (470), Expect(2) = 2e-91
Identities = 96/97 (98%), Positives = 96/97 (98%)
Frame = +3

Query: 72 INQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQPELFIHIIPDKT 251
INQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQPELFIHIIPDKT
Sbjct: 13 INQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQPELFIHIIPDKT 72

Query: 252 TNSLTIIDSGIGMTKADLVNNLGTIARSGTKEFMEAL 362
NSLTIIDSGIGMTKADLVNNLGTIARSGTKEFMEAL
Sbjct: 73 NNSLTIIDSGIGMTKADLVNNLGTIARSGTKEFMEAL 109



Score = 175 bits (443), Expect(2) = 2e-91
Identities = 89/101 (88%), Positives = 92/101 (91%), Gaps = 1/101 (0%)
Frame = +1

Query: 373 APPTMIGQFGVKKKGAYLVAEKVVVTTKHNDDEQYIWESQAGGSFTVTRDP-GEPLGRGT 549
A +MIGQFGV AYLVAEKV+VTTKHNDDEQY+WESQAGGSFTVTRD GE LGRGT
Sbjct: 113 ADVSMIGQFGVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRDTSGENLGRGT 172

Query: 550 KITLFLKEDQLEYLEERRLKDLIKKHSEFISYPISLWVEKT 672
KITLFLKEDQLEYLEERRLKDLIKKHSEFISYPISLWVEKT
Sbjct: 173 KITLFLKEDQLEYLEERRLKDLIKKHSEFISYPISLWVEKT 213


>tr|Q6R0J1|Q6R0J1_TOBAC Heat shock protein 90 OS=Nicotiana tabacum
GN=OINtHsp90 PE=2 SV=1
Length = 699

Score = 185 bits (469), Expect(2) = 3e-91
Identities = 95/97 (97%), Positives = 96/97 (98%)
Frame = +3

Query: 72 INQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQPELFIHIIPDKT 251
INQLLSLIINTFYSNKE+FLRELISNSSDALDKIRFESLTDKSKLDAQPELFIHIIPDKT
Sbjct: 13 INQLLSLIINTFYSNKEVFLRELISNSSDALDKIRFESLTDKSKLDAQPELFIHIIPDKT 72

Query: 252 TNSLTIIDSGIGMTKADLVNNLGTIARSGTKEFMEAL 362
NSLTIIDSGIGMTKADLVNNLGTIARSGTKEFMEAL
Sbjct: 73 NNSLTIIDSGIGMTKADLVNNLGTIARSGTKEFMEAL 109



Score = 175 bits (443), Expect(2) = 3e-91
Identities = 89/101 (88%), Positives = 92/101 (91%), Gaps = 1/101 (0%)
Frame = +1

Query: 373 APPTMIGQFGVKKKGAYLVAEKVVVTTKHNDDEQYIWESQAGGSFTVTRDP-GEPLGRGT 549
A +MIGQFGV AYLVAEKV+VTTKHNDDEQY+WESQAGGSFTVTRD GE LGRGT
Sbjct: 113 ADVSMIGQFGVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRDTSGENLGRGT 172

Query: 550 KITLFLKEDQLEYLEERRLKDLIKKHSEFISYPISLWVEKT 672
KITLFLKEDQLEYLEERRLKDLIKKHSEFISYPISLWVEKT
Sbjct: 173 KITLFLKEDQLEYLEERRLKDLIKKHSEFISYPISLWVEKT 213


>tr|Q6UJX6|Q6UJX6_NICBE Molecular chaperone Hsp90-1 OS=Nicotiana
benthamiana PE=2 SV=1
Length = 699

Score = 185 bits (470), Expect(2) = 5e-91
Identities = 96/97 (98%), Positives = 96/97 (98%)
Frame = +3

Query: 72 INQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQPELFIHIIPDKT 251
INQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQPELFIHIIPDKT
Sbjct: 13 INQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQPELFIHIIPDKT 72

Query: 252 TNSLTIIDSGIGMTKADLVNNLGTIARSGTKEFMEAL 362
NSLTIIDSGIGMTKADLVNNLGTIARSGTKEFMEAL
Sbjct: 73 NNSLTIIDSGIGMTKADLVNNLGTIARSGTKEFMEAL 109



Score = 174 bits (440), Expect(2) = 5e-91
Identities = 88/101 (87%), Positives = 92/101 (91%), Gaps = 1/101 (0%)
Frame = +1

Query: 373 APPTMIGQFGVKKKGAYLVAEKVVVTTKHNDDEQYIWESQAGGSFTVTRDP-GEPLGRGT 549
A +MIGQFGV AYLVAEKV+VTTKHNDDEQY+WESQAGGSFTVTRD G+ LGRGT
Sbjct: 113 ADVSMIGQFGVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRDTSGDNLGRGT 172

Query: 550 KITLFLKEDQLEYLEERRLKDLIKKHSEFISYPISLWVEKT 672
KITLFLKEDQLEYLEERRLKDLIKKHSEFISYPISLWVEKT
Sbjct: 173 KITLFLKEDQLEYLEERRLKDLIKKHSEFISYPISLWVEKT 213


>tr|Q6UJX5|Q6UJX5_NICBE Molecular chaperone Hsp90-2 OS=Nicotiana
benthamiana PE=2 SV=1
Length = 699

Score = 184 bits (467), Expect(2) = 1e-90
Identities = 95/97 (97%), Positives = 96/97 (98%)
Frame = +3

Query: 72 INQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQPELFIHIIPDKT 251
INQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQPELFIHIIPDKT
Sbjct: 13 INQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQPELFIHIIPDKT 72

Query: 252 TNSLTIIDSGIGMTKADLVNNLGTIARSGTKEFMEAL 362
N+LTIIDSGIGMTKADLVNNLGTIARSGTKEFMEAL
Sbjct: 73 NNTLTIIDSGIGMTKADLVNNLGTIARSGTKEFMEAL 109



Score = 174 bits (440), Expect(2) = 1e-90
Identities = 88/101 (87%), Positives = 92/101 (91%), Gaps = 1/101 (0%)
Frame = +1

Query: 373 APPTMIGQFGVKKKGAYLVAEKVVVTTKHNDDEQYIWESQAGGSFTVTRDP-GEPLGRGT 549
A +MIGQFGV AYLVAE+VVVTTKHNDDEQY+WESQAGGSFTVTRD GE LGRGT
Sbjct: 113 ADVSMIGQFGVGFYSAYLVAERVVVTTKHNDDEQYVWESQAGGSFTVTRDTSGENLGRGT 172

Query: 550 KITLFLKEDQLEYLEERRLKDLIKKHSEFISYPISLWVEKT 672
KITLFLKEDQLEYLEERRLKDL+KKHSEFISYPISLWVEKT
Sbjct: 173 KITLFLKEDQLEYLEERRLKDLVKKHSEFISYPISLWVEKT 213


>tr|A5AHA8|A5AHA8_VITVI Putative uncharacterized protein OS=Vitis
vinifera GN=VITISV_029391 PE=4 SV=1
Length = 699

Score = 184 bits (467), Expect(2) = 1e-90
Identities = 94/97 (96%), Positives = 96/97 (98%)
Frame = +3

Query: 72 INQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQPELFIHIIPDKT 251
INQLLSLIINTFYSNKEIFLRE+ISNSSDALDKIRFESLTDKSKLDAQPELFIHI+PDKT
Sbjct: 13 INQLLSLIINTFYSNKEIFLREIISNSSDALDKIRFESLTDKSKLDAQPELFIHIVPDKT 72

Query: 252 TNSLTIIDSGIGMTKADLVNNLGTIARSGTKEFMEAL 362
NSLTIIDSGIGMTKADLVNNLGTIARSGTKEFMEAL
Sbjct: 73 NNSLTIIDSGIGMTKADLVNNLGTIARSGTKEFMEAL 109



Score = 174 bits (440), Expect(2) = 1e-90
Identities = 87/101 (86%), Positives = 92/101 (91%), Gaps = 1/101 (0%)
Frame = +1

Query: 373 APPTMIGQFGVKKKGAYLVAEKVVVTTKHNDDEQYIWESQAGGSFTVTRDP-GEPLGRGT 549
A +MIGQFGV AYLVAEKV+VTTKHNDDEQY+WESQAGGSFTVTRD GE LGRGT
Sbjct: 113 ADVSMIGQFGVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRDTSGESLGRGT 172

Query: 550 KITLFLKEDQLEYLEERRLKDLIKKHSEFISYPISLWVEKT 672
KITL+LKEDQLEYLEERRLKDLIKKHSEFISYPISLW+EKT
Sbjct: 173 KITLYLKEDQLEYLEERRLKDLIKKHSEFISYPISLWIEKT 213


>tr|B6EBD7|B6EBD7_SOYBN Heat shock protein 90-1 OS=Glycine max PE=2
SV=1
Length = 702

Score = 182 bits (463), Expect(2) = 4e-90
Identities = 93/97 (95%), Positives = 96/97 (98%)
Frame = +3

Query: 72 INQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQPELFIHIIPDKT 251
INQLLSLIINTFYSNKEIFLRELISN+SDALDKIRFESLTDKSKLDAQPELFIHIIPDKT
Sbjct: 13 INQLLSLIINTFYSNKEIFLRELISNASDALDKIRFESLTDKSKLDAQPELFIHIIPDKT 72

Query: 252 TNSLTIIDSGIGMTKADLVNNLGTIARSGTKEFMEAL 362
N+LTI+DSGIGMTKADLVNNLGTIARSGTKEFMEAL
Sbjct: 73 NNTLTIVDSGIGMTKADLVNNLGTIARSGTKEFMEAL 109



Score = 173 bits (439), Expect(2) = 4e-90
Identities = 87/101 (86%), Positives = 92/101 (91%), Gaps = 1/101 (0%)
Frame = +1

Query: 373 APPTMIGQFGVKKKGAYLVAEKVVVTTKHNDDEQYIWESQAGGSFTVTRD-PGEPLGRGT 549
A +MIGQFGV AYLVAEKV+VTTKHNDDEQY+WESQAGGSFTVTRD GE LGRGT
Sbjct: 113 ADVSMIGQFGVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRDNTGEVLGRGT 172

Query: 550 KITLFLKEDQLEYLEERRLKDLIKKHSEFISYPISLWVEKT 672
KITL+LKEDQLEYLEERRLKDLIKKHSEFISYPISLW+EKT
Sbjct: 173 KITLYLKEDQLEYLEERRLKDLIKKHSEFISYPISLWIEKT 213


>tr|A8WEL7|A8WEL7_9MAGN Heat shock protein 90 OS=Vitis
pseudoreticulata PE=2 SV=1
Length = 699

Score = 184 bits (467), Expect(2) = 9e-90
Identities = 95/97 (97%), Positives = 96/97 (98%)
Frame = +3

Query: 72 INQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQPELFIHIIPDKT 251
INQLLSLIINTFYSNKEIFLRELISN+SDALDKIRFESLTDKSKLDAQPELFIHIIPDKT
Sbjct: 13 INQLLSLIINTFYSNKEIFLRELISNASDALDKIRFESLTDKSKLDAQPELFIHIIPDKT 72

Query: 252 TNSLTIIDSGIGMTKADLVNNLGTIARSGTKEFMEAL 362
NSLTIIDSGIGMTKADLVNNLGTIARSGTKEFMEAL
Sbjct: 73 NNSLTIIDSGIGMTKADLVNNLGTIARSGTKEFMEAL 109



Score = 171 bits (432), Expect(2) = 9e-90
Identities = 85/101 (84%), Positives = 91/101 (90%), Gaps = 1/101 (0%)
Frame = +1

Query: 373 APPTMIGQFGVKKKGAYLVAEKVVVTTKHNDDEQYIWESQAGGSFTVTRDP-GEPLGRGT 549
A +MIGQFGV AYLVAEKV+VT KHNDDEQY+WESQAGGSFTVTRD GE LGRGT
Sbjct: 113 ADVSMIGQFGVGFYSAYLVAEKVIVTAKHNDDEQYVWESQAGGSFTVTRDTSGESLGRGT 172

Query: 550 KITLFLKEDQLEYLEERRLKDLIKKHSEFISYPISLWVEKT 672
KITL+LKEDQLEYLEERR+KDLIKKHSEFISYPISLW+EKT
Sbjct: 173 KITLYLKEDQLEYLEERRVKDLIKKHSEFISYPISLWIEKT 213


>tr|Q6UJX4|Q6UJX4_SOLLC Molecular chaperone Hsp90-1 OS=Solanum
lycopersicum PE=2 SV=1
Length = 699

Score = 181 bits (460), Expect(2) = 1e-89
Identities = 91/97 (93%), Positives = 96/97 (98%)
Frame = +3

Query: 72 INQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQPELFIHIIPDKT 251
INQLLSLIINTFYSNKEIFLRELISNSSDALDKIRF+SLTDKSKLDAQPELFIHI+PDKT
Sbjct: 13 INQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFQSLTDKSKLDAQPELFIHIVPDKT 72

Query: 252 TNSLTIIDSGIGMTKADLVNNLGTIARSGTKEFMEAL 362
N+LTIIDSG+GMTKADLVNNLGTIARSGTKEFMEA+
Sbjct: 73 NNTLTIIDSGVGMTKADLVNNLGTIARSGTKEFMEAI 109



Score = 173 bits (438), Expect(2) = 1e-89
Identities = 88/101 (87%), Positives = 92/101 (91%), Gaps = 1/101 (0%)
Frame = +1

Query: 373 APPTMIGQFGVKKKGAYLVAEKVVVTTKHNDDEQYIWESQAGGSFTVTRDP-GEPLGRGT 549
A +MIGQFGV AYLVAE+VVVTTKHNDDEQY+WESQAGGSFTVTRD GE LGRGT
Sbjct: 113 ADVSMIGQFGVGFYSAYLVAERVVVTTKHNDDEQYVWESQAGGSFTVTRDTSGENLGRGT 172

Query: 550 KITLFLKEDQLEYLEERRLKDLIKKHSEFISYPISLWVEKT 672
K+TLFLKEDQLEYLEERRLKDLIKKHSEFISYPISLWVEKT
Sbjct: 173 KMTLFLKEDQLEYLEERRLKDLIKKHSEFISYPISLWVEKT 213


>tr|Q2XTE5|Q2XTE5_SOLTU Hsp90-2-like OS=Solanum tuberosum PE=2 SV=1
Length = 700

Score = 183 bits (465), Expect(2) = 1e-89
Identities = 94/97 (96%), Positives = 96/97 (98%)
Frame = +3

Query: 72 INQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQPELFIHIIPDKT 251
INQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQPELFIHIIPDKT
Sbjct: 13 INQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQPELFIHIIPDKT 72

Query: 252 TNSLTIIDSGIGMTKADLVNNLGTIARSGTKEFMEAL 362
N+LTIIDSGIGMTKADLVNNLGTIARSGTKEFMEA+
Sbjct: 73 NNTLTIIDSGIGMTKADLVNNLGTIARSGTKEFMEAI 109



Score = 171 bits (432), Expect(2) = 1e-89
Identities = 86/101 (85%), Positives = 91/101 (90%), Gaps = 1/101 (0%)
Frame = +1

Query: 373 APPTMIGQFGVKKKGAYLVAEKVVVTTKHNDDEQYIWESQAGGSFTVTRDP-GEPLGRGT 549
A +MIGQFGV AYLVAEKV+VTTKHNDDEQY+WESQAGGSFTVTRD GE LGRGT
Sbjct: 113 ADVSMIGQFGVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRDTSGENLGRGT 172

Query: 550 KITLFLKEDQLEYLEERRLKDLIKKHSEFISYPISLWVEKT 672
K+ L+LKEDQLEYLEERRLKDLIKKHSEFISYPISLWVEKT
Sbjct: 173 KMVLYLKEDQLEYLEERRLKDLIKKHSEFISYPISLWVEKT 213


>tr|B1Q477|B1Q477_CAPCH Putative Hsp90-2 OS=Capsicum chinense PE=2
SV=1
Length = 699

Score = 182 bits (461), Expect(2) = 1e-89
Identities = 92/97 (94%), Positives = 95/97 (97%)
Frame = +3

Query: 72 INQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQPELFIHIIPDKT 251
INQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLD QPELFIHIIPDKT
Sbjct: 13 INQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDGQPELFIHIIPDKT 72

Query: 252 TNSLTIIDSGIGMTKADLVNNLGTIARSGTKEFMEAL 362
N+LTI+DSG+GMTKADLVNNLGTIARSGTKEFMEAL
Sbjct: 73 NNTLTIVDSGVGMTKADLVNNLGTIARSGTKEFMEAL 109



Score = 172 bits (436), Expect(2) = 1e-89
Identities = 88/101 (87%), Positives = 91/101 (90%), Gaps = 1/101 (0%)
Frame = +1

Query: 373 APPTMIGQFGVKKKGAYLVAEKVVVTTKHNDDEQYIWESQAGGSFTVTRDP-GEPLGRGT 549
A +MIGQFGV AYLVAEKV+VTTKHNDDEQY+WESQAGGSFTVTRD GE LGRGT
Sbjct: 113 ADVSMIGQFGVGFYSAYLVAEKVLVTTKHNDDEQYVWESQAGGSFTVTRDTSGENLGRGT 172

Query: 550 KITLFLKEDQLEYLEERRLKDLIKKHSEFISYPISLWVEKT 672
KI LFLKEDQLEYLEERRLKDLIKKHSEFISYPISLWVEKT
Sbjct: 173 KIVLFLKEDQLEYLEERRLKDLIKKHSEFISYPISLWVEKT 213