DK950990
Clone id TST38A01NGRL0010_D03
Library
Length 671
Definition Adiantum capillus-veneris mRNA. clone: TST38A01NGRL0010_D03. 5' end sequence.
Accession
Tissue type prothallia
Developmental stage gametophyte
Contig ID
Sequence
GTTGTTAGATGCGCCATGTAGTGGAACTGGGGTAGTTTCAAAGGACCAATCTGTGAAGAT
GTCTAAGAGTGATGCAGATTTTCAGAATAGCGCTATATTACAAAAGGAGCTGATTCTTGC
TGCCATTGATATGGTTGATGCTTTCTCGAAAACAGGTGGCTATATTGTTTATTCAACATG
CTCAATTACTGTAGCTGAGAACGAGGCAGTTATTGATTATGCTGTCAAAAAACGAGATGT
AAAAGTGGTACCGTGCGGACTTGATTTTGGGCGACCAGGGTTTATTCGATTTAGAGAGAA
ACGGTTTCATACTTCTTTAACTGAAACCCGTCGCTTTTATCCTCATGTACACAATCTGGA
TGGCTTTTTTGTTCCCCCCCTGAAAAAGCTGAGTAACAGCAAGGCAAAAGGAAGTGAGAA
GATGAATACCTCTGAGGAGCCTGATTCTGTGGTGACAAGTGAACCCGATCCTATTGAAAA
CCCTGATGCAGCTAATGAATCCATTGCTGAAGATACTGCACATGAGACACAAGACACAAC
AGGCAGTTCATCCAAAAGCCGGAGTATCAAAAGAAAGAAGCTTTTGAGAAGAGACTTGAA
AAACTTGCCCTCTAAAGATGAGATATCCAAGTTGAGGGAGGACAAAAGAGAAGCTTTTCG
AACTAAGGCAA
■■Homology search results ■■ -
sp_hit_id P46087
Definition sp|P46087|NOP2_HUMAN Putative ribosomal RNA methyltransferase NOP2 OS=Homo sapiens
Align length 150
Score (bit) 192.0
E-value 1.0e-48
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= DK950990|Adiantum capillus-veneris mRNA, clone:
TST38A01NGRL0010_D03, 5'
(671 letters)

Database: uniprot_sprot.fasta
412,525 sequences; 148,809,765 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

sp|P46087|NOP2_HUMAN Putative ribosomal RNA methyltransferase NO... 192 1e-48
sp|Q922K7|NOP2_MOUSE Putative ribosomal RNA methyltransferase NO... 192 1e-48
sp|O94268|NOP2_SCHPO Putative ribosomal RNA methyltransferase no... 187 4e-47
sp|P40991|NOP2_YEAST Putative ribosomal RNA methyltransferase No... 155 1e-37
sp|Q83RJ3|RSMF_SHIFL Putative ribosomal RNA small subunit methyl... 67 9e-11
sp|Q0T529|RSMF_SHIF8 Ribosomal RNA small subunit methyltransfera... 67 9e-11
sp|A8GKG7|RSMB_SERP5 Ribosomal RNA small subunit methyltransfera... 66 2e-10
sp|Q3Z2H4|RSMF_SHISS Ribosomal RNA small subunit methyltransfera... 65 2e-10
sp|Q321Y0|RSMF_SHIBS Ribosomal RNA small subunit methyltransfera... 65 2e-10
sp|P76273|RSMF_ECOLI Ribosomal RNA small subunit methyltransfera... 65 2e-10
sp|Q32F19|RSMF_SHIDS Ribosomal RNA small subunit methyltransfera... 65 3e-10
sp|Q0TGZ7|RSMF_ECOL5 Ribosomal RNA small subunit methyltransfera... 65 3e-10
sp|Q8XCL9|RSMF_ECO57 Ribosomal RNA small subunit methyltransfera... 65 4e-10
sp|Q6D000|RSMB_ERWCT Ribosomal RNA small subunit methyltransfera... 65 4e-10
sp|Q6LQU5|RSMF_PHOPR Ribosomal RNA small subunit methyltransfera... 64 6e-10
sp|Q1RAV2|RSMF_ECOUT Ribosomal RNA small subunit methyltransfera... 64 9e-10
sp|Q8FGS9|RSMF_ECOL6 Ribosomal RNA small subunit methyltransfera... 64 9e-10
sp|A1AC00|RSMF_ECOK1 Ribosomal RNA small subunit methyltransfera... 64 9e-10
sp|Q60343|Y026_METJA Putative methyltransferase MJ0026 OS=Methan... 63 1e-09
sp|Q3IHA0|RSMF_PSEHT Ribosomal RNA small subunit methyltransfera... 63 2e-09
sp|Q8Z662|RSMF_SALTI Ribosomal RNA small subunit methyltransfera... 62 3e-09
sp|Q87PA5|RSMF_VIBPA Ribosomal RNA small subunit methyltransfera... 61 5e-09
sp|Q8ZNZ2|RSMF_SALTY Ribosomal RNA small subunit methyltransfera... 61 5e-09
sp|Q57NF9|RSMF_SALCH Ribosomal RNA small subunit methyltransfera... 61 5e-09
sp|P72943|RSMB_SYNY3 Ribosomal RNA small subunit methyltransfera... 61 5e-09
sp|P38205|NCL1_YEAST tRNA (cytosine-5-)-methyltransferase NCL1 O... 61 6e-09
sp|A1SWV0|RSMF_PSYIN Ribosomal RNA small subunit methyltransfera... 60 1e-08
sp|Q5PHN5|RSMF_SALPA Ribosomal RNA small subunit methyltransfera... 60 1e-08
sp|Q7VKC4|RSMB_HAEDU Ribosomal RNA small subunit methyltransfera... 59 2e-08
sp|Q6D4C8|RSMF_ERWCT Ribosomal RNA small subunit methyltransfera... 59 2e-08

>sp|P46087|NOP2_HUMAN Putative ribosomal RNA methyltransferase NOP2
OS=Homo sapiens GN=NOP2 PE=1 SV=2
Length = 812

Score = 192 bits (489), Expect = 1e-48
Identities = 93/150 (62%), Positives = 114/150 (76%)
Frame = +2

Query: 2 LLDAPCSGTGVVSKDQSVKMSKSDADFQNSAILQKELILAAIDMVDAFSKTGGYIVYSTC 181
LLDAPCSGTGV+SKD +VK +K + D A LQKEL+L+AID V+A SKTGGY+VY TC
Sbjct: 458 LLDAPCSGTGVISKDPAVKTNKDEKDILRCAHLQKELLLSAIDSVNATSKTGGYLVYCTC 517

Query: 182 SITVAENEAVIDYAVKKRDVKVVPCGLDFGRPGFIRFREKRFHTSLTETRRFYPHVHNLD 361
SITV ENE V+DYA+KKR+V++VP GLDFG+ GF RFRE+RFH SL TRRFYPH HN+D
Sbjct: 518 SITVEENEWVVDYALKKRNVRLVPTGLDFGQEGFTRFRERRFHPSLRSTRRFYPHTHNMD 577

Query: 362 GFFVPPLKKLSNSKAKGSEKMNTSEEPDSV 451
GFF+ KK SNS + + + P +V
Sbjct: 578 GFFIAKFKKFSNSIPQSQTGNSETATPTNV 607


>sp|Q922K7|NOP2_MOUSE Putative ribosomal RNA methyltransferase NOP2
OS=Mus musculus GN=Nop2 PE=2 SV=1
Length = 793

Score = 192 bits (488), Expect = 1e-48
Identities = 94/151 (62%), Positives = 115/151 (76%), Gaps = 3/151 (1%)
Frame = +2

Query: 2 LLDAPCSGTGVVSKDQSVKMSKSDADFQNSAILQKELILAAIDMVDAFSKTGGYIVYSTC 181
LLDAPCSGTGV+SKD +VK +K + D Q A LQKEL+L+AID V+A SKTGGY+VY TC
Sbjct: 443 LLDAPCSGTGVISKDPAVKTNKDEKDIQRCAHLQKELLLSAIDSVNAASKTGGYLVYCTC 502

Query: 182 SITVAENEAVIDYAVKKRDVKVVPCGLDFGRPGFIRFREKRFHTSLTETRRFYPHVHNLD 361
SITV ENE V+DYA+KKR+V++VP GLDFG+ GF RF+ +RFH +L TRRFYPH HN+D
Sbjct: 503 SITVEENEWVVDYALKKRNVRLVPTGLDFGQEGFTRFQARRFHPTLRSTRRFYPHTHNMD 562

Query: 362 GFFVPPLKKLSNSKAK---GSEKMNTSEEPD 445
GFF+ KK SNS + G+ T EPD
Sbjct: 563 GFFIAKFKKFSNSIPQPHAGNSAAATPTEPD 593


>sp|O94268|NOP2_SCHPO Putative ribosomal RNA methyltransferase nop2
OS=Schizosaccharomyces pombe GN=SPBP8B7.20c PE=1 SV=1
Length = 608

Score = 187 bits (475), Expect = 4e-47
Identities = 103/187 (55%), Positives = 131/187 (70%), Gaps = 6/187 (3%)
Frame = +2

Query: 2 LLDAPCSGTGVVSKDQSVKMSKSDADFQNSAILQKELILAAIDMVDAFSKTGGYIVYSTC 181
LLDAPCSGTGV+ KDQSVK +KS+ DF + LQ++L+L+AID V+A SKTGG+IVYSTC
Sbjct: 414 LLDAPCSGTGVIYKDQSVKTNKSERDFDTLSHLQRQLLLSAIDSVNADSKTGGFIVYSTC 473

Query: 182 SITVAENEAVIDYAVKKR-DVKVVPCGLDFGRPGFIRFREKRFHTSLTETRRFYPHVHNL 358
SITV E+EAVI YA+KKR +VK+V GL+FGR GF RFREKRFH SL TRR+YPHVHN+
Sbjct: 474 SITVDEDEAVIQYALKKRPNVKLVSTGLEFGREGFTRFREKRFHPSLKLTRRYYPHVHNI 533

Query: 359 DGFFVPPLKKLSNS--KAKGSEKMNTSEEPDSVV---TSEPDPIENPDAANESIAEDTAH 523
DGFFV LKK+S+ ++ M D + ++E D I D A++ I E
Sbjct: 534 DGFFVAKLKKISDKIPTVNVADDMKDGTNNDVEIEKNSTEIDNITFNDEADKEIIEQNRR 593

Query: 524 ETQDTTG 544
+ + G
Sbjct: 594 KWLKSKG 600


>sp|P40991|NOP2_YEAST Putative ribosomal RNA methyltransferase Nop2
OS=Saccharomyces cerevisiae GN=NOP2 PE=1 SV=1
Length = 618

Score = 155 bits (393), Expect = 1e-37
Identities = 83/172 (48%), Positives = 113/172 (65%), Gaps = 1/172 (0%)
Frame = +2

Query: 2 LLDAPCSGTGVVSKDQSVKMSKSDADFQNSAILQKELILAAIDMVDAFSKTGGYIVYSTC 181
LLDAPCSGTGV+ KDQSVK+S+++ DF LQK+L+L+AID VD SK GG IVYSTC
Sbjct: 419 LLDAPCSGTGVIGKDQSVKVSRTEKDFIQIPHLQKQLLLSAIDSVDCNSKHGGVIVYSTC 478

Query: 182 SITVAENEAVIDYAVKKR-DVKVVPCGLDFGRPGFIRFREKRFHTSLTETRRFYPHVHNL 358
S+ V E+EAVIDYA++KR +VK+V GL G+ F +R K+FH S+ RR+YPH +N+
Sbjct: 479 SVAVEEDEAVIDYALRKRPNVKLVDTGLAIGKEAFTSYRGKKFHPSVKLARRYYPHTYNV 538

Query: 359 DGFFVPPLKKLSNSKAKGSEKMNTSEEPDSVVTSEPDPIENPDAANESIAED 514
DGFFV +K+ S ++ +E + + + I + D A ED
Sbjct: 539 DGFFVAKFQKIGPSSFDDNQASAKEKETAARKEALEEGIIHSDFATFEDEED 590


>sp|Q83RJ3|RSMF_SHIFL Putative ribosomal RNA small subunit
methyltransferase F OS=Shigella flexneri GN=rsmF PE=5
SV=2
Length = 479

Score = 67.0 bits (162), Expect = 9e-11
Identities = 54/155 (34%), Positives = 76/155 (49%), Gaps = 4/155 (2%)
Frame = +2

Query: 2 LLDAPCSGTGVVSKDQSVKMSKSDADFQNSAILQKELILAAIDMVDAFSKTGGYIVYSTC 181
LLDAPCSG GVV KD + S Q A Q+ELI +A + + GG +VYSTC
Sbjct: 192 LLDAPCSGEGVVRKDPDALKNWSPESNQEIAATQRELIDSAFHAL----RPGGTLVYSTC 247

Query: 182 SITVAENEAVIDYAVK--KRDVKVVPCGLDFGRPGFIRFREKRFHTSLTET--RRFYPHV 349
++ ENEAV + + +V+ +P G F PG + +LTE +P +
Sbjct: 248 TLNREENEAVCRWLKETYPDEVEFLPLGDLF--PG--------ANKALTEEGFLHVFPQI 297

Query: 350 HNLDGFFVPPLKKLSNSKAKGSEKMNTSEEPDSVV 454
++ +GFFV L+K A + K P S V
Sbjct: 298 YDCEGFFVARLRKTQAIPALPAPKYKVGNFPFSPV 332


>sp|Q0T529|RSMF_SHIF8 Ribosomal RNA small subunit methyltransferase
F OS=Shigella flexneri serotype 5b (strain 8401) GN=rsmF
PE=3 SV=2
Length = 479

Score = 67.0 bits (162), Expect = 9e-11
Identities = 54/155 (34%), Positives = 76/155 (49%), Gaps = 4/155 (2%)
Frame = +2

Query: 2 LLDAPCSGTGVVSKDQSVKMSKSDADFQNSAILQKELILAAIDMVDAFSKTGGYIVYSTC 181
LLDAPCSG GVV KD + S Q A Q+ELI +A + + GG +VYSTC
Sbjct: 192 LLDAPCSGEGVVRKDPDALKNWSPESNQEIAATQRELIDSAFHAL----RPGGTLVYSTC 247

Query: 182 SITVAENEAVIDYAVK--KRDVKVVPCGLDFGRPGFIRFREKRFHTSLTET--RRFYPHV 349
++ ENEAV + + +V+ +P G F PG + +LTE +P +
Sbjct: 248 TLNREENEAVCRWLKETYPDEVEFLPLGDLF--PG--------ANKALTEEGFLHVFPQI 297

Query: 350 HNLDGFFVPPLKKLSNSKAKGSEKMNTSEEPDSVV 454
++ +GFFV L+K A + K P S V
Sbjct: 298 YDCEGFFVARLRKTQAIPALPAPKYKVGNFPFSPV 332


>sp|A8GKG7|RSMB_SERP5 Ribosomal RNA small subunit methyltransferase
B OS=Serratia proteamaculans (strain 568) GN=rsmB PE=3
SV=1
Length = 429

Score = 65.9 bits (159), Expect = 2e-10
Identities = 46/131 (35%), Positives = 66/131 (50%), Gaps = 1/131 (0%)
Frame = +2

Query: 2 LLDAPCSGTGVVSKDQSVKMSKSDADFQNSAILQKELILAAIDMVDAFSKTGGYIVYSTC 181
LLDAPCS TGV+ + +K + D+D A LQ E+ I+ + K+GG +VY+TC
Sbjct: 320 LLDAPCSATGVIRRHPDIKWLRRDSDIAELAALQAEI----IEAIWPHLKSGGVMVYATC 375

Query: 182 SITVAEN-EAVIDYAVKKRDVKVVPCGLDFGRPGFIRFREKRFHTSLTETRRFYPHVHNL 358
SI AEN E V + + D ++V G + +PG R+ PH +
Sbjct: 376 SILPAENAEQVSAFLQRHADARLVETG-NQQQPG----------------RQNLPHPEDG 418

Query: 359 DGFFVPPLKKL 391
DGFF L K+
Sbjct: 419 DGFFYAKLIKM 429


>sp|Q3Z2H4|RSMF_SHISS Ribosomal RNA small subunit methyltransferase
F OS=Shigella sonnei (strain Ss046) GN=rsmF PE=3 SV=2
Length = 479

Score = 65.5 bits (158), Expect = 2e-10
Identities = 54/155 (34%), Positives = 75/155 (48%), Gaps = 4/155 (2%)
Frame = +2

Query: 2 LLDAPCSGTGVVSKDQSVKMSKSDADFQNSAILQKELILAAIDMVDAFSKTGGYIVYSTC 181
LLDAPCSG GVV KD + S Q A Q+ELI +A + + GG +VYSTC
Sbjct: 192 LLDAPCSGEGVVRKDPDALKNWSPESNQEIAATQRELIDSAFHAL----RPGGTLVYSTC 247

Query: 182 SITVAENEAVIDYAVKKRD--VKVVPCGLDFGRPGFIRFREKRFHTSLTET--RRFYPHV 349
++ ENEAV + + V+ +P G F PG + +LTE +P +
Sbjct: 248 TLNQEENEAVCLWLKETYPDAVEFLPLGDLF--PG--------ANKALTEEGFLHVFPQI 297

Query: 350 HNLDGFFVPPLKKLSNSKAKGSEKMNTSEEPDSVV 454
++ +GFFV L+K A + K P S V
Sbjct: 298 YDCEGFFVARLRKTQAIPALPAPKYKVGNFPFSPV 332


>sp|Q321Y0|RSMF_SHIBS Ribosomal RNA small subunit methyltransferase
F OS=Shigella boydii serotype 4 (strain Sb227) GN=rsmF
PE=3 SV=2
Length = 479

Score = 65.5 bits (158), Expect = 2e-10
Identities = 54/155 (34%), Positives = 75/155 (48%), Gaps = 4/155 (2%)
Frame = +2

Query: 2 LLDAPCSGTGVVSKDQSVKMSKSDADFQNSAILQKELILAAIDMVDAFSKTGGYIVYSTC 181
LLDAPCSG GVV KD + S Q A Q+ELI +A + + GG +VYSTC
Sbjct: 192 LLDAPCSGEGVVRKDPDALKNWSPESNQEIAATQRELIDSAFHAL----RPGGTLVYSTC 247

Query: 182 SITVAENEAVIDYAVKKRD--VKVVPCGLDFGRPGFIRFREKRFHTSLTET--RRFYPHV 349
++ ENEAV + + V+ +P G F PG + +LTE +P +
Sbjct: 248 TLNQEENEAVCLWLKETYPDAVEFLPLGDLF--PG--------ANKALTEEGFLHVFPQI 297

Query: 350 HNLDGFFVPPLKKLSNSKAKGSEKMNTSEEPDSVV 454
++ +GFFV L+K A + K P S V
Sbjct: 298 YDCEGFFVARLRKTQAIPALPAPKYKVGNFPFSPV 332


>sp|P76273|RSMF_ECOLI Ribosomal RNA small subunit methyltransferase
F OS=Escherichia coli (strain K12) GN=rsmF PE=1 SV=2
Length = 479

Score = 65.5 bits (158), Expect = 2e-10
Identities = 54/155 (34%), Positives = 75/155 (48%), Gaps = 4/155 (2%)
Frame = +2

Query: 2 LLDAPCSGTGVVSKDQSVKMSKSDADFQNSAILQKELILAAIDMVDAFSKTGGYIVYSTC 181
LLDAPCSG GVV KD + S Q A Q+ELI +A + + GG +VYSTC
Sbjct: 192 LLDAPCSGEGVVRKDPDALKNWSPESNQEIAATQRELIDSAFHAL----RPGGTLVYSTC 247

Query: 182 SITVAENEAVIDYAVKKRD--VKVVPCGLDFGRPGFIRFREKRFHTSLTET--RRFYPHV 349
++ ENEAV + + V+ +P G F PG + +LTE +P +
Sbjct: 248 TLNQEENEAVCLWLKETYPDAVEFLPLGDLF--PG--------ANKALTEEGFLHVFPQI 297

Query: 350 HNLDGFFVPPLKKLSNSKAKGSEKMNTSEEPDSVV 454
++ +GFFV L+K A + K P S V
Sbjct: 298 YDCEGFFVARLRKTQAIPALPAPKYKVGNFPFSPV 332


tr_hit_id B8LRU4
Definition tr|B8LRU4|B8LRU4_PICSI Putative uncharacterized protein OS=Picea sitchensis
Align length 220
Score (bit) 223.0
E-value 1.0e-56
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= DK950990|Adiantum capillus-veneris mRNA, clone:
TST38A01NGRL0010_D03, 5'
(671 letters)

Database: uniprot_trembl.fasta
7,341,751 sequences; 2,391,615,440 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

tr|B8LRU4|B8LRU4_PICSI Putative uncharacterized protein OS=Picea... 223 1e-56
tr|A5AR63|A5AR63_VITVI Putative uncharacterized protein OS=Vitis... 223 1e-56
tr|A7Q9B4|A7Q9B4_VITVI Chromosome chr19 scaffold_66, whole genom... 219 1e-55
tr|Q8VYM6|Q8VYM6_ARATH Putative uncharacterized protein At4g2660... 215 2e-54
tr|Q6Z5K9|Q6Z5K9_ORYSJ Putative proliferating cell nuclear prote... 214 4e-54
tr|Q69MP1|Q69MP1_ORYSJ Os09g0551300 protein OS=Oryza sativa subs... 211 3e-53
tr|B8BEE6|B8BEE6_ORYSI Putative uncharacterized protein OS=Oryza... 211 3e-53
tr|B4F9Q9|B4F9Q9_MAIZE Putative uncharacterized protein OS=Zea m... 211 3e-53
tr|A3C199|A3C199_ORYSJ Putative uncharacterized protein OS=Oryza... 211 3e-53
tr|Q9FG73|Q9FG73_ARATH Nucleolar protein-like OS=Arabidopsis tha... 210 6e-53
tr|B8AHP5|B8AHP5_ORYSI Putative uncharacterized protein OS=Oryza... 209 1e-52
tr|Q0DXZ5|Q0DXZ5_ORYSJ Os02g0724600 protein OS=Oryza sativa subs... 202 2e-50
tr|A3AAW6|A3AAW6_ORYSJ Putative uncharacterized protein OS=Oryza... 202 2e-50
tr|A9THC4|A9THC4_PHYPA Predicted protein OS=Physcomitrella paten... 200 8e-50
tr|Q08AV5|Q08AV5_XENLA LOC100036868 protein (Fragment) OS=Xenopu... 197 4e-49
tr|A1L2J8|A1L2J8_XENLA LOC100036868 protein (Fragment) OS=Xenopu... 197 4e-49
tr|A4IGA8|A4IGA8_DANRE Im:6893299 protein (Fragment) OS=Danio re... 197 7e-49
tr|Q5CZR4|Q5CZR4_DANRE Im:6893299 protein (Fragment) OS=Danio re... 194 4e-48
tr|Q3KQS4|Q3KQS4_HUMAN NOL1 protein OS=Homo sapiens GN=NOL1 PE=2... 192 1e-47
tr|A8MQ38|A8MQ38_HUMAN Putative uncharacterized protein NOP2 OS=... 192 1e-47
tr|Q99KC3|Q99KC3_MOUSE Nol1 protein OS=Mus musculus GN=Nop2 PE=2... 192 2e-47
tr|B6L8Q2|B6L8Q2_BRAFL Putative uncharacterized protein OS=Branc... 192 2e-47
tr|Q05BA7|Q05BA7_HUMAN NOL1 protein OS=Homo sapiens GN=NOL1 PE=2... 192 2e-47
tr|A8HVL4|A8HVL4_CHLRE Predicted protein (Fragment) OS=Chlamydom... 191 3e-47
tr|B3MEN0|B3MEN0_DROAN GF12515 OS=Drosophila ananassae GN=GF1251... 191 4e-47
tr|A6QQS8|A6QQS8_BOVIN NOL1 protein OS=Bos taurus GN=NOL1 PE=2 SV=1 191 5e-47
tr|A8PL10|A8PL10_BRUMA NOL1/NOP2/sun family putative RNA methyla... 191 5e-47
tr|B4MDU5|B4MDU5_DROVI GJ18081 OS=Drosophila virilis GN=GJ18081 ... 189 1e-46
tr|A9UX73|A9UX73_MONBE Predicted protein OS=Monosiga brevicollis... 189 2e-46
tr|Q9LDL2|Q9LDL2_ARATH Putative uncharacterized protein AT4g2660... 187 7e-46

>tr|B8LRU4|B8LRU4_PICSI Putative uncharacterized protein OS=Picea
sitchensis PE=2 SV=1
Length = 641

Score = 223 bits (567), Expect = 1e-56
Identities = 119/220 (54%), Positives = 148/220 (67%)
Frame = +2

Query: 2 LLDAPCSGTGVVSKDQSVKMSKSDADFQNSAILQKELILAAIDMVDAFSKTGGYIVYSTC 181
LLDAPCSGTG++ KD++VK KS D A LQK+L+LAAIDMVDA SK+GGY+VYSTC
Sbjct: 381 LLDAPCSGTGIIWKDENVKSKKSAEDIMKCAFLQKQLLLAAIDMVDAGSKSGGYLVYSTC 440

Query: 182 SITVAENEAVIDYAVKKRDVKVVPCGLDFGRPGFIRFREKRFHTSLTETRRFYPHVHNLD 361
SITVAENEAV++YA+ KRDVKVVPCGLDFG+ GF+RFRE RFH SL +TRRFYPHVHN+D
Sbjct: 441 SITVAENEAVVNYALSKRDVKVVPCGLDFGQHGFVRFREHRFHPSLEKTRRFYPHVHNMD 500

Query: 362 GFFVPPLKKLSNSKAKGSEKMNTSEEPDSVVTSEPDPIENPDAANESIAEDTAHETQDTT 541
GFFV LKK+SN+K S+ E ++V ++ I + + + +E ET
Sbjct: 501 GFFVAKLKKMSNTKPI-SKATEAGENIPNIVENKDGEINDGNIVTDQ-SERLYTETALIN 558

Query: 542 GXXXXXXXXXXXXXXXXXXXXXPSKDEISKLREDKREAFR 661
PSK+EISK RE+KR+A R
Sbjct: 559 ESSETKMIKANKHDKRQGKKKLPSKEEISKSREEKRKALR 598


>tr|A5AR63|A5AR63_VITVI Putative uncharacterized protein OS=Vitis
vinifera GN=VITISV_037193 PE=4 SV=1
Length = 741

Score = 223 bits (567), Expect = 1e-56
Identities = 117/172 (68%), Positives = 131/172 (76%)
Frame = +2

Query: 2 LLDAPCSGTGVVSKDQSVKMSKSDADFQNSAILQKELILAAIDMVDAFSKTGGYIVYSTC 181
LLDAPCSGTGV+SKD+SVK SKS D Q A LQK+LILAAIDMVDA SK+GGYIVYSTC
Sbjct: 390 LLDAPCSGTGVISKDESVKTSKSLEDIQKCAHLQKQLILAAIDMVDANSKSGGYIVYSTC 449

Query: 182 SITVAENEAVIDYAVKKRDVKVVPCGLDFGRPGFIRFREKRFHTSLTETRRFYPHVHNLD 361
SI + ENEAVIDYA+KKR+VK+VPCGLDFGRPGF RFRE RFH SL +TRRFYPHVHN+D
Sbjct: 450 SIMIPENEAVIDYALKKRNVKLVPCGLDFGRPGFTRFREHRFHQSLEKTRRFYPHVHNMD 509

Query: 362 GFFVPPLKKLSNSKAKGSEKMNTSEEPDSVVTSEPDPIENPDAANESIAEDT 517
GFFV LKK+SNSK T EP V E P EN + ++ E T
Sbjct: 510 GFFVAKLKKMSNSKPN-----PTPSEPSEV--EEQAPEENDSDSELNMGEKT 554


>tr|A7Q9B4|A7Q9B4_VITVI Chromosome chr19 scaffold_66, whole genome
shotgun sequence OS=Vitis vinifera GN=GSVIVT00033408001
PE=4 SV=1
Length = 430

Score = 219 bits (558), Expect = 1e-55
Identities = 122/222 (54%), Positives = 138/222 (62%)
Frame = +2

Query: 2 LLDAPCSGTGVVSKDQSVKMSKSDADFQNSAILQKELILAAIDMVDAFSKTGGYIVYSTC 181
LLDAPCSGTGV+SKD+SVK SKS D Q A LQK+LILAAIDMVDA SK+GGYIVYSTC
Sbjct: 254 LLDAPCSGTGVISKDESVKTSKSLEDIQKCAHLQKQLILAAIDMVDANSKSGGYIVYSTC 313

Query: 182 SITVAENEAVIDYAVKKRDVKVVPCGLDFGRPGFIRFREKRFHTSLTETRRFYPHVHNLD 361
SI + ENEAVIDYA+KKR+VK+VPCGLDFGRPGF RFRE RFH SL +TRRFYPHVHN+D
Sbjct: 314 SIMIPENEAVIDYALKKRNVKLVPCGLDFGRPGFTRFREHRFHQSLEKTRRFYPHVHNMD 373

Query: 362 GFFVPPLKKLSNSKAKGSEKMNTSEEPDSVVTSEPDPIENPDAANESIAEDTAHETQDTT 541
GFFV LKK+SNSK P P E +
Sbjct: 374 GFFVAKLKKMSNSK------------------PNPTPSEPSERKKRKF------------ 403

Query: 542 GXXXXXXXXXXXXXXXXXXXXXPSKDEISKLREDKREAFRTK 667
PS++EISK RE+KR+ R K
Sbjct: 404 ----------------------PSREEISKAREEKRKTMREK 423


>tr|Q8VYM6|Q8VYM6_ARATH Putative uncharacterized protein At4g26600
OS=Arabidopsis thaliana GN=At4g26600 PE=2 SV=1
Length = 671

Score = 215 bits (548), Expect = 2e-54
Identities = 118/246 (47%), Positives = 151/246 (61%), Gaps = 23/246 (9%)
Frame = +2

Query: 2 LLDAPCSGTGVVSKDQSVKMSKSDADFQNSAILQKELILAAIDMVDAFSKTGGYIVYSTC 181
LLDAPCSGTGV+SKD+SVK SKS D + A LQK+LIL AID+VDA SKTGGYIVYSTC
Sbjct: 418 LLDAPCSGTGVISKDESVKTSKSADDIKKFAHLQKQLILGAIDLVDANSKTGGYIVYSTC 477

Query: 182 SITVAENEAVIDYAVKKRDVKVVPCGLDFGRPGFIRFREKRFHTSLTETRRFYPHVHNLD 361
S+ + ENEAVIDYA+K RDVK+VPCGLDFGRPGF FRE RFH SL +TRRFYPHVHN+D
Sbjct: 478 SVMIPENEAVIDYALKNRDVKLVPCGLDFGRPGFSSFREHRFHPSLEKTRRFYPHVHNMD 537

Query: 362 GFFVPPLKKLSNS--------------KAKGSEKMNTSEEPDSVVTSEPDPIENPDAANE 499
GFFV LKK+SN+ +A+ S + E+ +++ E P+ + E
Sbjct: 538 GFFVAKLKKMSNAMQPSGNDEPAVTMEQAQVSSSDDDDEKAEAIEELEKPPVASGQPKRE 597

Query: 500 SIAEDTAHETQDTTGXXXXXXXXXXXXXXXXXXXXXPS---------KDEISKLREDKRE 652
S ++ ++ ++ P K+EI++ RE+KR+
Sbjct: 598 SNTKEDTNKRKNPRSKEIHKGKRNKNTKTESGNVEEPRKQKKKRSQWKNEIAQAREEKRK 657

Query: 653 AFRTKA 670
R A
Sbjct: 658 TMRENA 663


>tr|Q6Z5K9|Q6Z5K9_ORYSJ Putative proliferating cell nuclear protein
P120 OS=Oryza sativa subsp. japonica GN=P0685G12.31 PE=4
SV=1
Length = 682

Score = 214 bits (545), Expect = 4e-54
Identities = 105/162 (64%), Positives = 126/162 (77%), Gaps = 1/162 (0%)
Frame = +2

Query: 2 LLDAPCSGTGVVSKDQSVKMSKSDADFQNSAILQKELILAAIDMVDAFSKTGGYIVYSTC 181
LLDAPC+GTG + KD +K SK D ++ A +QK+L+LAAID+VDA SKTGGYIVYSTC
Sbjct: 412 LLDAPCTGTGTIWKDPQIKTSKGIEDIRDCAFVQKQLLLAAIDLVDANSKTGGYIVYSTC 471

Query: 182 SITVAENEAVIDYAVKKRDVKVVPCGLDFGRPGFIRFREKRFHTSLTETRRFYPHVHNLD 361
S+ + ENEAV+DYA+KKR+VK+VPCGLDFGRPGFIRFRE RFHTSL +TRRFYPHV+N+D
Sbjct: 472 SLMIPENEAVVDYALKKRNVKLVPCGLDFGRPGFIRFREHRFHTSLDKTRRFYPHVNNMD 531

Query: 362 GFFVPPLKKLSNSKAKGSEKMNTSEEP-DSVVTSEPDPIENP 484
GFFV LKKLSN+ SE N EE + S DP + P
Sbjct: 532 GFFVAKLKKLSNTIPVASESSNVPEEAIEKADPSSDDPQKQP 573


>tr|Q69MP1|Q69MP1_ORYSJ Os09g0551300 protein OS=Oryza sativa subsp.
japonica GN=P0489D11.25 PE=4 SV=1
Length = 699

Score = 211 bits (537), Expect = 3e-53
Identities = 106/180 (58%), Positives = 129/180 (71%)
Frame = +2

Query: 2 LLDAPCSGTGVVSKDQSVKMSKSDADFQNSAILQKELILAAIDMVDAFSKTGGYIVYSTC 181
LLDAPC+GTG + KD +K SK D ++ A +QK+L+LAAID+VDA SKTGGYIVYSTC
Sbjct: 417 LLDAPCTGTGTIWKDPQIKTSKGIEDIRDCAFVQKQLLLAAIDLVDANSKTGGYIVYSTC 476

Query: 182 SITVAENEAVIDYAVKKRDVKVVPCGLDFGRPGFIRFREKRFHTSLTETRRFYPHVHNLD 361
S+ + ENEAVIDYA+KKR+VK+VPCGLDFGRPGFIRFRE RFHTSL +TRRFYPHV+N+D
Sbjct: 477 SLMIPENEAVIDYALKKRNVKLVPCGLDFGRPGFIRFREHRFHTSLDKTRRFYPHVNNMD 536

Query: 362 GFFVPPLKKLSNSKAKGSEKMNTSEEPDSVVTSEPDPIENPDAANESIAEDTAHETQDTT 541
GFFV LKKLSN+ SE EE D ++ I +D ++TT
Sbjct: 537 GFFVAKLKKLSNTIPVTSESSKVPEEAIEKTDPSSDDLQE-QPIQSKIHKDVKKMNEETT 595


>tr|B8BEE6|B8BEE6_ORYSI Putative uncharacterized protein OS=Oryza
sativa subsp. indica GN=OsI_32305 PE=4 SV=1
Length = 699

Score = 211 bits (537), Expect = 3e-53
Identities = 106/180 (58%), Positives = 129/180 (71%)
Frame = +2

Query: 2 LLDAPCSGTGVVSKDQSVKMSKSDADFQNSAILQKELILAAIDMVDAFSKTGGYIVYSTC 181
LLDAPC+GTG + KD +K SK D ++ A +QK+L+LAAID+VDA SKTGGYIVYSTC
Sbjct: 417 LLDAPCTGTGTIWKDPQIKTSKGIEDIRDCAFVQKQLLLAAIDLVDANSKTGGYIVYSTC 476

Query: 182 SITVAENEAVIDYAVKKRDVKVVPCGLDFGRPGFIRFREKRFHTSLTETRRFYPHVHNLD 361
S+ + ENEAVIDYA+KKR+VK+VPCGLDFGRPGFIRFRE RFHTSL +TRRFYPHV+N+D
Sbjct: 477 SLMIPENEAVIDYALKKRNVKLVPCGLDFGRPGFIRFREHRFHTSLDKTRRFYPHVNNMD 536

Query: 362 GFFVPPLKKLSNSKAKGSEKMNTSEEPDSVVTSEPDPIENPDAANESIAEDTAHETQDTT 541
GFFV LKKLSN+ SE EE D ++ I +D ++TT
Sbjct: 537 GFFVAKLKKLSNTIPVTSESSKVPEEAIEKTDPSSDDLQE-QPIQSKIHKDVKKMNEETT 595


>tr|B4F9Q9|B4F9Q9_MAIZE Putative uncharacterized protein OS=Zea mays
PE=2 SV=1
Length = 718

Score = 211 bits (537), Expect = 3e-53
Identities = 105/164 (64%), Positives = 128/164 (78%), Gaps = 8/164 (4%)
Frame = +2

Query: 2 LLDAPCSGTGVVSKDQSVKMSKSDADFQNSAILQKELILAAIDMVDAFSKTGGYIVYSTC 181
LLDAPC+GTG + KD +K SK D +N A +QK+L+LAAID+VDA SKTGGYIVYSTC
Sbjct: 418 LLDAPCTGTGTIWKDLQIKTSKDIEDIRNCAFVQKQLLLAAIDLVDANSKTGGYIVYSTC 477

Query: 182 SITVAENEAVIDYAVKKRDVKVVPCGLDFGRPGFIRFREKRFHTSLTETRRFYPHVHNLD 361
SI + ENEAVIDYA+KKR+VK+VPCGLDFGRPGFIR+RE RFHTSL +TRRFYPHV+N+D
Sbjct: 478 SIMIPENEAVIDYALKKRNVKLVPCGLDFGRPGFIRYREHRFHTSLEKTRRFYPHVNNMD 537

Query: 362 GFFVPPLKKLSNSKAKGSEKMNTSE--------EPDSVVTSEPD 469
GFFV LKKLSN+ SE+ SE E + V+++E +
Sbjct: 538 GFFVAKLKKLSNTIPVTSEQPKASEGAAEKADGEDEKVISNEQE 581


>tr|A3C199|A3C199_ORYSJ Putative uncharacterized protein OS=Oryza
sativa subsp. japonica GN=OsJ_029071 PE=4 SV=1
Length = 703

Score = 211 bits (537), Expect = 3e-53
Identities = 106/180 (58%), Positives = 129/180 (71%)
Frame = +2

Query: 2 LLDAPCSGTGVVSKDQSVKMSKSDADFQNSAILQKELILAAIDMVDAFSKTGGYIVYSTC 181
LLDAPC+GTG + KD +K SK D ++ A +QK+L+LAAID+VDA SKTGGYIVYSTC
Sbjct: 432 LLDAPCTGTGTIWKDPQIKTSKGIEDIRDCAFVQKQLLLAAIDLVDANSKTGGYIVYSTC 491

Query: 182 SITVAENEAVIDYAVKKRDVKVVPCGLDFGRPGFIRFREKRFHTSLTETRRFYPHVHNLD 361
S+ + ENEAVIDYA+KKR+VK+VPCGLDFGRPGFIRFRE RFHTSL +TRRFYPHV+N+D
Sbjct: 492 SLMIPENEAVIDYALKKRNVKLVPCGLDFGRPGFIRFREHRFHTSLDKTRRFYPHVNNMD 551

Query: 362 GFFVPPLKKLSNSKAKGSEKMNTSEEPDSVVTSEPDPIENPDAANESIAEDTAHETQDTT 541
GFFV LKKLSN+ SE EE D ++ I +D ++TT
Sbjct: 552 GFFVAKLKKLSNTIPVTSESSKVPEEAIEKTDPSSDDLQE-QPIQSKIHKDVKKMNEETT 610


>tr|Q9FG73|Q9FG73_ARATH Nucleolar protein-like OS=Arabidopsis
thaliana GN=At5g55920 PE=4 SV=1
Length = 682

Score = 210 bits (535), Expect = 6e-53
Identities = 108/172 (62%), Positives = 128/172 (74%)
Frame = +2

Query: 2 LLDAPCSGTGVVSKDQSVKMSKSDADFQNSAILQKELILAAIDMVDAFSKTGGYIVYSTC 181
LLDAPCSGTG++SKD+SVK++K+ + + A LQK+L+LAAIDMVDA SKTGGYIVYSTC
Sbjct: 435 LLDAPCSGTGIISKDESVKITKTMDEIKKFAHLQKQLLLAAIDMVDANSKTGGYIVYSTC 494

Query: 182 SITVAENEAVIDYAVKKRDVKVVPCGLDFGRPGFIRFREKRFHTSLTETRRFYPHVHNLD 361
SI V ENEAVIDYA+KKRDVK+V CGLDFGR GF RFRE RF SL +TRRFYPHVHN+D
Sbjct: 495 SIMVTENEAVIDYALKKRDVKLVTCGLDFGRKGFTRFREHRFQPSLDKTRRFYPHVHNMD 554

Query: 362 GFFVPPLKKLSNSKAKGSEKMNTSEEPDSVVTSEPDPIENPDAANESIAEDT 517
GFFV LKK+SN K E + D+V T E + + D E+T
Sbjct: 555 GFFVAKLKKMSNVKQSSEE-----GDDDAVETVEQAEVSSDDDDEAEAIEET 601