DK950974
Clone id TST38A01NGRL0010_C09
Library
Length 682
Definition Adiantum capillus-veneris mRNA. clone: TST38A01NGRL0010_C09. 5' end sequence.
Accession
Tissue type prothallia
Developmental stage gametophyte
Contig ID
Sequence
TTCAGATGCAAAAATTTTTTATCCCTTTCTGATTTCTCAGGAATGGAAGCTCAGAGCTTG
GTAGCCATGGCGGCGGCGCCATCTCCCGCTTACTGCTCGTTGGCACGCACAGGTCCTATC
CTTCCGCCAGCAACTGCCAGAATCACGTCCACATTTTTCAGTGGGCAGAAGGTGCGCGGA
CGGAGAATGGTATCTCTGCAGCAGCAGCAGCAGAGATTCCGCTTACGACTGCAAGCGCGT
TCTTCCGGCGGGCATGAGTCGTCCCCTGAGGATGGATACGACTCCTCCGGCTCTGCAGGT
GGTACTTCGAAATCTCCTGCTCAAAGTTCTGGCTATACCAGCGACGCTTCAGTGGAGCCT
AAGCAGAACTATGGTAGTGCTCGTCCAGGGACCCCTTCCCAAAACCCTAACCCAGGTTAT
GGAAGCAACACTAGTTCAGGTTATGGAACGCCCAATCCAGGATATGGCTCTGGTGTGGTG
AACCCTACATCTTCTACTCCGTGGAGTGGGTCGGGAGCGGAAGGTTCCCCAAACACTGGA
TATGGTAGTGGCTATGGAGGTGGATCAAGTGCTGGCTATGGAAGTGGGTCAACTGCAGGG
AGTGGACCTGCCTATGGGAGTGGGCCAGCTTCTGGTTATGGTGCTCCTCCTGTTGACTCA
AGGTCTGGGGATGGACCTGGCA
■■Homology search results ■■ -
sp_hit_id P23792
Definition sp|P23792|DISC_DROME Protein disconnected OS=Drosophila melanogaster
Align length 44
Score (bit) 38.5
E-value 0.034
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= DK950974|Adiantum capillus-veneris mRNA, clone:
TST38A01NGRL0010_C09, 5'
(682 letters)

Database: uniprot_sprot.fasta
412,525 sequences; 148,809,765 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

sp|P23792|DISC_DROME Protein disconnected OS=Drosophila melanoga... 39 0.034
sp|Q54TE3|GTAJ_DICDI GATA zinc finger domain-containing protein ... 36 0.17
sp|Q9W4E2|NBEA_DROME Neurobeachin OS=Drosophila melanogaster GN=... 35 0.28
sp|P36417|GBF_DICDI G-box-binding factor OS=Dictyostelium discoi... 35 0.37
sp|P51521|OVO_DROME Protein ovo OS=Drosophila melanogaster GN=ov... 35 0.49
sp|Q54QR1|LIMA_DICDI LIM domain-containing protein A OS=Dictyost... 35 0.49
sp|Q8MP30|Y7791_DICDI Uncharacterized histidine-rich protein DDB... 34 0.63
sp|Q1ZXC2|PABPA_DICDI Polyadenylate-binding protein 1-A OS=Dicty... 34 0.63
sp|Q6BUT3|NST1_DEBHA Stress response protein NST1 OS=Debaryomyce... 34 0.63
sp|Q8IX07|FOG1_HUMAN Zinc finger protein ZFPM1 OS=Homo sapiens G... 34 0.63
sp|P10180|CUT_DROME Homeobox protein cut OS=Drosophila melanogas... 34 0.63
sp|Q0KHT7|Y2666_DROME Probable serine/threonine-protein kinase C... 34 0.82
sp|Q24432|OMB_DROME Optomotor-blind protein OS=Drosophila melano... 34 0.83
sp|Q5F2E7|NUFP2_MOUSE Nuclear fragile X mental retardation-inter... 34 0.83
sp|P04929|HRPX_PLALO Histidine-rich glycoprotein OS=Plasmodium l... 33 1.1
sp|Q26366|VG_DROME Protein vestigial OS=Drosophila melanogaster ... 33 1.4
sp|Q9VHA0|SCM_DROME Polycomb protein Scm OS=Drosophila melanogas... 33 1.8
sp|Q86H13|PDE4_DICDI cAMP-specific 3',5'-cAMP phosphodiesterase ... 33 1.8
sp|Q8SPV9|FCGRN_MACFA IgG receptor FcRn large subunit p51 OS=Mac... 33 1.8
sp|P55899|FCGRN_HUMAN IgG receptor FcRn large subunit p51 OS=Hom... 33 1.8
sp|O43497|CAC1G_HUMAN Voltage-dependent T-type calcium channel s... 33 1.8
sp|Q6ZRP5|YD019_HUMAN Putative uncharacterized protein FLJ46204 ... 32 2.4
sp|Q90888|MAFB_CHICK Transcription factor MafB OS=Gallus gallus ... 32 2.4
sp|P51140|DSH_DROME Segment polarity protein dishevelled OS=Dros... 32 2.4
sp|Q54RP6|DHKL_DICDI Hybrid signal transduction histidine kinase... 32 2.4
sp|Q473Q8|UREE_RALEJ Urease accessory protein ureE OS=Ralstonia ... 32 3.1
sp|Q39016|CDPKB_ARATH Calcium-dependent protein kinase 11 OS=Ara... 32 3.1
sp|Q62563|SRY_MUSSP Sex-determining region Y protein OS=Mus spre... 32 4.1
sp|Q9VP48|RAB26_DROME Ras-related protein Rab-26 OS=Drosophila m... 32 4.1
sp|Q9W539|HR4_DROME Hormone receptor 4 OS=Drosophila melanogaste... 32 4.1

>sp|P23792|DISC_DROME Protein disconnected OS=Drosophila
melanogaster GN=disco PE=1 SV=2
Length = 568

Score = 38.5 bits (88), Expect = 0.034
Identities = 18/44 (40%), Positives = 24/44 (54%)
Frame = -1

Query: 667 QTLSQQEEHHNQKLAHSHRQVHSLQLTHFHSQHLIHLHSHYHIQ 536
Q QQE+HH+ L+H H++ H L H H H H H +H Q
Sbjct: 510 QQQHQQEQHHHLTLSHHHQEQHH-HLGHHHMGHHHHHHHQHHQQ 552



Score = 34.7 bits (78), Expect = 0.49
Identities = 18/51 (35%), Positives = 25/51 (49%), Gaps = 9/51 (17%)
Frame = -1

Query: 667 QTLSQQEEHHNQ-KLAHSHRQVHSLQLTHFHSQ--------HLIHLHSHYH 542
+T QQ HH+Q + H Q H L L+H H + H+ H H H+H
Sbjct: 497 KTQHQQYNHHHQLQQQHQQEQHHHLTLSHHHQEQHHHLGHHHMGHHHHHHH 547


>sp|Q54TE3|GTAJ_DICDI GATA zinc finger domain-containing protein 10
OS=Dictyostelium discoideum GN=gtaJ PE=4 SV=1
Length = 714

Score = 36.2 bits (82), Expect = 0.17
Identities = 17/44 (38%), Positives = 21/44 (47%)
Frame = -1

Query: 667 QTLSQQEEHHNQKLAHSHRQVHSLQLTHFHSQHLIHLHSHYHIQ 536
Q QQ++ H Q+ H H+Q H Q H H Q H H H Q
Sbjct: 130 QQQQQQQQQHYQQQQHPHQQQHPHQQQHPHQQQHPHQQQHPHQQ 173


>sp|Q9W4E2|NBEA_DROME Neurobeachin OS=Drosophila melanogaster GN=rg
PE=1 SV=2
Length = 3584

Score = 35.4 bits (80), Expect = 0.28
Identities = 16/53 (30%), Positives = 28/53 (52%), Gaps = 7/53 (13%)
Frame = -1

Query: 676 VHPQTLSQQEEHHNQKLAHSHRQVHS---LQLTHFH----SQHLIHLHSHYHI 539
V+PQ L + ++HN + H +Q Q H++ Q ++H HSH+H+
Sbjct: 1993 VYPQFLPESHQNHNSNMQHQQQQQQQQQHQQQQHYYQQQQQQQVVHNHSHHHM 2045



Score = 32.7 bits (73), Expect = 1.8
Identities = 23/69 (33%), Positives = 32/69 (46%), Gaps = 11/69 (15%)
Frame = -1

Query: 673 HPQTLSQQEEHHNQKLAHSHRQVHSLQLTHFHSQHLIHLHSHYHIQ------CLGN---- 524
H Q QQ++H Q+ H ++Q Q+ H HS H H+ + Y+ Q G
Sbjct: 2011 HQQQQQQQQQHQQQQ--HYYQQQQQQQVVHNHSHH--HMTAAYYQQQQHQQVAAGQQQHS 2066

Query: 523 -LPLPTHST 500
PL THST
Sbjct: 2067 PTPLATHST 2075


>sp|P36417|GBF_DICDI G-box-binding factor OS=Dictyostelium
discoideum GN=gbfA PE=1 SV=2
Length = 708

Score = 35.0 bits (79), Expect = 0.37
Identities = 18/48 (37%), Positives = 23/48 (47%)
Frame = -1

Query: 679 QVHPQTLSQQEEHHNQKLAHSHRQVHSLQLTHFHSQHLIHLHSHYHIQ 536
Q H Q QQ++HH Q+ H H Q Q H H+Q H H+ Q
Sbjct: 205 QHHQQQQQQQQQHHQQQQHHQHSQP---QQQHQHNQQQQHQHNQQQHQ 249



Score = 33.1 bits (74), Expect = 1.4
Identities = 17/48 (35%), Positives = 22/48 (45%)
Frame = -1

Query: 679 QVHPQTLSQQEEHHNQKLAHSHRQVHSLQLTHFHSQHLIHLHSHYHIQ 536
Q H Q + QQ++HH Q H Q Q+ H H + H H H Q
Sbjct: 156 QQHHQQMQQQQQHHQQMQQQQHHQ----QMQH----HQLQQHQHQHQQ 195


>sp|P51521|OVO_DROME Protein ovo OS=Drosophila melanogaster GN=ovo
PE=1 SV=2
Length = 1351

Score = 34.7 bits (78), Expect = 0.49
Identities = 19/54 (35%), Positives = 23/54 (42%), Gaps = 1/54 (1%)
Frame = -1

Query: 667 QTLSQQEEHHNQKLAHSHRQVHSLQLTHFHSQ-HLIHLHSHYHIQCLGNLPLPT 509
Q QQ++HH Q+ H H Q Q H H H H H +LP PT
Sbjct: 947 QQQQQQQQHHQQQQQQQHHHFHHQQQQQPQPQSHHSHHHGHGHDNSNMSLPSPT 1000


>sp|Q54QR1|LIMA_DICDI LIM domain-containing protein A
OS=Dictyostelium discoideum GN=limA PE=2 SV=1
Length = 1183

Score = 34.7 bits (78), Expect = 0.49
Identities = 22/56 (39%), Positives = 25/56 (44%), Gaps = 9/56 (16%)
Frame = -1

Query: 676 VHPQTLSQQEEHHNQKLAHSHRQVHSL---QLTHFHSQHLIHLHS------HYHIQ 536
VHP + HH+Q HSH Q HS Q H QH H HS H HI+
Sbjct: 761 VHPHNATPSHHHHHQ---HSHSQPHSFDHNQHQHQPLQHHHHTHSQPISIQHQHIE 813



Score = 33.1 bits (74), Expect = 1.4
Identities = 26/73 (35%), Positives = 30/73 (41%), Gaps = 2/73 (2%)
Frame = -1

Query: 676 VHPQTLSQQEEH-HNQKLAHSH-RQVHSLQLTHFHSQHLIHLHSHYHIQCLGNLPLPTHS 503
+H L + + H H L HSH Q HS +H H Q H HSH P HS
Sbjct: 681 IHTAKLKENDHHAHPNPLEHSHPHQSHSHSHSHSHPQ---HPHSH---------PQHPHS 728

Query: 502 TE*KM*GSPHQSH 464
PHQSH
Sbjct: 729 -------HPHQSH 734



Score = 30.8 bits (68), Expect = 7.0
Identities = 18/52 (34%), Positives = 20/52 (38%), Gaps = 6/52 (11%)
Frame = -1

Query: 673 HPQTLSQQEEHHNQKLAHSHRQVHSLQLTHFHSQ------HLIHLHSHYHIQ 536
HP L H + +HSH Q H H Q H H HSH H Q
Sbjct: 694 HPNPLEHSHPHQSHSHSHSHSHP---QHPHSHPQHPHSHPHQSHSHSHAHSQ 742


>sp|Q8MP30|Y7791_DICDI Uncharacterized histidine-rich protein
DDB0167791 OS=Dictyostelium discoideum GN=DDB_G0274557
PE=4 SV=1
Length = 233

Score = 34.3 bits (77), Expect = 0.63
Identities = 14/44 (31%), Positives = 16/44 (36%)
Frame = -1

Query: 673 HPQTLSQQEEHHNQKLAHSHRQVHSLQLTHFHSQHLIHLHSHYH 542
HP HH+ H H H H H H H H H+H
Sbjct: 109 HPHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH 152



Score = 33.9 bits (76), Expect = 0.83
Identities = 14/44 (31%), Positives = 16/44 (36%)
Frame = -1

Query: 673 HPQTLSQQEEHHNQKLAHSHRQVHSLQLTHFHSQHLIHLHSHYH 542
HP HH+ H H H H H H H H H+H
Sbjct: 96 HPHHPHHHPHHHHHPHHHHHHHHHHHHHHHHHHHHHHHHHHHHH 139



Score = 33.9 bits (76), Expect = 0.83
Identities = 14/44 (31%), Positives = 16/44 (36%)
Frame = -1

Query: 673 HPQTLSQQEEHHNQKLAHSHRQVHSLQLTHFHSQHLIHLHSHYH 542
HP HH+ H H H H H H H H H+H
Sbjct: 103 HPHHHHHPHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH 146



Score = 33.5 bits (75), Expect = 1.1
Identities = 15/44 (34%), Positives = 17/44 (38%)
Frame = -1

Query: 673 HPQTLSQQEEHHNQKLAHSHRQVHSLQLTHFHSQHLIHLHSHYH 542
HP L HH+ H H H H H H H H H+H
Sbjct: 66 HPHHLHHHHHHHHHHHHHHHHHHHHHH--HHHHPHHPHHHPHHH 107



Score = 31.6 bits (70), Expect = 4.1
Identities = 12/34 (35%), Positives = 14/34 (41%)
Frame = -1

Query: 643 HHNQKLAHSHRQVHSLQLTHFHSQHLIHLHSHYH 542
HH+ H H H H H H H H H+H
Sbjct: 92 HHHHHPHHPHHHPHHHHHPHHHHHHHHHHHHHHH 125



Score = 31.2 bits (69), Expect = 5.4
Identities = 12/34 (35%), Positives = 14/34 (41%)
Frame = -1

Query: 643 HHNQKLAHSHRQVHSLQLTHFHSQHLIHLHSHYH 542
HH+ H H H H H H H H H+H
Sbjct: 82 HHHHHHHHHHHHHHHPHHPHHHPHHHHHPHHHHH 115



Score = 30.8 bits (68), Expect = 7.0
Identities = 12/34 (35%), Positives = 14/34 (41%)
Frame = -1

Query: 643 HHNQKLAHSHRQVHSLQLTHFHSQHLIHLHSHYH 542
HH+ H H H H H H H H H+H
Sbjct: 120 HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH 153



Score = 30.8 bits (68), Expect = 7.0
Identities = 12/34 (35%), Positives = 14/34 (41%)
Frame = -1

Query: 643 HHNQKLAHSHRQVHSLQLTHFHSQHLIHLHSHYH 542
HH+ H H H H H H H H H+H
Sbjct: 121 HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH 154



Score = 30.8 bits (68), Expect = 7.0
Identities = 12/34 (35%), Positives = 14/34 (41%)
Frame = -1

Query: 643 HHNQKLAHSHRQVHSLQLTHFHSQHLIHLHSHYH 542
HH+ H H H H H H H H H+H
Sbjct: 125 HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHPHHH 158



Score = 30.4 bits (67), Expect = 9.1
Identities = 13/34 (38%), Positives = 13/34 (38%)
Frame = -1

Query: 643 HHNQKLAHSHRQVHSLQLTHFHSQHLIHLHSHYH 542
HH L H H H H H H H H H H
Sbjct: 65 HHPHHLHHHHHHHHHHHHHHHHHHHHHHHHHHPH 98


>sp|Q1ZXC2|PABPA_DICDI Polyadenylate-binding protein 1-A
OS=Dictyostelium discoideum GN=pabp1A PE=3 SV=1
Length = 814

Score = 34.3 bits (77), Expect = 0.63
Identities = 16/52 (30%), Positives = 20/52 (38%), Gaps = 1/52 (1%)
Frame = -1

Query: 679 QVHPQTLSQQEEHHNQKLAHSHRQVHSLQLTHFHSQHLIHL-HSHYHIQCLG 527
Q HP + H Q H H+ H H H H H H H+H +G
Sbjct: 107 QQHPGYVPSHHHHQQQHHHHQHQHQHHQHQHHQHQHHQHHQHHQHHHTSPMG 158


>sp|Q6BUT3|NST1_DEBHA Stress response protein NST1 OS=Debaryomyces
hansenii GN=NST1 PE=3 SV=2
Length = 1179

Score = 34.3 bits (77), Expect = 0.63
Identities = 17/45 (37%), Positives = 21/45 (46%), Gaps = 5/45 (11%)
Frame = -1

Query: 655 QQEEH-----HNQKLAHSHRQVHSLQLTHFHSQHLIHLHSHYHIQ 536
Q++EH H +HSH H+ H HS H HSH H Q
Sbjct: 311 QEDEHEDECGHKNDHSHSHSHSHTENHNHSHSYDPNHNHSHSHFQ 355


>sp|Q8IX07|FOG1_HUMAN Zinc finger protein ZFPM1 OS=Homo sapiens
GN=ZFPM1 PE=1 SV=1
Length = 1004

Score = 34.3 bits (77), Expect = 0.63
Identities = 16/50 (32%), Positives = 24/50 (48%)
Frame = +1

Query: 250 GHESSPEDGYDSSGSAGGTSKSPAQSSGYTSDASVEPKQNYGSARPGTPS 399
GH +PE SGS G +PA+S G +D ++ + PG P+
Sbjct: 759 GHAPAPESPRPGSGSGSGPGLAPARSPGPAADGPIDLSKKPRRPLPGAPA 808


tr_hit_id Q4TA56
Definition tr|Q4TA56|Q4TA56_TETNG Chromosome undetermined SCAF7448, whole genome shotgun sequence. (Fragment) OS=Tetraodon nigroviridis
Align length 75
Score (bit) 59.7
E-value 2.0e-07
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= DK950974|Adiantum capillus-veneris mRNA, clone:
TST38A01NGRL0010_C09, 5'
(682 letters)

Database: uniprot_trembl.fasta
7,341,751 sequences; 2,391,615,440 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

tr|Q4TA56|Q4TA56_TETNG Chromosome undetermined SCAF7448, whole g... 60 2e-07
tr|A7K920|A7K920_9PHYC Putative uncharacterized protein z410R OS... 55 3e-06
tr|B0WHK4|B0WHK4_CULQU Predicted protein (Fragment) OS=Culex qui... 53 2e-05
tr|B6NA07|B6NA07_BRAFL Putative uncharacterized protein OS=Branc... 49 4e-04
tr|Q6ZUN2|Q6ZUN2_HUMAN cDNA FLJ43523 fis, clone PLACE5000282, we... 46 0.002
tr|B4KTE3|B4KTE3_DROMO GI19536 OS=Drosophila mojavensis GN=GI195... 44 0.009
tr|Q8LTG6|Q8LTG6_9VIRU Mitogen OS=Streptococcus phage phisc1 GN=... 43 0.016
tr|B4IBB5|B4IBB5_DROSE GM15270 OS=Drosophila sechellia GN=GM1527... 43 0.021
tr|A7IUT8|A7IUT8_PBCVM Putative uncharacterized protein m558R OS... 42 0.047
tr|A9S9C8|A9S9C8_PHYPA Predicted protein OS=Physcomitrella paten... 41 0.062
tr|A8JNU8|A8JNU8_DROME CG32169, isoform B OS=Drosophila melanoga... 41 0.081
tr|B4QV27|B4QV27_DROSI GD19193 OS=Drosophila simulans GN=GD19193... 40 0.11
tr|Q6BYS6|Q6BYS6_DEBHA DEHA2A07282p OS=Debaryomyces hansenii GN=... 40 0.14
tr|Q86AZ9|Q86AZ9_DICDI Similar to Mus musculus (Mouse). Sex-dete... 39 0.24
tr|Q550K3|Q550K3_DICDI Putative uncharacterized protein OS=Dicty... 39 0.24
tr|B4MT68|B4MT68_DROWI GK19761 OS=Drosophila willistoni GN=GK197... 39 0.24
tr|B4M9W7|B4M9W7_DROVI Ovo OS=Drosophila virilis GN=Dvir\ovo PE=... 39 0.24
tr|B3NZB3|B3NZB3_DROER GG16806 OS=Drosophila erecta GN=GG16806 P... 39 0.24
tr|B4K982|B4K982_DROMO GI24295 OS=Drosophila mojavensis GN=GI242... 39 0.31
tr|B3LW94|B3LW94_DROAN GF18110 OS=Drosophila ananassae GN=GF1811... 39 0.31
tr|A9VLA0|A9VLA0_BACWK VrrB protein OS=Bacillus weihenstephanens... 39 0.40
tr|Q53YG0|Q53YG0_DROME Disconnected, isoform B OS=Drosophila mel... 39 0.40
tr|B4JN73|B4JN73_DROGR GH24765 OS=Drosophila grimshawi GN=GH2476... 39 0.40
tr|A8P051|A8P051_BRUMA Hypothetical 17.1 kDa protein in PUR5 3'r... 39 0.40
tr|B7Q5P8|B7Q5P8_IXOSC Putative uncharacterized protein (Fragmen... 38 0.52
tr|Q9U1K4|Q9U1K4_DROME C2H2 zinc finger transcription factor OS=... 38 0.53
tr|Q8IRM5|Q8IRM5_DROME Sp1, isoform B OS=Drosophila melanogaster... 38 0.53
tr|B5DN39|B5DN39_DROPS GA22634 OS=Drosophila pseudoobscura pseud... 38 0.53
tr|B4R764|B4R764_DROSI GD16964 OS=Drosophila simulans GN=GD16964... 38 0.53
tr|B4M8J1|B4M8J1_DROVI GJ18132 OS=Drosophila virilis GN=GJ18132 ... 38 0.53

>tr|Q4TA56|Q4TA56_TETNG Chromosome undetermined SCAF7448, whole
genome shotgun sequence. (Fragment) OS=Tetraodon
nigroviridis GN=GSTENG00004427001 PE=4 SV=1
Length = 548

Score = 59.7 bits (143), Expect = 2e-07
Identities = 24/75 (32%), Positives = 27/75 (36%), Gaps = 14/75 (18%)
Frame = +3

Query: 498 SVEWVGSGRFPKHWIW*WLWRWIKCWLWKWVNCR--------------EWTCLWEWASFW 635
SV GSG W W +W W W W W R W C+W W W
Sbjct: 286 SVSGPGSGNCVWAWAWACVWAWAWAWAWAWARARAWVWVWVCVWAWAWAWVCVWAWVCVW 345

Query: 636 LWCSSC*LKVWGWTW 680
W C + VW W W
Sbjct: 346 AWVCVC-VCVWAWAW 359


>tr|A7K920|A7K920_9PHYC Putative uncharacterized protein z410R
OS=Acanthocystis turfacea Chlorella virus 1 GN=z410R
PE=4 SV=1
Length = 129

Score = 55.5 bits (132), Expect = 3e-06
Identities = 28/81 (34%), Positives = 34/81 (41%), Gaps = 6/81 (7%)
Frame = +3

Query: 417 LWKQH*FRLWNAQSRIWLWCGEPYIFYSVEWV--GSGRFPKHWIW*W----LWRWIKCWL 578
LW + F W+ R W WCG W GS + + W+W W LW W + WL
Sbjct: 51 LWGRPWFWSWH---RSWHWCGC--------WPRRGSWHWHRRWLWHWHRRWLWHWHRRWL 99

Query: 579 WKWVNCREWTCLWEWASFWLW 641
W W R W W W W W
Sbjct: 100 WHW--HRRWLWHWHWHGSWRW 118



Score = 45.4 bits (106), Expect = 0.003
Identities = 18/54 (33%), Positives = 22/54 (40%), Gaps = 8/54 (14%)
Frame = +3

Query: 543 W*WLWRWIKCWLWKWVNCRE--WTCLWE------WASFWLWCSSC*LKVWGWTW 680
W W W+ CW W+ CR W W W FWLW + W W+W
Sbjct: 12 WFRFWTWLGCWYGFWLGCRRGFWLGCWRGFWLGCWRGFWLWG-----RPWFWSW 60



Score = 42.4 bits (98), Expect = 0.028
Identities = 24/84 (28%), Positives = 28/84 (33%), Gaps = 10/84 (11%)
Frame = +3

Query: 459 RIWLWCGEPYIFY----SVEWVGSGRFPKHWIW*WLWRWIKCWLWKWVNCREWTCLW--- 617
R W W G Y F+ W+G R W W W + W W W W W
Sbjct: 14 RFWTWLGCWYGFWLGCRRGFWLGCWRGFWLGCWRGFWLWGRPWFWSWHRSWHWCGCWPRR 73

Query: 618 ---EWASFWLWCSSC*LKVWGWTW 680
W WLW + W W W
Sbjct: 74 GSWHWHRRWLWHWH---RRWLWHW 94



Score = 35.8 bits (81), Expect = 2.6
Identities = 20/63 (31%), Positives = 25/63 (39%)
Frame = +3

Query: 420 WKQH*FRLWNAQSRIWLWCGEPYIFYSVEWVGSGRFPKHWIW*WLWRWIKCWLWKWVNCR 599
W H LW+ R WLW W R+ HW WLW W W+W R
Sbjct: 76 WHWHRRWLWHWHRR-WLW----------HW--HRRWLWHWHRRWLWHWHWHGSWRWSRKR 122

Query: 600 EWT 608
+W+
Sbjct: 123 KWS 125


>tr|B0WHK4|B0WHK4_CULQU Predicted protein (Fragment) OS=Culex
quinquefasciatus GN=CpipJ_CPIJ006504 PE=4 SV=1
Length = 527

Score = 53.1 bits (126), Expect = 2e-05
Identities = 25/88 (28%), Positives = 29/88 (32%), Gaps = 3/88 (3%)
Frame = +3

Query: 426 QH*FRLWNAQSRI---WLWCGEPYIFYSVEWVGSGRFPKHWIW*WLWRWIKCWLWKWVNC 596
+H W A R W W + F+ W + W W W W W W W W
Sbjct: 206 KHVLTCWPADWRTLLGWFWFWFWFWFWFWFWFWFWFWFWFWFWFWFWFWFWFWFWFWFWF 265

Query: 597 REWTCLWEWASFWLWCSSC*LKVWGWTW 680
W W W FW W W W W
Sbjct: 266 WFWFWFWFWFWFWFW-------FWFWFW 286



Score = 52.0 bits (123), Expect = 3e-05
Identities = 21/72 (29%), Positives = 24/72 (33%)
Frame = +3

Query: 465 WLWCGEPYIFYSVEWVGSGRFPKHWIW*WLWRWIKCWLWKWVNCREWTCLWEWASFWLWC 644
W W + F+ W + W W W W W W W W W W W FW W
Sbjct: 230 WFWFWFWFWFWFWFWFWFWFWFWFWFWFWFWFWFWFWFWFWFWFWFWFWFWFWFWFWFW- 288

Query: 645 SSC*LKVWGWTW 680
W W W
Sbjct: 289 ------FWFWFW 294



Score = 52.0 bits (123), Expect = 3e-05
Identities = 21/72 (29%), Positives = 24/72 (33%)
Frame = +3

Query: 465 WLWCGEPYIFYSVEWVGSGRFPKHWIW*WLWRWIKCWLWKWVNCREWTCLWEWASFWLWC 644
W W + F+ W + W W W W W W W W W W W FW W
Sbjct: 238 WFWFWFWFWFWFWFWFWFWFWFWFWFWFWFWFWFWFWFWFWFWFWFWFWFWFWFWFWFW- 296

Query: 645 SSC*LKVWGWTW 680
W W W
Sbjct: 297 ------FWFWFW 302



Score = 52.0 bits (123), Expect = 3e-05
Identities = 21/72 (29%), Positives = 24/72 (33%)
Frame = +3

Query: 465 WLWCGEPYIFYSVEWVGSGRFPKHWIW*WLWRWIKCWLWKWVNCREWTCLWEWASFWLWC 644
W W + F+ W + W W W W W W W W W W W FW W
Sbjct: 246 WFWFWFWFWFWFWFWFWFWFWFWFWFWFWFWFWFWFWFWFWFWFWFWFWFWFWFWFWFW- 304

Query: 645 SSC*LKVWGWTW 680
W W W
Sbjct: 305 ------FWFWFW 310



Score = 52.0 bits (123), Expect = 3e-05
Identities = 21/72 (29%), Positives = 24/72 (33%)
Frame = +3

Query: 465 WLWCGEPYIFYSVEWVGSGRFPKHWIW*WLWRWIKCWLWKWVNCREWTCLWEWASFWLWC 644
W W + F+ W + W W W W W W W W W W W FW W
Sbjct: 254 WFWFWFWFWFWFWFWFWFWFWFWFWFWFWFWFWFWFWFWFWFWFWFWFWFWFWFWFWFW- 312

Query: 645 SSC*LKVWGWTW 680
W W W
Sbjct: 313 ------FWFWFW 318



Score = 52.0 bits (123), Expect = 3e-05
Identities = 21/72 (29%), Positives = 24/72 (33%)
Frame = +3

Query: 465 WLWCGEPYIFYSVEWVGSGRFPKHWIW*WLWRWIKCWLWKWVNCREWTCLWEWASFWLWC 644
W W + F+ W + W W W W W W W W W W W FW W
Sbjct: 262 WFWFWFWFWFWFWFWFWFWFWFWFWFWFWFWFWFWFWFWFWFWFWFWFWFWFWFWFWFW- 320

Query: 645 SSC*LKVWGWTW 680
W W W
Sbjct: 321 ------FWFWFW 326



Score = 52.0 bits (123), Expect = 3e-05
Identities = 21/72 (29%), Positives = 24/72 (33%)
Frame = +3

Query: 465 WLWCGEPYIFYSVEWVGSGRFPKHWIW*WLWRWIKCWLWKWVNCREWTCLWEWASFWLWC 644
W W + F+ W + W W W W W W W W W W W FW W
Sbjct: 270 WFWFWFWFWFWFWFWFWFWFWFWFWFWFWFWFWFWFWFWFWFWFWFWFWFWFWFWFWFW- 328

Query: 645 SSC*LKVWGWTW 680
W W W
Sbjct: 329 ------FWFWFW 334



Score = 52.0 bits (123), Expect = 3e-05
Identities = 21/72 (29%), Positives = 24/72 (33%)
Frame = +3

Query: 465 WLWCGEPYIFYSVEWVGSGRFPKHWIW*WLWRWIKCWLWKWVNCREWTCLWEWASFWLWC 644
W W + F+ W + W W W W W W W W W W W FW W
Sbjct: 278 WFWFWFWFWFWFWFWFWFWFWFWFWFWFWFWFWFWFWFWFWFWFWFWFWFWFWFWFWFW- 336

Query: 645 SSC*LKVWGWTW 680
W W W
Sbjct: 337 ------FWFWFW 342



Score = 52.0 bits (123), Expect = 3e-05
Identities = 21/72 (29%), Positives = 24/72 (33%)
Frame = +3

Query: 465 WLWCGEPYIFYSVEWVGSGRFPKHWIW*WLWRWIKCWLWKWVNCREWTCLWEWASFWLWC 644
W W + F+ W + W W W W W W W W W W W FW W
Sbjct: 286 WFWFWFWFWFWFWFWFWFWFWFWFWFWFWFWFWFWFWFWFWFWFWFWFWFWFWFWFWFW- 344

Query: 645 SSC*LKVWGWTW 680
W W W
Sbjct: 345 ------FWFWFW 350



Score = 48.5 bits (114), Expect = 4e-04
Identities = 18/59 (30%), Positives = 21/59 (35%)
Frame = +3

Query: 465 WLWCGEPYIFYSVEWVGSGRFPKHWIW*WLWRWIKCWLWKWVNCREWTCLWEWASFWLW 641
W W + F+ W + W W W W W W W W W W W FW W
Sbjct: 294 WFWFWFWFWFWFWFWFWFWFWFWFWFWFWFWFWFWFWFWFWFWFWFWFWFWFWFWFWFW 352


>tr|B6NA07|B6NA07_BRAFL Putative uncharacterized protein
OS=Branchiostoma floridae GN=BRAFLDRAFT_92590 PE=4 SV=1
Length = 382

Score = 48.5 bits (114), Expect = 4e-04
Identities = 18/42 (42%), Positives = 22/42 (52%)
Frame = +3

Query: 552 LWRWIKCWLWKWVNCREWTCLWEWASFWLWCSSC*LKVWGWT 677
+W W CW W W CR W+ W W W W SSC + W W+
Sbjct: 322 VWSWGSCWAWSW--CRAWS--WNWCRAWSW-SSC--RAWSWS 356



Score = 40.0 bits (92), Expect = 0.14
Identities = 17/44 (38%), Positives = 18/44 (40%)
Frame = +3

Query: 537 WIW*WLWRWIKCWLWKWVNCREWTCLWEWASFWLWCSSC*LKVW 668
W W W W C W W CR W+ W W W SSC W
Sbjct: 323 WSWGSCWAWSWCRAWSWNWCRAWS--WSSCRAWSW-SSCMAGSW 363



Score = 38.1 bits (87), Expect = 0.52
Identities = 17/46 (36%), Positives = 19/46 (41%), Gaps = 7/46 (15%)
Frame = +3

Query: 537 WIW*WL--WRWIKCWLWKWVNCREWTCLWEWASFWLWC-----SSC 653
W W W W W C W W +CR W+ A W C SSC
Sbjct: 329 WAWSWCRAWSWNWCRAWSWSSCRAWSWSSCMAGSWSLCMAGSWSSC 374


>tr|Q6ZUN2|Q6ZUN2_HUMAN cDNA FLJ43523 fis, clone PLACE5000282,
weakly similar to Homo sapiens elastin (supravalvular
aortic stenosis, Williams-Beuren syndrome) (ELN) OS=Homo
sapiens PE=2 SV=1
Length = 559

Score = 45.8 bits (107), Expect = 0.002
Identities = 28/102 (27%), Positives = 32/102 (31%), Gaps = 30/102 (29%)
Frame = +3

Query: 465 WLWCGEPYIFYSVEWVGSGRFPKHWIW*WLWRW---------------IKC--------- 572
W W G S W+GS + W W WRW I+C
Sbjct: 457 WSWRGSWCRCGSWSWLGSWSWRGSWSWCGSWRWRGSRHWPWWSCSCSKIRCQGGCQSPAP 516

Query: 573 ---WLWKWVNCREWTCLW---EWASFWLWCSSC*LKVWGWTW 680
W W W WT W W W WCS W W+W
Sbjct: 517 SCSWAWCW---HPWTWSWCRRPWTWSWCWCS------WTWSW 549



Score = 43.9 bits (102), Expect = 0.009
Identities = 25/102 (24%), Positives = 33/102 (32%), Gaps = 26/102 (25%)
Frame = +3

Query: 453 QSRIWLWCGEPYIFYSVEWVGSGRFPKHWIW*WLWR--WIKCWLWKWVNCREW------- 605
Q R+ WC + W G + W+ W WR W C W+W R W
Sbjct: 445 QVRVSSWCRRGSWSWRGSWCRCGSWS--WLGSWSWRGSWSWCGSWRWRGSRHWPWWSCSC 502

Query: 606 --------------TCLWEWASF---WLWCSSC*LKVWGWTW 680
+C W W W WC + W W+W
Sbjct: 503 SKIRCQGGCQSPAPSCSWAWCWHPWTWSWCR----RPWTWSW 540


>tr|B4KTE3|B4KTE3_DROMO GI19536 OS=Drosophila mojavensis GN=GI19536
PE=4 SV=1
Length = 1310

Score = 43.9 bits (102), Expect = 0.009
Identities = 15/37 (40%), Positives = 16/37 (43%)
Frame = +3

Query: 537 WIW*WLWRWIKCWLWKWVNCREWTCLWEWASFWLWCS 647
W W W W W W W W W LW W+ W W S
Sbjct: 1197 WPWEWAWAWSGAWAWAW----SW--LWAWSWLWSWLS 1227



Score = 39.7 bits (91), Expect = 0.18
Identities = 16/48 (33%), Positives = 18/48 (37%)
Frame = +3

Query: 537 WIW*WLWRWIKCWLWKWVNCREWTCLWEWASFWLWCSSC*LKVWGWTW 680
W W W W W W+ W WA WLW S W W+W
Sbjct: 1195 WAWPWEWAWA------------WSGAWAWAWSWLWAWS-----WLWSW 1225



Score = 38.5 bits (88), Expect = 0.40
Identities = 13/35 (37%), Positives = 15/35 (42%)
Frame = +3

Query: 525 FPKHWIW*WLWRWIKCWLWKWVNCREWTCLWEWAS 629
+P W W W W W W W W+ LW W S
Sbjct: 1197 WPWEWAWAWSGAWAWAWSWLWA----WSWLWSWLS 1227



Score = 38.1 bits (87), Expect = 0.52
Identities = 16/48 (33%), Positives = 22/48 (45%), Gaps = 2/48 (4%)
Frame = +3

Query: 465 WLWCGEPYIFYSVEWVGSGRFPKHWIW*WLWRWIKCWLWKWVN--CRE 602
W W E ++ W G+ W W W W W WLW W++ CR+
Sbjct: 1195 WAWPWE----WAWAWSGA------WAWAWSWLWAWSWLWSWLSMKCRQ 1232


>tr|Q8LTG6|Q8LTG6_9VIRU Mitogen OS=Streptococcus phage phisc1 GN=scm
PE=4 SV=1
Length = 183

Score = 43.1 bits (100), Expect = 0.016
Identities = 22/78 (28%), Positives = 29/78 (37%), Gaps = 8/78 (10%)
Frame = +3

Query: 465 WLWCGEPYIFYSVEWVGSGRFPKHWIW*WLWRWIKCWLWKWVNCREWTCLWEWASFW--- 635
W WC +Y ++G+ +P W W CW W W C W W+S +
Sbjct: 12 WCWCSSCSYWYL--YLGTSGYPACLCWSWCSHR-PCWSWCWHRCYGWCVCLTWSSSYRIG 68

Query: 636 -----LWCSSC*LKVWGW 674
LWC C W W
Sbjct: 69 CWYGSLWCCCC--PHWCW 84


>tr|B4IBB5|B4IBB5_DROSE GM15270 OS=Drosophila sechellia GN=GM15270
PE=4 SV=1
Length = 349

Score = 42.7 bits (99), Expect = 0.021
Identities = 23/58 (39%), Positives = 28/58 (48%), Gaps = 12/58 (20%)
Frame = -1

Query: 679 QVHPQTLSQQEEHHN---QKLAHSHRQVHSLQLTHFH---------SQHLIHLHSHYH 542
QVH QT QQ++HH+ Q HSH+ H Q H QHL H H H+H
Sbjct: 279 QVHHQTQQQQQQHHHTAAQHYHHSHQTAHHQQQQQQHHQQQQQQAQQQHLSHQHHHHH 336


>tr|A7IUT8|A7IUT8_PBCVM Putative uncharacterized protein m558R
OS=Paramecium bursaria Chlorella virus MT325 GN=m558R
PE=4 SV=1
Length = 216

Score = 41.6 bits (96), Expect = 0.047
Identities = 15/37 (40%), Positives = 17/37 (45%), Gaps = 7/37 (18%)
Frame = +3

Query: 555 WRWIKCWLWK----WVNCREWTCLWEWASFWL---WC 644
W W +CWLW W C W+ W W WL WC
Sbjct: 176 WYWGRCWLWSGFWYWGRCWLWSGFWYWGRCWLDWSWC 212



Score = 40.0 bits (92), Expect = 0.14
Identities = 32/107 (29%), Positives = 42/107 (39%), Gaps = 5/107 (4%)
Frame = +3

Query: 294 CRWYFEISCSKFWLYQRRFSGA*AELW*CSSRDPFPKP*PRLWKQH*FRLWNAQSRIWLW 473
CR+++ C +FW R W SR F W + R W +SR W
Sbjct: 125 CRFWYRSRC-RFWYRSR------CRFW-YRSRCGF-------WYRSRCRFWY-RSRCGFW 168

Query: 474 ----CGEPYIFYSVEWVGSGRFPKHWIW*WLWRWIKCWL-WKWVNCR 599
CG Y W G + + W+W W W +CWL W W CR
Sbjct: 169 YRSRCGFWYWGRCWLWSGFWYWGRCWLWSGFWYWGRCWLDWSW--CR 213



Score = 39.3 bits (90), Expect = 0.23
Identities = 14/42 (33%), Positives = 16/42 (38%)
Frame = +3

Query: 555 WRWIKCWLWKWVNCREWTCLWEWASFWLWCSSC*LKVWGWTW 680
W +C W W C W+ W W WLW WG W
Sbjct: 168 WYRSRCGFWYWGRCWLWSGFWYWGRCWLWSG---FWYWGRCW 206


>tr|A9S9C8|A9S9C8_PHYPA Predicted protein OS=Physcomitrella patens
subsp. patens GN=PHYPADRAFT_76297 PE=4 SV=1
Length = 353

Score = 41.2 bits (95), Expect = 0.062
Identities = 28/88 (31%), Positives = 33/88 (37%), Gaps = 16/88 (18%)
Frame = +3

Query: 465 WL--WCGEPYIFYSVEWVGS------GRFPKHWIW*WLWRWIKCWLWKWVNCREWTCLW- 617
WL W G + EWVG GR+ W+ WL W+ WL +WV W W
Sbjct: 255 WLAAWVGR----WLAEWVGRWLAAWVGRWLAEWVGRWLAEWVGRWLAEWVG--RWLAAWV 308

Query: 618 -----EWASFWL--WCSSC*LKVWGWTW 680
EW WL W L W W
Sbjct: 309 GRWLAEWVGRWLAEWVGRW-LAAWVGRW 335



Score = 36.6 bits (83), Expect = 1.5
Identities = 25/84 (29%), Positives = 32/84 (38%), Gaps = 12/84 (14%)
Frame = +3

Query: 465 WL--WCGEPYIFYSVEWVGSGRFPKHWIW*WLWRWIKCWLWKWVNC------REWTCLW- 617
WL W G + EWVG W+ W+ RW+ W+ +W+ EW W
Sbjct: 239 WLAAWVGR----WLAEWVG------RWLAAWVGRWLAEWVGRWLAAWVGRWLAEWVGRWL 288

Query: 618 -EWASFWL--WCSSC*LKVWGWTW 680
EW WL W L W W
Sbjct: 289 AEWVGRWLAEWVGRW-LAAWVGRW 311



Score = 35.8 bits (81), Expect = 2.6
Identities = 17/58 (29%), Positives = 25/58 (43%), Gaps = 2/58 (3%)
Frame = +3

Query: 471 WCGEPYIFYSVEWVGS--GRFPKHWIW*WLWRWIKCWLWKWVNCREWTCLWEWASFWL 638
W E + EWVG + W+ W+ RW+ W+ +W+ L EW WL
Sbjct: 287 WLAEWVGRWLAEWVGRWLAAWVGRWLAEWVGRWLAEWVGRWLAAWVGRWLAEWVGRWL 344



Score = 34.7 bits (78), Expect = 5.8
Identities = 16/56 (28%), Positives = 24/56 (42%)
Frame = +3

Query: 471 WCGEPYIFYSVEWVGSGRFPKHWIW*WLWRWIKCWLWKWVNCREWTCLWEWASFWL 638
W E + EW+G W+ W+ RW+ W+ +W+ L EW WL
Sbjct: 223 WLKEWMDRWQKEWMG------RWLAAWVGRWLAEWVGRWLAAWVGRWLAEWVGRWL 272