DK950998
Clone id TST38A01NGRL0010_D11
Library
Length 646
Definition Adiantum capillus-veneris mRNA. clone: TST38A01NGRL0010_D11. 5' end sequence.
Accession
Tissue type prothallia
Developmental stage gametophyte
Contig ID -
Sequence
TCAATCAATCCAGTCTGGTTAGCTTATGCCTTTCGAGCTCTGCCTTTGTCGTTCCGAGTC
AATTTATACTAGGAACACTGGGCCTTTTGCCCGATTTGGAATCAATGGGTTGTTGTATGA
GCAAACAGCAGGTGGCGCGCGCAAATAGGGCTGCCAAATGGAAGACGACAGGAATTGTAG
GCCTACGGGACTCCAATCTCAAGACTTTACCAAGCCAAGTGCTGGATCTTGCGAGGAGTG
TTCGCACTCTTGATGTGACACACAACAAACTTGTGGACTTGCCAGTTGAGATTGGTGGGC
TTATCAATCTTCAACGCTTGATGGTTGCAGAAAATCTGTTGCGGCGGTGGCCTTCCTCTC
TCTTTTTTTTACCAGCCCTCACAGTTCTTGCACTGGATGAAAACAAGAAAACGACCTTAC
CAGATGAATTGGGGCTTCTGGTGCGACTTGAAAGGTTTTCGGTCTCTCTCAATTCGTTGT
CTTCGTTGCCATCTGCGATAGGAAGCTTAAGGAATTTGACACTTTTGAACATCAGTCATA
ACAGGCTTAAGCAGCTACCAGAATCATTAGGTAGTTGCTATTCATTGGAAGAGCTTCTCG
CTAATGATAATTTGATCGAGGAACTTCCACATACAGTTTGCAATCT
■■Homology search results ■■ -
sp_hit_id P0C895
Definition sp|P0C895|Y2010_ARATH LRR repeats and ubiquitin-like domain-containing protein At2g30105 OS=Arabidopsis thaliana
Align length 168
Score (bit) 100.0
E-value 6.0e-21
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= DK950998|Adiantum capillus-veneris mRNA, clone:
TST38A01NGRL0010_D11, 5'
(646 letters)

Database: uniprot_sprot.fasta
412,525 sequences; 148,809,765 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

sp|P0C895|Y2010_ARATH LRR repeats and ubiquitin-like domain-cont... 100 6e-21
sp|Q7KRY7|LAP4_DROME Protein lap4 OS=Drosophila melanogaster GN=... 90 9e-18
sp|Q14160|LAP4_HUMAN Protein LAP4 OS=Homo sapiens GN=SCRIB PE=1 ... 89 1e-17
sp|Q80VQ1|LRRC1_MOUSE Leucine-rich repeat-containing protein 1 O... 88 3e-17
sp|Q80U72|LAP4_MOUSE Protein LAP4 OS=Mus musculus GN=Scrib PE=1 ... 87 6e-17
sp|Q6AYI5|SHOC2_RAT Leucine-rich repeat protein SHOC-2 OS=Rattus... 87 1e-16
sp|Q5RAV5|SHOC2_PONAB Leucine-rich repeat protein SHOC-2 OS=Pong... 87 1e-16
sp|O88520|SHOC2_MOUSE Leucine-rich repeat protein SHOC-2 OS=Mus ... 87 1e-16
sp|Q9UQ13|SHOC2_HUMAN Leucine-rich repeat protein SHOC-2 OS=Homo... 87 1e-16
sp|A6QLV3|SHOC2_BOVIN Leucine-rich repeat protein SHOC-2 OS=Bos ... 87 1e-16
sp|Q9BTT6|LRRC1_HUMAN Leucine-rich repeat-containing protein 1 O... 86 1e-16
sp|Q9ERV7|PIDD_MOUSE Leucine-rich repeat and death domain-contai... 83 1e-15
sp|Q5M8G4|LRC40_XENTR Leucine-rich repeat-containing protein 40 ... 83 1e-15
sp|Q6NSJ5|LRC8E_HUMAN Leucine-rich repeat-containing protein 8E ... 81 4e-15
sp|A6H6A4|LRIQ4_MOUSE Leucine-rich repeat and IQ domain-containi... 81 5e-15
sp|O61967|LAP1_CAEEL Protein lap1 OS=Caenorhabditis elegans GN=l... 80 9e-15
sp|P70587|LRRC7_RAT Leucine-rich repeat-containing protein 7 OS=... 79 3e-14
sp|Q80TE7|LRRC7_MOUSE Leucine-rich repeat-containing protein 7 O... 79 3e-14
sp|Q96NW7|LRRC7_HUMAN Leucine-rich repeat-containing protein 7 O... 79 3e-14
sp|Q3KRC6|LRC8E_RAT Leucine-rich repeat-containing protein 8E OS... 79 3e-14
sp|Q66JT1|LRC8E_MOUSE Leucine-rich repeat-containing protein 8E ... 78 4e-14
sp|Q6GPJ5|LRC40_XENLA Leucine-rich repeat-containing protein 40 ... 78 4e-14
sp|Q5ZLN0|LRC40_CHICK Leucine-rich repeat-containing protein 40 ... 78 4e-14
sp|Q7SXW3|LRC40_DANRE Leucine-rich repeat-containing protein 40 ... 77 6e-14
sp|Q9HB75|PIDD_HUMAN Leucine-rich repeat and death domain-contai... 77 1e-13
sp|Q4V8I7|LRC8A_RAT Leucine-rich repeat-containing protein 8A OS... 75 2e-13
sp|Q80WG5|LRC8A_MOUSE Leucine-rich repeat-containing protein 8A ... 75 3e-13
sp|Q8IWT6|LRC8A_HUMAN Leucine-rich repeat-containing protein 8A ... 75 3e-13
sp|A6NIV6|LRIQ4_HUMAN Leucine-rich repeat and IQ domain-containi... 75 4e-13
sp|Q96RT1|LAP2_HUMAN Protein LAP2 OS=Homo sapiens GN=ERBB2IP PE=... 74 5e-13

>sp|P0C895|Y2010_ARATH LRR repeats and ubiquitin-like
domain-containing protein At2g30105 OS=Arabidopsis
thaliana GN=At2g30105 PE=2 SV=1
Length = 374

Score = 100 bits (249), Expect = 6e-21
Identities = 55/168 (32%), Positives = 88/168 (52%), Gaps = 4/168 (2%)
Frame = +3

Query: 144 NRAAKWKTTGIVGLRDSNLKTLPSQVLDLARSVRTLDVTHNKLVDLPVEIGGLINLQRLM 323
NR +WK TG++ L +NLK +P +V D VR LD++ N + ++P +I ++Q+L
Sbjct: 123 NRTDRWKATGVIALAQANLKEIPEEVWDCGSGVRVLDISENFIKEVPAKISSFGSMQKLF 182

Query: 324 VAENLLR----RWPSSLFFLPALTVLALDENKKTTLPDELGLLVRLERFXXXXXXXXXXX 491
+ N L +W + L L +L++ N T LP +G L L +
Sbjct: 183 LQGNGLSDESIQW-EGIASLKRLMLLSISHNNLTVLPSAMGSLTSLRQLDVTNNKLTSLP 241

Query: 492 XAIGSLRNLTLLNISHNRLKQLPESLGSCYSLEELLANDNLIEELPHT 635
+G L L +L ++NR+ LPES+G+C L E+ + N+I ELP T
Sbjct: 242 NELGLLTQLEILKANNNRITSLPESIGNCSFLMEVDLSANIISELPET 289



Score = 50.1 bits (118), Expect = 1e-05
Identities = 42/139 (30%), Positives = 60/139 (43%)
Frame = +3

Query: 153 AKWKTTGIVGLRDSNLKTLPSQVLDLARSVRTLDVTHNKLVDLPVEIGGLINLQRLMVAE 332
A K ++ + +NL LPS + L S+R LDVT+NKL LP E+G L L+ L
Sbjct: 199 ASLKRLMLLSISHNNLTVLPSAMGSLT-SLRQLDVTNNKLTSLPNELGLLTQLEILKANN 257

Query: 333 NLLRRWPSSLFFLPALTVLALDENKKTTLPDELGLLVRLERFXXXXXXXXXXXXAIGSLR 512
N + P S+ L + L N + LP+ LR
Sbjct: 258 NRITSLPESIGNCSFLMEVDLSANIISELPE-----------------------TFTKLR 294

Query: 513 NLTLLNISHNRLKQLPESL 569
NL L +++ LK LP +L
Sbjct: 295 NLKTLELNNTGLKTLPSAL 313


>sp|Q7KRY7|LAP4_DROME Protein lap4 OS=Drosophila melanogaster
GN=scrib PE=1 SV=1
Length = 1851

Score = 90.1 bits (222), Expect = 9e-18
Identities = 52/152 (34%), Positives = 83/152 (54%)
Frame = +3

Query: 183 LRDSNLKTLPSQVLDLARSVRTLDVTHNKLVDLPVEIGGLINLQRLMVAENLLRRWPSSL 362
LR++ LK LP + L + ++ LD+ N++ DLP +G L L L + N L+R P L
Sbjct: 159 LRENLLKHLPETISQLTK-LKRLDLGDNEIEDLPPYLGYLPGLHELWLDHNQLQRLPPEL 217

Query: 363 FFLPALTVLALDENKKTTLPDELGLLVRLERFXXXXXXXXXXXXAIGSLRNLTLLNISHN 542
L LT L + EN+ LP+E+ LV L I L LT+L + N
Sbjct: 218 GLLTKLTYLDVSENRLEELPNEISGLVSLTDLDLAQNLLEALPDGIAKLSRLTILKLDQN 277

Query: 543 RLKQLPESLGSCYSLEELLANDNLIEELPHTV 638
RL++L ++LG+C +++EL+ +N + ELP ++
Sbjct: 278 RLQRLNDTLGNCENMQELILTENFLSELPASI 309



Score = 86.7 bits (213), Expect = 1e-16
Identities = 53/154 (34%), Positives = 80/154 (51%)
Frame = +3

Query: 183 LRDSNLKTLPSQVLDLARSVRTLDVTHNKLVDLPVEIGGLINLQRLMVAENLLRRWPSSL 362
L + L+ LP + L L + LDV+ N+L +LP EI GL++L L +A+NLL P +
Sbjct: 205 LDHNQLQRLPPE-LGLLTKLTYLDVSENRLEELPNEISGLVSLTDLDLAQNLLEALPDGI 263

Query: 363 FFLPALTVLALDENKKTTLPDELGLLVRLERFXXXXXXXXXXXXAIGSLRNLTLLNISHN 542
L LT+L LD+N+ L D LG ++ +IG + L LN+ N
Sbjct: 264 AKLSRLTILKLDQNRLQRLNDTLGNCENMQELILTENFLSELPASIGQMTKLNNLNVDRN 323

Query: 543 RLKQLPESLGSCYSLEELLANDNLIEELPHTVCN 644
L+ LP +G C +L L DN +++LP + N
Sbjct: 324 ALEYLPLEIGQCANLGVLSLRDNKLKKLPPELGN 357



Score = 76.6 bits (187), Expect = 1e-13
Identities = 53/156 (33%), Positives = 76/156 (48%)
Frame = +3

Query: 162 KTTGIVGLRDSNLKTLPSQVLDLARSVRTLDVTHNKLVDLPVEIGGLINLQRLMVAENLL 341
K ++GL D +L TLP+ L + + +L++ N L LP I L L+RL + +N +
Sbjct: 129 KNLTVLGLNDMSLTTLPADFGSLTQ-LESLELRENLLKHLPETISQLTKLKRLDLGDNEI 187

Query: 342 RRWPSSLFFLPALTVLALDENKKTTLPDELGLLVRLERFXXXXXXXXXXXXAIGSLRNLT 521
P L +LP L L LD N+ LP ELGLL +L T
Sbjct: 188 EDLPPYLGYLPGLHELWLDHNQLQRLPPELGLLTKL-----------------------T 224

Query: 522 LLNISHNRLKQLPESLGSCYSLEELLANDNLIEELP 629
L++S NRL++LP + SL +L NL+E LP
Sbjct: 225 YLDVSENRLEELPNEISGLVSLTDLDLAQNLLEALP 260



Score = 72.0 bits (175), Expect = 2e-12
Identities = 48/151 (31%), Positives = 72/151 (47%)
Frame = +3

Query: 177 VGLRDSNLKTLPSQVLDLARSVRTLDVTHNKLVDLPVEIGGLINLQRLMVAENLLRRWPS 356
+GL D+ + LP + + V LDV+ N + D+P +I L +LQ + N + + PS
Sbjct: 65 LGLSDNEIGRLPPDIQNFENLVE-LDVSRNDIPDIPDDIKHLQSLQVADFSSNPIPKLPS 123

Query: 357 SLFFLPALTVLALDENKKTTLPDELGLLVRLERFXXXXXXXXXXXXAIGSLRNLTLLNIS 536
L LTVL L++ TTLP + G L +LE I L L L++
Sbjct: 124 GFSQLKNLTVLGLNDMSLTTLPADFGSLTQLESLELRENLLKHLPETISQLTKLKRLDLG 183

Query: 537 HNRLKQLPESLGSCYSLEELLANDNLIEELP 629
N ++ LP LG L EL + N ++ LP
Sbjct: 184 DNEIEDLPPYLGYLPGLHELWLDHNQLQRLP 214



Score = 64.3 bits (155), Expect = 5e-10
Identities = 42/154 (27%), Positives = 71/154 (46%)
Frame = +3

Query: 177 VGLRDSNLKTLPSQVLDLARSVRTLDVTHNKLVDLPVEIGGLINLQRLMVAENLLRRWPS 356
V R +L +P ++L +R++ L + N + DLP L L++L +++N + R P
Sbjct: 18 VDKRHCSLPQVPEEILRYSRTLEELFLDANHIRDLPKNFFRLHRLRKLGLSDNEIGRLPP 77

Query: 357 SLFFLPALTVLALDENKKTTLPDELGLLVRLERFXXXXXXXXXXXXAIGSLRNLTLLNIS 536
+ L L + N +PD++ L L+ L+NLT+L ++
Sbjct: 78 DIQNFENLVELDVSRNDIPDIPDDIKHLQSLQVADFSSNPIPKLPSGFSQLKNLTVLGLN 137

Query: 537 HNRLKQLPESLGSCYSLEELLANDNLIEELPHTV 638
L LP GS LE L +NL++ LP T+
Sbjct: 138 DMSLTTLPADFGSLTQLESLELRENLLKHLPETI 171



Score = 38.5 bits (88), Expect = 0.030
Identities = 27/83 (32%), Positives = 42/83 (50%)
Frame = +3

Query: 183 LRDSNLKTLPSQVLDLARSVRTLDVTHNKLVDLPVEIGGLINLQRLMVAENLLRRWPSSL 362
L ++ L LP+ + + + + L+V N L LP+EIG NL L + +N L++ P L
Sbjct: 297 LTENFLSELPASIGQMTK-LNNLNVDRNALEYLPLEIGQCANLGVLSLRDNKLKKLPPEL 355

Query: 363 FFLPALTVLALDENKKTTLPDEL 431
L VL + N+ LP L
Sbjct: 356 GNCTVLHVLDVSGNQLLYLPYSL 378


>sp|Q14160|LAP4_HUMAN Protein LAP4 OS=Homo sapiens GN=SCRIB PE=1
SV=3
Length = 1630

Score = 89.4 bits (220), Expect = 1e-17
Identities = 50/146 (34%), Positives = 79/146 (54%)
Frame = +3

Query: 192 SNLKTLPSQVLDLARSVRTLDVTHNKLVDLPVEIGGLINLQRLMVAENLLRRWPSSLFFL 371
+ L LP ++ +L R V LDV+ N+L +LP E+GGL+ L L++++NLLRR P + L
Sbjct: 207 NQLSALPPELGNLRRLV-CLDVSENRLEELPAELGGLVLLTDLLLSQNLLRRLPDGIGQL 265

Query: 372 PALTVLALDENKKTTLPDELGLLVRLERFXXXXXXXXXXXXAIGSLRNLTLLNISHNRLK 551
L++L +D+N+ + + +G L ++G L LT LN+ N L+
Sbjct: 266 KQLSILKVDQNRLCEVTEAIGDCENLSELILTENLLMALPRSLGKLTKLTNLNVDRNHLE 325

Query: 552 QLPESLGSCYSLEELLANDNLIEELP 629
LP +G C +L L DN + LP
Sbjct: 326 ALPPEIGGCVALSVLSLRDNRLAVLP 351



Score = 84.3 bits (207), Expect = 5e-16
Identities = 57/156 (36%), Positives = 74/156 (47%)
Frame = +3

Query: 162 KTTGIVGLRDSNLKTLPSQVLDLARSVRTLDVTHNKLVDLPVEIGGLINLQRLMVAENLL 341
K I + L LP L RS+ L + L LP ++G L NL L + ENLL
Sbjct: 105 KALEIADFSGNPLSRLPDGFTQL-RSLAHLALNDVSLQALPGDVGNLANLVTLELRENLL 163

Query: 342 RRWPSSLFFLPALTVLALDENKKTTLPDELGLLVRLERFXXXXXXXXXXXXAIGSLRNLT 521
+ P+SL FL L L L N LPD LG L L +G+LR L
Sbjct: 164 KSLPASLSFLVKLEQLDLGGNDLEVLPDTLGALPNLRELWLDRNQLSALPPELGNLRRLV 223

Query: 522 LLNISHNRLKQLPESLGSCYSLEELLANDNLIEELP 629
L++S NRL++LP LG L +LL + NL+ LP
Sbjct: 224 CLDVSENRLEELPAELGGLVLLTDLLLSQNLLRRLP 259



Score = 83.2 bits (204), Expect = 1e-15
Identities = 53/152 (34%), Positives = 80/152 (52%)
Frame = +3

Query: 183 LRDSNLKTLPSQVLDLARSVRTLDVTHNKLVDLPVEIGGLINLQRLMVAENLLRRWPSSL 362
LR++ LK+LP+ + L + + LD+ N L LP +G L NL+ L + N L P L
Sbjct: 158 LRENLLKSLPASLSFLVK-LEQLDLGGNDLEVLPDTLGALPNLRELWLDRNQLSALPPEL 216

Query: 363 FFLPALTVLALDENKKTTLPDELGLLVRLERFXXXXXXXXXXXXAIGSLRNLTLLNISHN 542
L L L + EN+ LP ELG LV L IG L+ L++L + N
Sbjct: 217 GNLRRLVCLDVSENRLEELPAELGGLVLLTDLLLSQNLLRRLPDGIGQLKQLSILKVDQN 276

Query: 543 RLKQLPESLGSCYSLEELLANDNLIEELPHTV 638
RL ++ E++G C +L EL+ +NL+ LP ++
Sbjct: 277 RLCEVTEAIGDCENLSELILTENLLMALPRSL 308



Score = 61.2 bits (147), Expect = 4e-09
Identities = 48/177 (27%), Positives = 75/177 (42%), Gaps = 23/177 (12%)
Frame = +3

Query: 177 VGLRDSNLKTLPSQVLDLARSVRTLDVTHNKLVDLPVEIGGLINLQRLMVAENLLRRW-- 350
V R +L+ +P ++ +RS+ L + N+L +LP L+NL++L +++N ++R
Sbjct: 17 VDKRHCSLQAVPEEIYRYSRSLEELLLDANQLRELPKPFFRLLNLRKLGLSDNEIQRLPP 76

Query: 351 ---------------------PSSLFFLPALTVLALDENKKTTLPDELGLLVRLERFXXX 467
P S+ F AL + N + LPD L L
Sbjct: 77 EVANFMQLVELDVSRNDIPEIPESIKFCKALEIADFSGNPLSRLPDGFTQLRSLAHLALN 136

Query: 468 XXXXXXXXXAIGSLRNLTLLNISHNRLKQLPESLGSCYSLEELLANDNLIEELPHTV 638
+G+L NL L + N LK LP SL LE+L N +E LP T+
Sbjct: 137 DVSLQALPGDVGNLANLVTLELRENLLKSLPASLSFLVKLEQLDLGGNDLEVLPDTL 193


>sp|Q80VQ1|LRRC1_MOUSE Leucine-rich repeat-containing protein 1
OS=Mus musculus GN=Lrrc1 PE=2 SV=2
Length = 524

Score = 88.2 bits (217), Expect = 3e-17
Identities = 52/152 (34%), Positives = 80/152 (52%)
Frame = +3

Query: 183 LRDSNLKTLPSQVLDLARSVRTLDVTHNKLVDLPVEIGGLINLQRLMVAENLLRRWPSSL 362
L + L LP ++ +L +++ LDV+ N+L LP EI GL +L L++++NLL P +
Sbjct: 204 LDGNQLSELPQEIGNL-KNLLCLDVSENRLERLPEEISGLTSLTYLVISQNLLETIPEGI 262

Query: 363 FFLPALTVLALDENKKTTLPDELGLLVRLERFXXXXXXXXXXXXAIGSLRNLTLLNISHN 542
L L++L LD+N+ T LP+ +G L +IG L+ L+ LN N
Sbjct: 263 GKLKKLSILKLDQNRLTQLPEAIGDCENLTELVLTENRLLTLPKSIGKLKKLSNLNADRN 322

Query: 543 RLKQLPESLGSCYSLEELLANDNLIEELPHTV 638
+L LP+ +G C SL DN + LP V
Sbjct: 323 KLVSLPKEIGGCCSLTMFCIRDNRLTRLPAEV 354



Score = 84.3 bits (207), Expect = 5e-16
Identities = 50/152 (32%), Positives = 80/152 (52%)
Frame = +3

Query: 183 LRDSNLKTLPSQVLDLARSVRTLDVTHNKLVDLPVEIGGLINLQRLMVAENLLRRWPSSL 362
LR++ L LP + L R + LD+ +N++ +LP IG L++L+ L + N L P +
Sbjct: 158 LRENLLTYLPDSLTQLRR-LEELDLGNNEIYNLPESIGALLHLKDLWLDGNQLSELPQEI 216

Query: 363 FFLPALTVLALDENKKTTLPDELGLLVRLERFXXXXXXXXXXXXAIGSLRNLTLLNISHN 542
L L L + EN+ LP+E+ L L IG L+ L++L + N
Sbjct: 217 GNLKNLLCLDVSENRLERLPEEISGLTSLTYLVISQNLLETIPEGIGKLKKLSILKLDQN 276

Query: 543 RLKQLPESLGSCYSLEELLANDNLIEELPHTV 638
RL QLPE++G C +L EL+ +N + LP ++
Sbjct: 277 RLTQLPEAIGDCENLTELVLTENRLLTLPKSI 308



Score = 80.1 bits (196), Expect = 9e-15
Identities = 53/159 (33%), Positives = 77/159 (48%)
Frame = +3

Query: 162 KTTGIVGLRDSNLKTLPSQVLDLARSVRTLDVTHNKLVDLPVEIGGLINLQRLMVAENLL 341
K + + L LP +L +++ L V L LP IG L NL L + ENLL
Sbjct: 105 KALQVADFSGNPLTRLPESFPEL-QNLTCLSVNDISLQSLPENIGNLYNLASLELRENLL 163

Query: 342 RRWPSSLFFLPALTVLALDENKKTTLPDELGLLVRLERFXXXXXXXXXXXXAIGSLRNLT 521
P SL L L L L N+ LP+ +G L+ L+ IG+L+NL
Sbjct: 164 TYLPDSLTQLRRLEELDLGNNEIYNLPESIGALLHLKDLWLDGNQLSELPQEIGNLKNLL 223

Query: 522 LLNISHNRLKQLPESLGSCYSLEELLANDNLIEELPHTV 638
L++S NRL++LPE + SL L+ + NL+E +P +
Sbjct: 224 CLDVSENRLERLPEEISGLTSLTYLVISQNLLETIPEGI 262



Score = 77.8 bits (190), Expect = 4e-14
Identities = 52/152 (34%), Positives = 77/152 (50%)
Frame = +3

Query: 183 LRDSNLKTLPSQVLDLARSVRTLDVTHNKLVDLPVEIGGLINLQRLMVAENLLRRWPSSL 362
L ++ + LP + L ++ L + N+L +LP EIG L NL L V+EN L R P +
Sbjct: 181 LGNNEIYNLPESIGALLH-LKDLWLDGNQLSELPQEIGNLKNLLCLDVSENRLERLPEEI 239

Query: 363 FFLPALTVLALDENKKTTLPDELGLLVRLERFXXXXXXXXXXXXAIGSLRNLTLLNISHN 542
L +LT L + +N T+P+ +G L +L AIG NLT L ++ N
Sbjct: 240 SGLTSLTYLVISQNLLETIPEGIGKLKKLSILKLDQNRLTQLPEAIGDCENLTELVLTEN 299

Query: 543 RLKQLPESLGSCYSLEELLANDNLIEELPHTV 638
RL LP+S+G L L A+ N + LP +
Sbjct: 300 RLLTLPKSIGKLKKLSNLNADRNKLVSLPKEI 331



Score = 70.1 bits (170), Expect = 9e-12
Identities = 45/156 (28%), Positives = 78/156 (50%)
Frame = +3

Query: 177 VGLRDSNLKTLPSQVLDLARSVRTLDVTHNKLVDLPVEIGGLINLQRLMVAENLLRRWPS 356
+GL D+ ++ LP ++ + + V LDV+ N + ++P I LQ + N L R P
Sbjct: 64 LGLSDNEIQRLPPEIANFMQLVE-LDVSRNDIPEIPESIAFCKALQVADFSGNPLTRLPE 122

Query: 357 SLFFLPALTVLALDENKKTTLPDELGLLVRLERFXXXXXXXXXXXXAIGSLRNLTLLNIS 536
S L LT L++++ +LP+ +G L L ++ LR L L++
Sbjct: 123 SFPELQNLTCLSVNDISLQSLPENIGNLYNLASLELRENLLTYLPDSLTQLRRLEELDLG 182

Query: 537 HNRLKQLPESLGSCYSLEELLANDNLIEELPHTVCN 644
+N + LPES+G+ L++L + N + ELP + N
Sbjct: 183 NNEIYNLPESIGALLHLKDLWLDGNQLSELPQEIGN 218



Score = 65.1 bits (157), Expect = 3e-10
Identities = 39/151 (25%), Positives = 76/151 (50%)
Frame = +3

Query: 186 RDSNLKTLPSQVLDLARSVRTLDVTHNKLVDLPVEIGGLINLQRLMVAENLLRRWPSSLF 365
R +L +P ++ ARS+ L + N+L +LP + L+ L++L +++N ++R P +
Sbjct: 20 RHCSLVYVPEEIYRYARSLEELLLDANQLRELPEQFFQLVKLRKLGLSDNEIQRLPPEIA 79

Query: 366 FLPALTVLALDENKKTTLPDELGLLVRLERFXXXXXXXXXXXXAIGSLRNLTLLNISHNR 545
L L + N +P+ + L+ + L+NLT L+++
Sbjct: 80 NFMQLVELDVSRNDIPEIPESIAFCKALQVADFSGNPLTRLPESFPELQNLTCLSVNDIS 139

Query: 546 LKQLPESLGSCYSLEELLANDNLIEELPHTV 638
L+ LPE++G+ Y+L L +NL+ LP ++
Sbjct: 140 LQSLPENIGNLYNLASLELRENLLTYLPDSL 170



Score = 59.7 bits (143), Expect = 1e-08
Identities = 45/143 (31%), Positives = 67/143 (46%)
Frame = +3

Query: 198 LKTLPSQVLDLARSVRTLDVTHNKLVDLPVEIGGLINLQRLMVAENLLRRWPSSLFFLPA 377
L+T+P + L + + L + N+L LP IG NL L++ EN L P S+ L
Sbjct: 255 LETIPEGIGKL-KKLSILKLDQNRLTQLPEAIGDCENLTELVLTENRLLTLPKSIGKLKK 313

Query: 378 LTVLALDENKKTTLPDELGLLVRLERFXXXXXXXXXXXXAIGSLRNLTLLNISHNRLKQL 557
L+ L D NK +LP E+G L F + L +L+++ NRL L
Sbjct: 314 LSNLNADRNKLVSLPKEIGGCCSLTMFCIRDNRLTRLPAEVSQAVELHVLDVAGNRLHHL 373

Query: 558 PESLGSCYSLEELLANDNLIEEL 626
P SL + L+ L +DN + L
Sbjct: 374 PLSL-TTLKLKALWLSDNQSQPL 395



Score = 55.8 bits (133), Expect = 2e-07
Identities = 41/138 (29%), Positives = 61/138 (44%), Gaps = 1/138 (0%)
Frame = +3

Query: 234 RSVRTLDVTHNKLVDLPVEIGGLI-NLQRLMVAENLLRRWPSSLFFLPALTVLALDENKK 410
R V +D H LV +P EI +L+ L++ N LR P F L L L L +N+
Sbjct: 12 RHVEAIDKRHCSLVYVPEEIYRYARSLEELLLDANQLRELPEQFFQLVKLRKLGLSDNEI 71

Query: 411 TTLPDELGLLVRLERFXXXXXXXXXXXXAIGSLRNLTLLNISHNRLKQLPESLGSCYSLE 590
LP E+ ++L +I + L + + S N L +LPES +L
Sbjct: 72 QRLPPEIANFMQLVELDVSRNDIPEIPESIAFCKALQVADFSGNPLTRLPESFPELQNLT 131

Query: 591 ELLANDNLIEELPHTVCN 644
L ND ++ LP + N
Sbjct: 132 CLSVNDISLQSLPENIGN 149


>sp|Q80U72|LAP4_MOUSE Protein LAP4 OS=Mus musculus GN=Scrib PE=1
SV=2
Length = 1612

Score = 87.4 bits (215), Expect = 6e-17
Identities = 50/146 (34%), Positives = 79/146 (54%)
Frame = +3

Query: 192 SNLKTLPSQVLDLARSVRTLDVTHNKLVDLPVEIGGLINLQRLMVAENLLRRWPSSLFFL 371
+ L LP ++ +L R V LDV+ N+L +LPVE+GGL L L++++NLL+R P + L
Sbjct: 207 NQLSALPPELGNLRRLV-CLDVSENRLEELPVELGGLALLTDLLLSQNLLQRLPEGIGQL 265

Query: 372 PALTVLALDENKKTTLPDELGLLVRLERFXXXXXXXXXXXXAIGSLRNLTLLNISHNRLK 551
L++L +D+N+ + + +G L ++G L LT LN+ N L+
Sbjct: 266 KQLSILKVDQNRLCEVTEAIGDCENLSELILTENLLTALPHSLGKLTKLTNLNVDRNHLE 325

Query: 552 QLPESLGSCYSLEELLANDNLIEELP 629
LP +G C +L L DN + LP
Sbjct: 326 VLPPEIGGCVALSVLSLRDNRLAVLP 351



Score = 84.7 bits (208), Expect = 4e-16
Identities = 57/159 (35%), Positives = 76/159 (47%)
Frame = +3

Query: 162 KTTGIVGLRDSNLKTLPSQVLDLARSVRTLDVTHNKLVDLPVEIGGLINLQRLMVAENLL 341
K I + L LP L RS+ L + L LP ++G L NL L + ENLL
Sbjct: 105 KALEIADFSGNPLSRLPDGFTQL-RSLAHLALNDVSLQALPGDVGNLANLVTLELRENLL 163

Query: 342 RRWPSSLFFLPALTVLALDENKKTTLPDELGLLVRLERFXXXXXXXXXXXXAIGSLRNLT 521
+ P+SL FL L L L N LPD LG L L +G+LR L
Sbjct: 164 KSLPASLSFLVKLEQLDLGGNDLEVLPDTLGALPNLRELWLDRNQLSALPPELGNLRRLV 223

Query: 522 LLNISHNRLKQLPESLGSCYSLEELLANDNLIEELPHTV 638
L++S NRL++LP LG L +LL + NL++ LP +
Sbjct: 224 CLDVSENRLEELPVELGGLALLTDLLLSQNLLQRLPEGI 262



Score = 84.7 bits (208), Expect = 4e-16
Identities = 53/152 (34%), Positives = 80/152 (52%)
Frame = +3

Query: 183 LRDSNLKTLPSQVLDLARSVRTLDVTHNKLVDLPVEIGGLINLQRLMVAENLLRRWPSSL 362
LR++ LK+LP+ + L + + LD+ N L LP +G L NL+ L + N L P L
Sbjct: 158 LRENLLKSLPASLSFLVK-LEQLDLGGNDLEVLPDTLGALPNLRELWLDRNQLSALPPEL 216

Query: 363 FFLPALTVLALDENKKTTLPDELGLLVRLERFXXXXXXXXXXXXAIGSLRNLTLLNISHN 542
L L L + EN+ LP ELG L L IG L+ L++L + N
Sbjct: 217 GNLRRLVCLDVSENRLEELPVELGGLALLTDLLLSQNLLQRLPEGIGQLKQLSILKVDQN 276

Query: 543 RLKQLPESLGSCYSLEELLANDNLIEELPHTV 638
RL ++ E++G C +L EL+ +NL+ LPH++
Sbjct: 277 RLCEVTEAIGDCENLSELILTENLLTALPHSL 308



Score = 61.2 bits (147), Expect = 4e-09
Identities = 48/177 (27%), Positives = 75/177 (42%), Gaps = 23/177 (12%)
Frame = +3

Query: 177 VGLRDSNLKTLPSQVLDLARSVRTLDVTHNKLVDLPVEIGGLINLQRLMVAENLLRRW-- 350
V R +L+ +P ++ +RS+ L + N+L +LP L+NL++L +++N ++R
Sbjct: 17 VDKRHCSLQVVPEEIYRYSRSLEELLLDANQLRELPKPFFRLLNLRKLGLSDNEIQRLPP 76

Query: 351 ---------------------PSSLFFLPALTVLALDENKKTTLPDELGLLVRLERFXXX 467
P S+ F AL + N + LPD L L
Sbjct: 77 EVANFMQLVELDVSRNDIPEIPESIKFCKALEIADFSGNPLSRLPDGFTQLRSLAHLALN 136

Query: 468 XXXXXXXXXAIGSLRNLTLLNISHNRLKQLPESLGSCYSLEELLANDNLIEELPHTV 638
+G+L NL L + N LK LP SL LE+L N +E LP T+
Sbjct: 137 DVSLQALPGDVGNLANLVTLELRENLLKSLPASLSFLVKLEQLDLGGNDLEVLPDTL 193


>sp|Q6AYI5|SHOC2_RAT Leucine-rich repeat protein SHOC-2 OS=Rattus
norvegicus GN=Shoc2 PE=2 SV=1
Length = 582

Score = 86.7 bits (213), Expect = 1e-16
Identities = 53/152 (34%), Positives = 83/152 (54%), Gaps = 2/152 (1%)
Frame = +3

Query: 162 KTTGIVGLRDSNLKTLPSQVLDLAR--SVRTLDVTHNKLVDLPVEIGGLINLQRLMVAEN 335
K + ++D+ L +LP LD S+ L++ N+L +P ++ GL++L+ L+++ N
Sbjct: 379 KVLSKLNMKDNQLTSLP---LDFGTWTSMVELNLATNQLTKIPEDVSGLVSLEVLILSNN 435

Query: 336 LLRRWPSSLFFLPALTVLALDENKKTTLPDELGLLVRLERFXXXXXXXXXXXXAIGSLRN 515
LL++ P L L L L L+ENK +LP+E+ L L++ IG L N
Sbjct: 436 LLKKLPHGLGNLRKLRELDLEENKLESLPNEIAYLKDLQKLVLTNNQLTTLPRGIGHLTN 495

Query: 516 LTLLNISHNRLKQLPESLGSCYSLEELLANDN 611
LT L + N L LPE +G+ +LEEL NDN
Sbjct: 496 LTHLGLGENLLTHLPEEIGTLENLEELYLNDN 527



Score = 75.9 bits (185), Expect = 2e-13
Identities = 49/154 (31%), Positives = 80/154 (51%)
Frame = +3

Query: 183 LRDSNLKTLPSQVLDLARSVRTLDVTHNKLVDLPVEIGGLINLQRLMVAENLLRRWPSSL 362
L + L++LP++V L ++ TL ++ N L LP + L L+ L + N LR PS +
Sbjct: 130 LYSNKLQSLPAEVGCLV-NLMTLALSENSLTSLPDSLDNLKKLRMLDLRHNKLREIPSVV 188

Query: 363 FFLPALTVLALDENKKTTLPDELGLLVRLERFXXXXXXXXXXXXAIGSLRNLTLLNISHN 542
+ L +LT L L N+ T + ++ L RL IG L NL L+++HN
Sbjct: 189 YRLDSLTTLYLRFNRITAVEKDVRNLPRLSTLSIRENKIKQLPAEIGELCNLITLDVAHN 248

Query: 543 RLKQLPESLGSCYSLEELLANDNLIEELPHTVCN 644
+L+ LP+ +G+C + L N + +LP T+ N
Sbjct: 249 QLEHLPKEIGNCTQITNLDLQHNELLDLPDTIGN 282



Score = 70.9 bits (172), Expect = 5e-12
Identities = 46/159 (28%), Positives = 78/159 (49%)
Frame = +3

Query: 162 KTTGIVGLRDSNLKTLPSQVLDLARSVRTLDVTHNKLVDLPVEIGGLINLQRLMVAENLL 341
K ++ LR + L+ +PS V L S+ TL + N++ + ++ L L L + EN +
Sbjct: 169 KKLRMLDLRHNKLREIPSVVYRLD-SLTTLYLRFNRITAVEKDVRNLPRLSTLSIRENKI 227

Query: 342 RRWPSSLFFLPALTVLALDENKKTTLPDELGLLVRLERFXXXXXXXXXXXXAIGSLRNLT 521
++ P+ + L L L + N+ LP E+G ++ IG+L +L
Sbjct: 228 KQLPAEIGELCNLITLDVAHNQLEHLPKEIGNCTQITNLDLQHNELLDLPDTIGNLSSLN 287

Query: 522 LLNISHNRLKQLPESLGSCYSLEELLANDNLIEELPHTV 638
L + +NRL +P SL C +LEEL +N I LP ++
Sbjct: 288 RLGLRYNRLSAIPRSLAKCSALEELNLENNNISTLPESL 326



Score = 57.8 bits (138), Expect = 5e-08
Identities = 49/192 (25%), Positives = 84/192 (43%), Gaps = 4/192 (2%)
Frame = +3

Query: 75 TLGLLPDLESMGCCMSKQQVARANRAAKWKTTGIVGLRDSNLKTLPSQVLDLARSVRTLD 254
T+G L L +G ++ A AK + L ++N+ TLP +L + +L
Sbjct: 279 TIGNLSSLNRLGLRYNRLS-AIPRSLAKCSALEELNLENNNISTLPESLLSSLVKLNSLT 337

Query: 255 VTHNKLVDLPVEIGG---LINLQRLMVAENLLRRWPSSLFF-LPALTVLALDENKKTTLP 422
+ N PV GG + L + N + + P +F L+ L + +N+ T+LP
Sbjct: 338 LARNCFQLYPV--GGPSQFSTIYSLNMEHNRINKIPFGIFSRAKVLSKLNMKDNQLTSLP 395

Query: 423 DELGLLVRLERFXXXXXXXXXXXXAIGSLRNLTLLNISHNRLKQLPESLGSCYSLEELLA 602
+ G + + L +L +L +S+N LK+LP LG+ L EL
Sbjct: 396 LDFGTWTSMVELNLATNQLTKIPEDVSGLVSLEVLILSNNLLKKLPHGLGNLRKLRELDL 455

Query: 603 NDNLIEELPHTV 638
+N +E LP+ +
Sbjct: 456 EENKLESLPNEI 467



Score = 52.0 bits (123), Expect = 3e-06
Identities = 38/135 (28%), Positives = 60/135 (44%), Gaps = 3/135 (2%)
Frame = +3

Query: 249 LDVTHNKLVDLPVEIGGLINLQRLMVAENLLRRWPSSLFFLPALTVLALDENKKTTLPDE 428
LD++ + LP + L L L + N L+ P+ + L L LAL EN T+LPD
Sbjct: 105 LDLSKRSIHILPPSVKELTQLTELYLYSNKLQSLPAEVGCLVNLMTLALSENSLTSLPDS 164

Query: 429 LGLLVRLERFXXXXXXXXXXXXAIGSLRNLTLLNISHNRLKQLPESLGSCYSLEELLAND 608
L L +L + L +LT L + NR+ + + + + L L +
Sbjct: 165 LDNLKKLRMLDLRHNKLREIPSVVYRLDSLTTLYLRFNRITAVEKDVRNLPRLSTLSIRE 224

Query: 609 NLIEELPHTV---CN 644
N I++LP + CN
Sbjct: 225 NKIKQLPAEIGELCN 239



Score = 47.4 bits (111), Expect = 7e-05
Identities = 33/113 (29%), Positives = 53/113 (46%)
Frame = +3

Query: 306 NLQRLMVAENLLRRWPSSLFFLPALTVLALDENKKTTLPDELGLLVRLERFXXXXXXXXX 485
N RL +++ + P S+ L LT L L NK +LP E+G LV L
Sbjct: 101 NSMRLDLSKRSIHILPPSVKELTQLTELYLYSNKLQSLPAEVGCLVNLMTLALSENSLTS 160

Query: 486 XXXAIGSLRNLTLLNISHNRLKQLPESLGSCYSLEELLANDNLIEELPHTVCN 644
++ +L+ L +L++ HN+L+++P + SL L N I + V N
Sbjct: 161 LPDSLDNLKKLRMLDLRHNKLREIPSVVYRLDSLTTLYLRFNRITAVEKDVRN 213


>sp|Q5RAV5|SHOC2_PONAB Leucine-rich repeat protein SHOC-2 OS=Pongo
abelii GN=SHOC2 PE=2 SV=2
Length = 582

Score = 86.7 bits (213), Expect = 1e-16
Identities = 53/152 (34%), Positives = 83/152 (54%), Gaps = 2/152 (1%)
Frame = +3

Query: 162 KTTGIVGLRDSNLKTLPSQVLDLAR--SVRTLDVTHNKLVDLPVEIGGLINLQRLMVAEN 335
K + ++D+ L +LP LD S+ L++ N+L +P ++ GL++L+ L+++ N
Sbjct: 379 KVLSKLNMKDNQLTSLP---LDFGTWTSMVELNLATNQLTKIPEDVSGLVSLEVLILSNN 435

Query: 336 LLRRWPSSLFFLPALTVLALDENKKTTLPDELGLLVRLERFXXXXXXXXXXXXAIGSLRN 515
LL++ P L L L L L+ENK +LP+E+ L L++ IG L N
Sbjct: 436 LLKKLPHGLGNLRKLRELDLEENKLESLPNEIAYLKDLQKLVLTNNQLTTLPRGIGHLTN 495

Query: 516 LTLLNISHNRLKQLPESLGSCYSLEELLANDN 611
LT L + N L LPE +G+ +LEEL NDN
Sbjct: 496 LTHLGLGENLLTHLPEEIGTLENLEELYLNDN 527



Score = 77.0 bits (188), Expect = 8e-14
Identities = 49/154 (31%), Positives = 81/154 (52%)
Frame = +3

Query: 183 LRDSNLKTLPSQVLDLARSVRTLDVTHNKLVDLPVEIGGLINLQRLMVAENLLRRWPSSL 362
L + L++LP++V L ++ TL ++ N L LP + L L+ L + N LR PS +
Sbjct: 130 LYSNKLQSLPAEVGCLV-NLMTLALSENSLTSLPDSLDNLKKLRMLDLRHNKLREIPSVV 188

Query: 363 FFLPALTVLALDENKKTTLPDELGLLVRLERFXXXXXXXXXXXXAIGSLRNLTLLNISHN 542
+ L +LT L L N+ TT+ ++ L +L IG L NL L+++HN
Sbjct: 189 YRLDSLTTLYLRFNRITTVEKDIKNLSKLSMLSIRENKIKQLPAEIGELCNLITLDVAHN 248

Query: 543 RLKQLPESLGSCYSLEELLANDNLIEELPHTVCN 644
+L+ LP+ +G+C + L N + +LP T+ N
Sbjct: 249 QLEHLPKEIGNCTQITNLDLQHNELLDLPDTIGN 282



Score = 72.4 bits (176), Expect = 2e-12
Identities = 47/159 (29%), Positives = 79/159 (49%)
Frame = +3

Query: 162 KTTGIVGLRDSNLKTLPSQVLDLARSVRTLDVTHNKLVDLPVEIGGLINLQRLMVAENLL 341
K ++ LR + L+ +PS V L S+ TL + N++ + +I L L L + EN +
Sbjct: 169 KKLRMLDLRHNKLREIPSVVYRLD-SLTTLYLRFNRITTVEKDIKNLSKLSMLSIRENKI 227

Query: 342 RRWPSSLFFLPALTVLALDENKKTTLPDELGLLVRLERFXXXXXXXXXXXXAIGSLRNLT 521
++ P+ + L L L + N+ LP E+G ++ IG+L +L+
Sbjct: 228 KQLPAEIGELCNLITLDVAHNQLEHLPKEIGNCTQITNLDLQHNELLDLPDTIGNLSSLS 287

Query: 522 LLNISHNRLKQLPESLGSCYSLEELLANDNLIEELPHTV 638
L + +NRL +P SL C +LEEL +N I LP ++
Sbjct: 288 RLGLRYNRLSAIPRSLAKCSALEELNLENNNISTLPESL 326



Score = 57.8 bits (138), Expect = 5e-08
Identities = 49/192 (25%), Positives = 84/192 (43%), Gaps = 4/192 (2%)
Frame = +3

Query: 75 TLGLLPDLESMGCCMSKQQVARANRAAKWKTTGIVGLRDSNLKTLPSQVLDLARSVRTLD 254
T+G L L +G ++ A AK + L ++N+ TLP +L + +L
Sbjct: 279 TIGNLSSLSRLGLRYNRLS-AIPRSLAKCSALEELNLENNNISTLPESLLSSLVKLNSLT 337

Query: 255 VTHNKLVDLPVEIGG---LINLQRLMVAENLLRRWPSSLFF-LPALTVLALDENKKTTLP 422
+ N PV GG + L + N + + P +F L+ L + +N+ T+LP
Sbjct: 338 LARNCFQLYPV--GGPSQFSTIYSLNMEHNRINKIPFGIFSRAKVLSKLNMKDNQLTSLP 395

Query: 423 DELGLLVRLERFXXXXXXXXXXXXAIGSLRNLTLLNISHNRLKQLPESLGSCYSLEELLA 602
+ G + + L +L +L +S+N LK+LP LG+ L EL
Sbjct: 396 LDFGTWTSMVELNLATNQLTKIPEDVSGLVSLEVLILSNNLLKKLPHGLGNLRKLRELDL 455

Query: 603 NDNLIEELPHTV 638
+N +E LP+ +
Sbjct: 456 EENKLESLPNEI 467



Score = 53.1 bits (126), Expect = 1e-06
Identities = 39/135 (28%), Positives = 60/135 (44%), Gaps = 3/135 (2%)
Frame = +3

Query: 249 LDVTHNKLVDLPVEIGGLINLQRLMVAENLLRRWPSSLFFLPALTVLALDENKKTTLPDE 428
LD++ + LP I L L L + N L+ P+ + L L LAL EN T+LPD
Sbjct: 105 LDLSKRSIHILPSSIKELTQLTELYLYSNKLQSLPAEVGCLVNLMTLALSENSLTSLPDS 164

Query: 429 LGLLVRLERFXXXXXXXXXXXXAIGSLRNLTLLNISHNRLKQLPESLGSCYSLEELLAND 608
L L +L + L +LT L + NR+ + + + + L L +
Sbjct: 165 LDNLKKLRMLDLRHNKLREIPSVVYRLDSLTTLYLRFNRITTVEKDIKNLSKLSMLSIRE 224

Query: 609 NLIEELPHTV---CN 644
N I++LP + CN
Sbjct: 225 NKIKQLPAEIGELCN 239



Score = 49.3 bits (116), Expect = 2e-05
Identities = 33/113 (29%), Positives = 54/113 (47%)
Frame = +3

Query: 306 NLQRLMVAENLLRRWPSSLFFLPALTVLALDENKKTTLPDELGLLVRLERFXXXXXXXXX 485
N RL +++ + PSS+ L LT L L NK +LP E+G LV L
Sbjct: 101 NSMRLDLSKRSIHILPSSIKELTQLTELYLYSNKLQSLPAEVGCLVNLMTLALSENSLTS 160

Query: 486 XXXAIGSLRNLTLLNISHNRLKQLPESLGSCYSLEELLANDNLIEELPHTVCN 644
++ +L+ L +L++ HN+L+++P + SL L N I + + N
Sbjct: 161 LPDSLDNLKKLRMLDLRHNKLREIPSVVYRLDSLTTLYLRFNRITTVEKDIKN 213


>sp|O88520|SHOC2_MOUSE Leucine-rich repeat protein SHOC-2 OS=Mus
musculus GN=Shoc2 PE=2 SV=2
Length = 582

Score = 86.7 bits (213), Expect = 1e-16
Identities = 53/152 (34%), Positives = 83/152 (54%), Gaps = 2/152 (1%)
Frame = +3

Query: 162 KTTGIVGLRDSNLKTLPSQVLDLAR--SVRTLDVTHNKLVDLPVEIGGLINLQRLMVAEN 335
K + ++D+ L +LP LD S+ L++ N+L +P ++ GL++L+ L+++ N
Sbjct: 379 KVLSKLNMKDNQLTSLP---LDFGTWTSMVELNLATNQLTKIPEDVSGLVSLEVLILSNN 435

Query: 336 LLRRWPSSLFFLPALTVLALDENKKTTLPDELGLLVRLERFXXXXXXXXXXXXAIGSLRN 515
LL++ P L L L L L+ENK +LP+E+ L L++ IG L N
Sbjct: 436 LLKKLPHGLGNLRKLRELDLEENKLESLPNEIAYLKDLQKLVLTNNQLSTLPRGIGHLTN 495

Query: 516 LTLLNISHNRLKQLPESLGSCYSLEELLANDN 611
LT L + N L LPE +G+ +LEEL NDN
Sbjct: 496 LTHLGLGENLLTHLPEEIGTLENLEELYLNDN 527



Score = 76.6 bits (187), Expect = 1e-13
Identities = 49/154 (31%), Positives = 81/154 (52%)
Frame = +3

Query: 183 LRDSNLKTLPSQVLDLARSVRTLDVTHNKLVDLPVEIGGLINLQRLMVAENLLRRWPSSL 362
L + L++LP++V L ++ TL ++ N L LP + L L+ L + N LR PS +
Sbjct: 130 LYSNKLQSLPAEVGCLV-NLMTLALSENSLTSLPDSLDNLKKLRMLDLRHNKLREIPSVV 188

Query: 363 FFLPALTVLALDENKKTTLPDELGLLVRLERFXXXXXXXXXXXXAIGSLRNLTLLNISHN 542
+ L +LT L L N+ TT+ ++ L +L IG L NL L+++HN
Sbjct: 189 YRLDSLTTLYLRFNRITTVEKDIKNLPKLSMLSIRENKIKQLPAEIGELCNLITLDVAHN 248

Query: 543 RLKQLPESLGSCYSLEELLANDNLIEELPHTVCN 644
+L+ LP+ +G+C + L N + +LP T+ N
Sbjct: 249 QLEHLPKEIGNCTQITNLDLQHNDLLDLPDTIGN 282



Score = 71.6 bits (174), Expect = 3e-12
Identities = 47/159 (29%), Positives = 78/159 (49%)
Frame = +3

Query: 162 KTTGIVGLRDSNLKTLPSQVLDLARSVRTLDVTHNKLVDLPVEIGGLINLQRLMVAENLL 341
K ++ LR + L+ +PS V L S+ TL + N++ + +I L L L + EN +
Sbjct: 169 KKLRMLDLRHNKLREIPSVVYRLD-SLTTLYLRFNRITTVEKDIKNLPKLSMLSIRENKI 227

Query: 342 RRWPSSLFFLPALTVLALDENKKTTLPDELGLLVRLERFXXXXXXXXXXXXAIGSLRNLT 521
++ P+ + L L L + N+ LP E+G ++ IG+L +L
Sbjct: 228 KQLPAEIGELCNLITLDVAHNQLEHLPKEIGNCTQITNLDLQHNDLLDLPDTIGNLSSLN 287

Query: 522 LLNISHNRLKQLPESLGSCYSLEELLANDNLIEELPHTV 638
L + +NRL +P SL C +LEEL +N I LP ++
Sbjct: 288 RLGLRYNRLSAIPRSLAKCSALEELNLENNNISTLPESL 326



Score = 57.8 bits (138), Expect = 5e-08
Identities = 49/192 (25%), Positives = 84/192 (43%), Gaps = 4/192 (2%)
Frame = +3

Query: 75 TLGLLPDLESMGCCMSKQQVARANRAAKWKTTGIVGLRDSNLKTLPSQVLDLARSVRTLD 254
T+G L L +G ++ A AK + L ++N+ TLP +L + +L
Sbjct: 279 TIGNLSSLNRLGLRYNRLS-AIPRSLAKCSALEELNLENNNISTLPESLLSSLVKLNSLT 337

Query: 255 VTHNKLVDLPVEIGG---LINLQRLMVAENLLRRWPSSLFF-LPALTVLALDENKKTTLP 422
+ N PV GG + L + N + + P +F L+ L + +N+ T+LP
Sbjct: 338 LARNCFQLYPV--GGPSQFSTIYSLNMEHNRINKIPFGIFSRAKVLSKLNMKDNQLTSLP 395

Query: 423 DELGLLVRLERFXXXXXXXXXXXXAIGSLRNLTLLNISHNRLKQLPESLGSCYSLEELLA 602
+ G + + L +L +L +S+N LK+LP LG+ L EL
Sbjct: 396 LDFGTWTSMVELNLATNQLTKIPEDVSGLVSLEVLILSNNLLKKLPHGLGNLRKLRELDL 455

Query: 603 NDNLIEELPHTV 638
+N +E LP+ +
Sbjct: 456 EENKLESLPNEI 467



Score = 52.4 bits (124), Expect = 2e-06
Identities = 38/135 (28%), Positives = 60/135 (44%), Gaps = 3/135 (2%)
Frame = +3

Query: 249 LDVTHNKLVDLPVEIGGLINLQRLMVAENLLRRWPSSLFFLPALTVLALDENKKTTLPDE 428
LD++ + LP + L L L + N L+ P+ + L L LAL EN T+LPD
Sbjct: 105 LDLSKRSIHILPPSVKELTQLTELYLYSNKLQSLPAEVGCLVNLMTLALSENSLTSLPDS 164

Query: 429 LGLLVRLERFXXXXXXXXXXXXAIGSLRNLTLLNISHNRLKQLPESLGSCYSLEELLAND 608
L L +L + L +LT L + NR+ + + + + L L +
Sbjct: 165 LDNLKKLRMLDLRHNKLREIPSVVYRLDSLTTLYLRFNRITTVEKDIKNLPKLSMLSIRE 224

Query: 609 NLIEELPHTV---CN 644
N I++LP + CN
Sbjct: 225 NKIKQLPAEIGELCN 239



Score = 47.0 bits (110), Expect = 8e-05
Identities = 32/113 (28%), Positives = 53/113 (46%)
Frame = +3

Query: 306 NLQRLMVAENLLRRWPSSLFFLPALTVLALDENKKTTLPDELGLLVRLERFXXXXXXXXX 485
N RL +++ + P S+ L LT L L NK +LP E+G LV L
Sbjct: 101 NSMRLDLSKRSIHILPPSVKELTQLTELYLYSNKLQSLPAEVGCLVNLMTLALSENSLTS 160

Query: 486 XXXAIGSLRNLTLLNISHNRLKQLPESLGSCYSLEELLANDNLIEELPHTVCN 644
++ +L+ L +L++ HN+L+++P + SL L N I + + N
Sbjct: 161 LPDSLDNLKKLRMLDLRHNKLREIPSVVYRLDSLTTLYLRFNRITTVEKDIKN 213


>sp|Q9UQ13|SHOC2_HUMAN Leucine-rich repeat protein SHOC-2 OS=Homo
sapiens GN=SHOC2 PE=1 SV=2
Length = 582

Score = 86.7 bits (213), Expect = 1e-16
Identities = 53/152 (34%), Positives = 83/152 (54%), Gaps = 2/152 (1%)
Frame = +3

Query: 162 KTTGIVGLRDSNLKTLPSQVLDLAR--SVRTLDVTHNKLVDLPVEIGGLINLQRLMVAEN 335
K + ++D+ L +LP LD S+ L++ N+L +P ++ GL++L+ L+++ N
Sbjct: 379 KVLSKLNMKDNQLTSLP---LDFGTWTSMVELNLATNQLTKIPEDVSGLVSLEVLILSNN 435

Query: 336 LLRRWPSSLFFLPALTVLALDENKKTTLPDELGLLVRLERFXXXXXXXXXXXXAIGSLRN 515
LL++ P L L L L L+ENK +LP+E+ L L++ IG L N
Sbjct: 436 LLKKLPHGLGNLRKLRELDLEENKLESLPNEIAYLKDLQKLVLTNNQLTTLPRGIGHLTN 495

Query: 516 LTLLNISHNRLKQLPESLGSCYSLEELLANDN 611
LT L + N L LPE +G+ +LEEL NDN
Sbjct: 496 LTHLGLGENLLTHLPEEIGTLENLEELYLNDN 527



Score = 77.0 bits (188), Expect = 8e-14
Identities = 49/154 (31%), Positives = 81/154 (52%)
Frame = +3

Query: 183 LRDSNLKTLPSQVLDLARSVRTLDVTHNKLVDLPVEIGGLINLQRLMVAENLLRRWPSSL 362
L + L++LP++V L ++ TL ++ N L LP + L L+ L + N LR PS +
Sbjct: 130 LYSNKLQSLPAEVGCLV-NLMTLALSENSLTSLPDSLDNLKKLRMLDLRHNKLREIPSVV 188

Query: 363 FFLPALTVLALDENKKTTLPDELGLLVRLERFXXXXXXXXXXXXAIGSLRNLTLLNISHN 542
+ L +LT L L N+ TT+ ++ L +L IG L NL L+++HN
Sbjct: 189 YRLDSLTTLYLRFNRITTVEKDIKNLSKLSMLSIRENKIKQLPAEIGELCNLITLDVAHN 248

Query: 543 RLKQLPESLGSCYSLEELLANDNLIEELPHTVCN 644
+L+ LP+ +G+C + L N + +LP T+ N
Sbjct: 249 QLEHLPKEIGNCTQITNLDLQHNELLDLPDTIGN 282



Score = 72.4 bits (176), Expect = 2e-12
Identities = 47/159 (29%), Positives = 79/159 (49%)
Frame = +3

Query: 162 KTTGIVGLRDSNLKTLPSQVLDLARSVRTLDVTHNKLVDLPVEIGGLINLQRLMVAENLL 341
K ++ LR + L+ +PS V L S+ TL + N++ + +I L L L + EN +
Sbjct: 169 KKLRMLDLRHNKLREIPSVVYRLD-SLTTLYLRFNRITTVEKDIKNLSKLSMLSIRENKI 227

Query: 342 RRWPSSLFFLPALTVLALDENKKTTLPDELGLLVRLERFXXXXXXXXXXXXAIGSLRNLT 521
++ P+ + L L L + N+ LP E+G ++ IG+L +L+
Sbjct: 228 KQLPAEIGELCNLITLDVAHNQLEHLPKEIGNCTQITNLDLQHNELLDLPDTIGNLSSLS 287

Query: 522 LLNISHNRLKQLPESLGSCYSLEELLANDNLIEELPHTV 638
L + +NRL +P SL C +LEEL +N I LP ++
Sbjct: 288 RLGLRYNRLSAIPRSLAKCSALEELNLENNNISTLPESL 326



Score = 57.8 bits (138), Expect = 5e-08
Identities = 49/192 (25%), Positives = 84/192 (43%), Gaps = 4/192 (2%)
Frame = +3

Query: 75 TLGLLPDLESMGCCMSKQQVARANRAAKWKTTGIVGLRDSNLKTLPSQVLDLARSVRTLD 254
T+G L L +G ++ A AK + L ++N+ TLP +L + +L
Sbjct: 279 TIGNLSSLSRLGLRYNRLS-AIPRSLAKCSALEELNLENNNISTLPESLLSSLVKLNSLT 337

Query: 255 VTHNKLVDLPVEIGG---LINLQRLMVAENLLRRWPSSLFF-LPALTVLALDENKKTTLP 422
+ N PV GG + L + N + + P +F L+ L + +N+ T+LP
Sbjct: 338 LARNCFQLYPV--GGPSQFSTIYSLNMEHNRINKIPFGIFSRAKVLSKLNMKDNQLTSLP 395

Query: 423 DELGLLVRLERFXXXXXXXXXXXXAIGSLRNLTLLNISHNRLKQLPESLGSCYSLEELLA 602
+ G + + L +L +L +S+N LK+LP LG+ L EL
Sbjct: 396 LDFGTWTSMVELNLATNQLTKIPEDVSGLVSLEVLILSNNLLKKLPHGLGNLRKLRELDL 455

Query: 603 NDNLIEELPHTV 638
+N +E LP+ +
Sbjct: 456 EENKLESLPNEI 467



Score = 53.1 bits (126), Expect = 1e-06
Identities = 39/135 (28%), Positives = 60/135 (44%), Gaps = 3/135 (2%)
Frame = +3

Query: 249 LDVTHNKLVDLPVEIGGLINLQRLMVAENLLRRWPSSLFFLPALTVLALDENKKTTLPDE 428
LD++ + LP I L L L + N L+ P+ + L L LAL EN T+LPD
Sbjct: 105 LDLSKRSIHILPSSIKELTQLTELYLYSNKLQSLPAEVGCLVNLMTLALSENSLTSLPDS 164

Query: 429 LGLLVRLERFXXXXXXXXXXXXAIGSLRNLTLLNISHNRLKQLPESLGSCYSLEELLAND 608
L L +L + L +LT L + NR+ + + + + L L +
Sbjct: 165 LDNLKKLRMLDLRHNKLREIPSVVYRLDSLTTLYLRFNRITTVEKDIKNLSKLSMLSIRE 224

Query: 609 NLIEELPHTV---CN 644
N I++LP + CN
Sbjct: 225 NKIKQLPAEIGELCN 239



Score = 49.3 bits (116), Expect = 2e-05
Identities = 33/113 (29%), Positives = 54/113 (47%)
Frame = +3

Query: 306 NLQRLMVAENLLRRWPSSLFFLPALTVLALDENKKTTLPDELGLLVRLERFXXXXXXXXX 485
N RL +++ + PSS+ L LT L L NK +LP E+G LV L
Sbjct: 101 NSMRLDLSKRSIHILPSSIKELTQLTELYLYSNKLQSLPAEVGCLVNLMTLALSENSLTS 160

Query: 486 XXXAIGSLRNLTLLNISHNRLKQLPESLGSCYSLEELLANDNLIEELPHTVCN 644
++ +L+ L +L++ HN+L+++P + SL L N I + + N
Sbjct: 161 LPDSLDNLKKLRMLDLRHNKLREIPSVVYRLDSLTTLYLRFNRITTVEKDIKN 213


>sp|A6QLV3|SHOC2_BOVIN Leucine-rich repeat protein SHOC-2 OS=Bos
taurus GN=SHOC2 PE=2 SV=1
Length = 582

Score = 86.7 bits (213), Expect = 1e-16
Identities = 53/152 (34%), Positives = 83/152 (54%), Gaps = 2/152 (1%)
Frame = +3

Query: 162 KTTGIVGLRDSNLKTLPSQVLDLAR--SVRTLDVTHNKLVDLPVEIGGLINLQRLMVAEN 335
K + ++D+ L +LP LD S+ L++ N+L +P ++ GL++L+ L+++ N
Sbjct: 379 KVLSKLNMKDNQLTSLP---LDFGTWTSMVELNLATNQLTKIPEDVSGLVSLEVLILSNN 435

Query: 336 LLRRWPSSLFFLPALTVLALDENKKTTLPDELGLLVRLERFXXXXXXXXXXXXAIGSLRN 515
LL++ P L L L L L+ENK +LP+E+ L L++ IG L N
Sbjct: 436 LLKKLPHGLGNLRKLRELDLEENKLESLPNEIAYLKDLQKLVLTNNQLTTLPRGIGHLTN 495

Query: 516 LTLLNISHNRLKQLPESLGSCYSLEELLANDN 611
LT L + N L LPE +G+ +LEEL NDN
Sbjct: 496 LTHLGLGENLLTHLPEEIGTLENLEELYLNDN 527



Score = 77.0 bits (188), Expect = 8e-14
Identities = 49/154 (31%), Positives = 81/154 (52%)
Frame = +3

Query: 183 LRDSNLKTLPSQVLDLARSVRTLDVTHNKLVDLPVEIGGLINLQRLMVAENLLRRWPSSL 362
L + L++LP++V L ++ TL ++ N L LP + L L+ L + N LR PS +
Sbjct: 130 LYSNKLQSLPAEVGCLV-NLMTLALSENSLTSLPDSLDNLKKLRMLDLRHNKLREIPSVV 188

Query: 363 FFLPALTVLALDENKKTTLPDELGLLVRLERFXXXXXXXXXXXXAIGSLRNLTLLNISHN 542
+ L +LT L L N+ TT+ ++ L +L IG L NL L+++HN
Sbjct: 189 YRLDSLTTLYLRFNRITTVEKDIKNLSKLSMLSIRENKIKQLPAEIGELCNLITLDVAHN 248

Query: 543 RLKQLPESLGSCYSLEELLANDNLIEELPHTVCN 644
+L+ LP+ +G+C + L N + +LP T+ N
Sbjct: 249 QLEHLPKEIGNCTQITNLDLQHNELLDLPDTIGN 282



Score = 72.4 bits (176), Expect = 2e-12
Identities = 47/159 (29%), Positives = 79/159 (49%)
Frame = +3

Query: 162 KTTGIVGLRDSNLKTLPSQVLDLARSVRTLDVTHNKLVDLPVEIGGLINLQRLMVAENLL 341
K ++ LR + L+ +PS V L S+ TL + N++ + +I L L L + EN +
Sbjct: 169 KKLRMLDLRHNKLREIPSVVYRLD-SLTTLYLRFNRITTVEKDIKNLSKLSMLSIRENKI 227

Query: 342 RRWPSSLFFLPALTVLALDENKKTTLPDELGLLVRLERFXXXXXXXXXXXXAIGSLRNLT 521
++ P+ + L L L + N+ LP E+G ++ IG+L +L+
Sbjct: 228 KQLPAEIGELCNLITLDVAHNQLEHLPKEIGNCTQITNLDLQHNELLDLPDTIGNLSSLS 287

Query: 522 LLNISHNRLKQLPESLGSCYSLEELLANDNLIEELPHTV 638
L + +NRL +P SL C +LEEL +N I LP ++
Sbjct: 288 RLGLRYNRLSAIPRSLAKCSALEELNLENNNISTLPESL 326



Score = 57.8 bits (138), Expect = 5e-08
Identities = 49/192 (25%), Positives = 84/192 (43%), Gaps = 4/192 (2%)
Frame = +3

Query: 75 TLGLLPDLESMGCCMSKQQVARANRAAKWKTTGIVGLRDSNLKTLPSQVLDLARSVRTLD 254
T+G L L +G ++ A AK + L ++N+ TLP +L + +L
Sbjct: 279 TIGNLSSLSRLGLRYNRLS-AIPRSLAKCSALEELNLENNNISTLPESLLSSLVKLNSLT 337

Query: 255 VTHNKLVDLPVEIGG---LINLQRLMVAENLLRRWPSSLFF-LPALTVLALDENKKTTLP 422
+ N PV GG + L + N + + P +F L+ L + +N+ T+LP
Sbjct: 338 LARNCFQLYPV--GGPSQFSTIYSLNMEHNRINKIPFGIFSRAKVLSKLNMKDNQLTSLP 395

Query: 423 DELGLLVRLERFXXXXXXXXXXXXAIGSLRNLTLLNISHNRLKQLPESLGSCYSLEELLA 602
+ G + + L +L +L +S+N LK+LP LG+ L EL
Sbjct: 396 LDFGTWTSMVELNLATNQLTKIPEDVSGLVSLEVLILSNNLLKKLPHGLGNLRKLRELDL 455

Query: 603 NDNLIEELPHTV 638
+N +E LP+ +
Sbjct: 456 EENKLESLPNEI 467



Score = 53.1 bits (126), Expect = 1e-06
Identities = 39/135 (28%), Positives = 60/135 (44%), Gaps = 3/135 (2%)
Frame = +3

Query: 249 LDVTHNKLVDLPVEIGGLINLQRLMVAENLLRRWPSSLFFLPALTVLALDENKKTTLPDE 428
LD++ + LP I L L L + N L+ P+ + L L LAL EN T+LPD
Sbjct: 105 LDLSKRSIHILPSSIKELTQLTELYLYSNKLQSLPAEVGCLVNLMTLALSENSLTSLPDS 164

Query: 429 LGLLVRLERFXXXXXXXXXXXXAIGSLRNLTLLNISHNRLKQLPESLGSCYSLEELLAND 608
L L +L + L +LT L + NR+ + + + + L L +
Sbjct: 165 LDNLKKLRMLDLRHNKLREIPSVVYRLDSLTTLYLRFNRITTVEKDIKNLSKLSMLSIRE 224

Query: 609 NLIEELPHTV---CN 644
N I++LP + CN
Sbjct: 225 NKIKQLPAEIGELCN 239



Score = 49.3 bits (116), Expect = 2e-05
Identities = 33/113 (29%), Positives = 54/113 (47%)
Frame = +3

Query: 306 NLQRLMVAENLLRRWPSSLFFLPALTVLALDENKKTTLPDELGLLVRLERFXXXXXXXXX 485
N RL +++ + PSS+ L LT L L NK +LP E+G LV L
Sbjct: 101 NSMRLDLSKRSIHILPSSIKELTQLTELYLYSNKLQSLPAEVGCLVNLMTLALSENSLTS 160

Query: 486 XXXAIGSLRNLTLLNISHNRLKQLPESLGSCYSLEELLANDNLIEELPHTVCN 644
++ +L+ L +L++ HN+L+++P + SL L N I + + N
Sbjct: 161 LPDSLDNLKKLRMLDLRHNKLREIPSVVYRLDSLTTLYLRFNRITTVEKDIKN 213


tr_hit_id Q9SD93
Definition tr|Q9SD93|Q9SD93_ARATH Putative uncharacterized protein F13G24.110 (Arabidopsis thaliana genomic DNA, chromosome 5, P1 clone:MXM12) OS=Arabidopsis thaliana
Align length 181
Score (bit) 204.0
E-value 3.0e-51
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= DK950998|Adiantum capillus-veneris mRNA, clone:
TST38A01NGRL0010_D11, 5'
(646 letters)

Database: uniprot_trembl.fasta
7,341,751 sequences; 2,391,615,440 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

tr|Q9SD93|Q9SD93_ARATH Putative uncharacterized protein F13G24.1... 204 3e-51
tr|Q8RWI2|Q8RWI2_ARATH Putative uncharacterized protein At5g0791... 204 3e-51
tr|B6T176|B6T176_MAIZE LAP4 protein OS=Zea mays PE=2 SV=1 179 2e-43
tr|A9TS86|A9TS86_PHYPA Predicted protein OS=Physcomitrella paten... 177 4e-43
tr|B8AQV9|B8AQV9_ORYSI Putative uncharacterized protein OS=Oryza... 174 4e-42
tr|A3AFE7|A3AFE7_ORYSJ Putative uncharacterized protein OS=Oryza... 174 4e-42
tr|A7PDF2|A7PDF2_VITVI Chromosome chr17 scaffold_12, whole genom... 171 4e-41
tr|Q10Q27|Q10Q27_ORYSJ Leucine Rich Repeat family protein, expre... 137 4e-31
tr|A9PGU0|A9PGU0_POPTR Putative uncharacterized protein OS=Popul... 109 2e-22
tr|A8IJL5|A8IJL5_CHLRE Predicted protein OS=Chlamydomonas reinha... 109 2e-22
tr|Q7XDQ7|Q7XDQ7_ORYSJ Os10g0456200 protein OS=Oryza sativa subs... 108 3e-22
tr|B6T4S8|B6T4S8_MAIZE Small GTP-binding protein domain OS=Zea m... 105 2e-21
tr|A9SSM9|A9SSM9_PHYPA Predicted protein OS=Physcomitrella paten... 105 2e-21
tr|A7NYA9|A7NYA9_VITVI Chromosome chr6 scaffold_3, whole genome ... 101 4e-20
tr|A5B0K2|A5B0K2_VITVI Putative uncharacterized protein OS=Vitis... 101 4e-20
tr|Q337P4|Q337P4_ORYSJ Ubiquitin family protein, putative, expre... 100 8e-20
tr|Q72TC3|Q72TC3_LEPIC Putative uncharacterized protein OS=Lepto... 97 8e-19
tr|B4K6Y7|B4K6Y7_DROMO GI22874 OS=Drosophila mojavensis GN=GI228... 95 3e-18
tr|A9JS95|A9JS95_XENLA LOC100127343 protein (Fragment) OS=Xenopu... 95 4e-18
tr|Q7ZZ35|Q7ZZ35_DANRE Novel protein similar to human scribble (... 93 1e-17
tr|Q4S1G7|Q4S1G7_TETNG Chromosome 6 SCAF14768, whole genome shot... 93 1e-17
tr|Q4H4B6|Q4H4B6_DANRE Scribble1 OS=Danio rerio GN=scrib PE=1 SV=1 93 1e-17
tr|Q72S79|Q72S79_LEPIC Putative uncharacterized protein OS=Lepto... 93 1e-17
tr|B6KXB8|B6KXB8_BRAFL Putative uncharacterized protein (Fragmen... 93 1e-17
tr|A1ZTY9|A1ZTY9_9SPHI Leucine-rich repeat containing protein OS... 93 2e-17
tr|B4K7L3|B4K7L3_DROMO GI22824 OS=Drosophila mojavensis GN=GI228... 93 2e-17
tr|Q8F3F9|Q8F3F9_LEPIN Putative outermembrane protein OS=Leptosp... 92 3e-17
tr|Q8F213|Q8F213_LEPIN Leucine-rich repeat containing protein OS... 92 3e-17
tr|B4JGP0|B4JGP0_DROGR GH18723 OS=Drosophila grimshawi GN=GH1872... 92 3e-17
tr|Q466H0|Q466H0_METBF Putative uncharacterized protein OS=Metha... 92 3e-17

>tr|Q9SD93|Q9SD93_ARATH Putative uncharacterized protein F13G24.110
(Arabidopsis thaliana genomic DNA, chromosome 5, P1
clone:MXM12) OS=Arabidopsis thaliana GN=F13G24.110 PE=4
SV=1
Length = 268

Score = 204 bits (520), Expect = 3e-51
Identities = 103/181 (56%), Positives = 135/181 (74%), Gaps = 1/181 (0%)
Frame = +3

Query: 105 MGCCMSKQQV-ARANRAAKWKTTGIVGLRDSNLKTLPSQVLDLARSVRTLDVTHNKLVDL 281
MGCC S ++ANR ++W++TGIVGLRDS LKT P +V+++ R+VRTLD+THNK+ D+
Sbjct: 1 MGCCASNTAGGSKANRISRWRSTGIVGLRDSKLKTFPDEVIEMERAVRTLDLTHNKIADV 60

Query: 282 PVEIGGLINLQRLMVAENLLRRWPSSLFFLPALTVLALDENKKTTLPDELGLLVRLERFX 461
P EI LIN+QRL++A+NL+ R P +L L +L VL LD N+ + LPDELG LVRLE+
Sbjct: 61 PGEISKLINMQRLLIADNLVERLPGNLGKLQSLKVLMLDGNRISCLPDELGQLVRLEQLS 120

Query: 462 XXXXXXXXXXXAIGSLRNLTLLNISHNRLKQLPESLGSCYSLEELLANDNLIEELPHTVC 641
IGSLRNL LLN+S+NRLK LPES+GSC SLEE+ ANDN++EELP ++C
Sbjct: 121 ISRNMLIYLPDTIGSLRNLLLLNVSNNRLKSLPESVGSCASLEEVQANDNVVEELPASLC 180

Query: 642 N 644
N
Sbjct: 181 N 181


>tr|Q8RWI2|Q8RWI2_ARATH Putative uncharacterized protein At5g07910
OS=Arabidopsis thaliana GN=At5g07910 PE=2 SV=1
Length = 262

Score = 204 bits (520), Expect = 3e-51
Identities = 103/181 (56%), Positives = 135/181 (74%), Gaps = 1/181 (0%)
Frame = +3

Query: 105 MGCCMSKQQV-ARANRAAKWKTTGIVGLRDSNLKTLPSQVLDLARSVRTLDVTHNKLVDL 281
MGCC S ++ANR ++W++TGIVGLRDS LKT P +V+++ R+VRTLD+THNK+ D+
Sbjct: 1 MGCCASNTAGGSKANRISRWRSTGIVGLRDSKLKTFPDEVIEMERAVRTLDLTHNKIADV 60

Query: 282 PVEIGGLINLQRLMVAENLLRRWPSSLFFLPALTVLALDENKKTTLPDELGLLVRLERFX 461
P EI LIN+QRL++A+NL+ R P +L L +L VL LD N+ + LPDELG LVRLE+
Sbjct: 61 PGEISKLINMQRLLIADNLVERLPGNLGKLQSLKVLMLDGNRISCLPDELGQLVRLEQLS 120

Query: 462 XXXXXXXXXXXAIGSLRNLTLLNISHNRLKQLPESLGSCYSLEELLANDNLIEELPHTVC 641
IGSLRNL LLN+S+NRLK LPES+GSC SLEE+ ANDN++EELP ++C
Sbjct: 121 ISRNMLIYLPDTIGSLRNLLLLNVSNNRLKSLPESVGSCASLEEVQANDNVVEELPASLC 180

Query: 642 N 644
N
Sbjct: 181 N 181


>tr|B6T176|B6T176_MAIZE LAP4 protein OS=Zea mays PE=2 SV=1
Length = 262

Score = 179 bits (453), Expect = 2e-43
Identities = 85/180 (47%), Positives = 127/180 (70%)
Frame = +3

Query: 105 MGCCMSKQQVARANRAAKWKTTGIVGLRDSNLKTLPSQVLDLARSVRTLDVTHNKLVDLP 284
MGCC S+ + A+R +W++TGIV LRD+ LK +P++VL + S+RTLD+T+NKLV++P
Sbjct: 1 MGCCSSRSSDSPASRVTRWRSTGIVALRDARLKEVPNEVLQVGNSLRTLDLTNNKLVEIP 60

Query: 285 VEIGGLINLQRLMVAENLLRRWPSSLFFLPALTVLALDENKKTTLPDELGLLVRLERFXX 464
EIG L N+QRL++A NL+ P+++ +L L +L LD N+ + LP+ELG L L++
Sbjct: 61 QEIGTLANMQRLVLAGNLIEIIPANIGYLQNLKILTLDRNRISILPEELGSLSNLQQLSV 120

Query: 465 XXXXXXXXXXAIGSLRNLTLLNISHNRLKQLPESLGSCYSLEELLANDNLIEELPHTVCN 644
+IG LRN+++LN+S N+LK+LPES+G C SLEE AN N IE++P ++CN
Sbjct: 121 PQNFLLCLPKSIGDLRNMSVLNVSDNKLKELPESIGGCSSLEEFQANGNAIEDVPASICN 180


>tr|A9TS86|A9TS86_PHYPA Predicted protein OS=Physcomitrella patens
subsp. patens GN=PHYPADRAFT_149714 PE=4 SV=1
Length = 267

Score = 177 bits (450), Expect = 4e-43
Identities = 92/176 (52%), Positives = 123/176 (69%), Gaps = 1/176 (0%)
Frame = +3

Query: 105 MGCCMSKQQ-VARANRAAKWKTTGIVGLRDSNLKTLPSQVLDLARSVRTLDVTHNKLVDL 281
MGCC +K +++ +RA +W++TGIV LRDS LK LP V+ +A SVRTLD THNKL +
Sbjct: 1 MGCCQAKPGGLSKDDRATRWRSTGIVALRDSKLKELPVDVVSIAASVRTLDATHNKLGSI 60

Query: 282 PVEIGGLINLQRLMVAENLLRRWPSSLFFLPALTVLALDENKKTTLPDELGLLVRLERFX 461
P EI +NLQRL++ ENLL R P ++ L +L VL LD N+ + LP+E+GLL RLERF
Sbjct: 61 PEEIENFVNLQRLILVENLLERLPLTVGKLRSLKVLLLDSNRLSLLPEEVGLLQRLERFS 120

Query: 462 XXXXXXXXXXXAIGSLRNLTLLNISHNRLKQLPESLGSCYSLEELLANDNLIEELP 629
IG+L NL L++S N L+ LPES+G+C SLEEL+ANDN+++ELP
Sbjct: 121 VSGNNLKSLPSTIGNLSNLIQLDVSKNSLETLPESIGNCKSLEELIANDNMLQELP 176



Score = 35.4 bits (80), Expect = 3.0
Identities = 15/38 (39%), Positives = 26/38 (68%)
Frame = +3

Query: 525 LNISHNRLKQLPESLGSCYSLEELLANDNLIEELPHTV 638
L+ +HN+L +PE + + +L+ L+ +NL+E LP TV
Sbjct: 50 LDATHNKLGSIPEEIENFVNLQRLILVENLLERLPLTV 87


>tr|B8AQV9|B8AQV9_ORYSI Putative uncharacterized protein OS=Oryza
sativa subsp. indica GN=OsI_10500 PE=4 SV=1
Length = 262

Score = 174 bits (441), Expect = 4e-42
Identities = 82/180 (45%), Positives = 124/180 (68%)
Frame = +3

Query: 105 MGCCMSKQQVARANRAAKWKTTGIVGLRDSNLKTLPSQVLDLARSVRTLDVTHNKLVDLP 284
MGCC S+ + A+R +W++TGIV LRD+ LK +P++VL + S+R LD+T+NK+ ++P
Sbjct: 1 MGCCSSRSADSPASRVTRWRSTGIVALRDARLKVVPNEVLQVGNSLRILDLTNNKIAEIP 60

Query: 285 VEIGGLINLQRLMVAENLLRRWPSSLFFLPALTVLALDENKKTTLPDELGLLVRLERFXX 464
E+G L+N+QRL++A NL+ P+++ +L L +L LD NK + LP+ELG L L++
Sbjct: 61 QEVGTLVNMQRLVLAGNLVESIPANIGYLRNLKILTLDRNKISVLPEELGSLSNLQQLSI 120

Query: 465 XXXXXXXXXXAIGSLRNLTLLNISHNRLKQLPESLGSCYSLEELLANDNLIEELPHTVCN 644
++G LRN+ LLN+S N+L LPES+G C SLEEL AN N IE++P ++CN
Sbjct: 121 SQNSLSRLPKSVGDLRNMLLLNVSDNKLIALPESIGGCSSLEELQANGNSIEDVPSSICN 180


>tr|A3AFE7|A3AFE7_ORYSJ Putative uncharacterized protein OS=Oryza
sativa subsp. japonica GN=OsJ_009519 PE=4 SV=1
Length = 233

Score = 174 bits (441), Expect = 4e-42
Identities = 82/180 (45%), Positives = 124/180 (68%)
Frame = +3

Query: 105 MGCCMSKQQVARANRAAKWKTTGIVGLRDSNLKTLPSQVLDLARSVRTLDVTHNKLVDLP 284
MGCC S+ + A+R +W++TGIV LRD+ LK +P++VL + S+R LD+T+NK+ ++P
Sbjct: 1 MGCCSSRSADSPASRVTRWRSTGIVALRDARLKVVPNEVLQVGNSLRILDLTNNKIAEIP 60

Query: 285 VEIGGLINLQRLMVAENLLRRWPSSLFFLPALTVLALDENKKTTLPDELGLLVRLERFXX 464
E+G L+N+QRL++A NL+ P+++ +L L +L LD NK + LP+ELG L L++
Sbjct: 61 QEVGTLVNMQRLVLAGNLVESIPANIGYLRNLKILTLDRNKISVLPEELGSLSNLQQLSI 120

Query: 465 XXXXXXXXXXAIGSLRNLTLLNISHNRLKQLPESLGSCYSLEELLANDNLIEELPHTVCN 644
++G LRN+ LLN+S N+L LPES+G C SLEEL AN N IE++P ++CN
Sbjct: 121 SQNSLSRLPKSVGDLRNMLLLNVSDNKLIALPESIGGCSSLEELQANGNSIEDVPSSICN 180


>tr|A7PDF2|A7PDF2_VITVI Chromosome chr17 scaffold_12, whole genome
shotgun sequence OS=Vitis vinifera GN=GSVIVT00016257001
PE=4 SV=1
Length = 246

Score = 171 bits (433), Expect = 4e-41
Identities = 87/148 (58%), Positives = 111/148 (75%)
Frame = +3

Query: 201 KTLPSQVLDLARSVRTLDVTHNKLVDLPVEIGGLINLQRLMVAENLLRRWPSSLFFLPAL 380
+ P +VLDL SVRTLD+THN+LVD+P+EI LIN+QRL++A+NL+ R P +L L +L
Sbjct: 28 QAFPDEVLDLDTSVRTLDLTHNRLVDIPMEISKLINMQRLILADNLIERLPMNLGKLQSL 87

Query: 381 TVLALDENKKTTLPDELGLLVRLERFXXXXXXXXXXXXAIGSLRNLTLLNISHNRLKQLP 560
V+ LD N+ TTLPDELG+LVRLER IGSLRNL LLN+S+N+LK LP
Sbjct: 88 KVMTLDGNQVTTLPDELGMLVRLERLSISGNLLTCLPETIGSLRNLLLLNVSNNKLKCLP 147

Query: 561 ESLGSCYSLEELLANDNLIEELPHTVCN 644
ES+GSC+SLEEL ANDN IE++P + CN
Sbjct: 148 ESVGSCFSLEELQANDNSIEDIPASFCN 175


>tr|Q10Q27|Q10Q27_ORYSJ Leucine Rich Repeat family protein,
expressed OS=Oryza sativa subsp. japonica
GN=LOC_Os03g11360 PE=4 SV=1
Length = 266

Score = 137 bits (346), Expect = 4e-31
Identities = 69/160 (43%), Positives = 106/160 (66%), Gaps = 2/160 (1%)
Frame = +3

Query: 171 GIVGLRDSNL--KTLPSQVLDLARSVRTLDVTHNKLVDLPVEIGGLINLQRLMVAENLLR 344
G+VG N + +P++VL + S+R LD+T+NK+ ++P E+G L+N+QRL++A NL+
Sbjct: 25 GLVGETKINASREVVPNEVLQVGNSLRILDLTNNKIAEIPQEVGTLVNMQRLVLAGNLVE 84

Query: 345 RWPSSLFFLPALTVLALDENKKTTLPDELGLLVRLERFXXXXXXXXXXXXAIGSLRNLTL 524
P+++ +L L +L LD NK + LP+ELG L L++ ++G LRN+ L
Sbjct: 85 SIPANIGYLRNLKILTLDRNKISVLPEELGSLSNLQQLSISQNSLSRLPKSVGDLRNMLL 144

Query: 525 LNISHNRLKQLPESLGSCYSLEELLANDNLIEELPHTVCN 644
LN+S N+L LPES+G C SLEEL AN N IE++P ++CN
Sbjct: 145 LNVSDNKLIALPESIGGCSSLEELQANGNSIEDVPSSICN 184



Score = 68.6 bits (166), Expect = 3e-10
Identities = 43/141 (30%), Positives = 80/141 (56%), Gaps = 1/141 (0%)
Frame = +3

Query: 198 LKTLPSQVLDLARSVRTLDVTHNKLVDLPVEIGGLINLQRLMVAENLLRRWPSSLFFLPA 377
++++P+ + L R+++ L + NK+ LP E+G L NLQ+L +++N L R P S+ L
Sbjct: 83 VESIPANIGYL-RNLKILTLDRNKISVLPEELGSLSNLQQLSISQNSLSRLPKSVGDLRN 141

Query: 378 LTVLALDENKKTTLPDELGLLVRLERFXXXXXXXXXXXXAIGSLRNLTLLNISHNRLKQL 557
+ +L + +NK LP+ +G LE +I +L L L+++ N+++QL
Sbjct: 142 MLLLNVSDNKLIALPESIGGCSSLEELQANGNSIEDVPSSICNLVCLKSLSLNGNKIRQL 201

Query: 558 PES-LGSCYSLEELLANDNLI 617
P++ L C +L+ + +DN I
Sbjct: 202 PQNLLKDCKALQNISLHDNPI 222


>tr|A9PGU0|A9PGU0_POPTR Putative uncharacterized protein OS=Populus
trichocarpa PE=2 SV=1
Length = 371

Score = 109 bits (272), Expect = 2e-22
Identities = 59/168 (35%), Positives = 94/168 (55%), Gaps = 4/168 (2%)
Frame = +3

Query: 144 NRAAKWKTTGIVGLRDSNLKTLPSQVLDLARSVRTLDVTHNKLVDLPVEIGGLINLQRLM 323
NR +WK TG++GL + NLK +P +V S R LD+++N ++D+P +IG L ++Q+ +
Sbjct: 121 NRVERWKVTGVIGLAECNLKAIPEEVWTCGPSTRVLDISNNFILDVPAQIGCLSSMQKFL 180

Query: 324 VAENLLR----RWPSSLFFLPALTVLALDENKKTTLPDELGLLVRLERFXXXXXXXXXXX 491
+ N + +W L L LTVL++ N +TLP ELG L L +
Sbjct: 181 LNGNGMLDECIKW-KGLTSLKHLTVLSVSHNNLSTLPSELGALCSLRQLHVSNNKLSSLP 239

Query: 492 XAIGSLRNLTLLNISHNRLKQLPESLGSCYSLEELLANDNLIEELPHT 635
IG L L +L +++NR+ +P +G C SL E+ + NL+ +LP T
Sbjct: 240 MEIGLLTQLEVLKVNNNRISNVPMCIGDCSSLAEVDLSSNLLTDLPVT 287



Score = 55.1 bits (131), Expect = 4e-06
Identities = 48/166 (28%), Positives = 71/166 (42%), Gaps = 11/166 (6%)
Frame = +3

Query: 105 MGCCMSKQQV-----ARANRAAKWKTTG------IVGLRDSNLKTLPSQVLDLARSVRTL 251
+GC S Q+ + KWK ++ + +NL TLPS++ L S+R L
Sbjct: 170 IGCLSSMQKFLLNGNGMLDECIKWKGLTSLKHLTVLSVSHNNLSTLPSELGALC-SLRQL 228

Query: 252 DVTHNKLVDLPVEIGGLINLQRLMVAENLLRRWPSSLFFLPALTVLALDENKKTTLPDEL 431
V++NKL LP+EIG L L+ L V N + P + +L + L N T LP
Sbjct: 229 HVSNNKLSSLPMEIGLLTQLEVLKVNNNRISNVPMCIGDCSSLAEVDLSSNLLTDLP--- 285

Query: 432 GLLVRLERFXXXXXXXXXXXXAIGSLRNLTLLNISHNRLKQLPESL 569
G L NL L++ +N LK LP ++
Sbjct: 286 --------------------VTFGDLLNLKALHLGNNGLKSLPSTI 311



Score = 40.0 bits (92), Expect = 0.12
Identities = 20/64 (31%), Positives = 39/64 (60%)
Frame = +3

Query: 174 IVGLRDSNLKTLPSQVLDLARSVRTLDVTHNKLVDLPVEIGGLINLQRLMVAENLLRRWP 353
++ + ++ + +P + D + S+ +D++ N L DLPV G L+NL+ L + N L+ P
Sbjct: 250 VLKVNNNRISNVPMCIGDCS-SLAEVDLSSNLLTDLPVTFGDLLNLKALHLGNNGLKSLP 308

Query: 354 SSLF 365
S++F
Sbjct: 309 STIF 312


>tr|A8IJL5|A8IJL5_CHLRE Predicted protein OS=Chlamydomonas
reinhardtii GN=CHLREDRAFT_100208 PE=4 SV=1
Length = 265

Score = 109 bits (272), Expect = 2e-22
Identities = 65/167 (38%), Positives = 95/167 (56%), Gaps = 2/167 (1%)
Frame = +3

Query: 135 ARANRAAKWKTTGIVGLRDSNLKTLPSQVLDLARSVRTLDVTHNKLVDLPVEIGGLINLQ 314
A A + W TGIVGLRD +K LP+ + ++A +V+ +D ++N++ LP + L NLQ
Sbjct: 5 ASAQQQNTWSKTGIVGLRDQGIKELPAVLSEIADTVKVIDASNNRITALPAFLPTLANLQ 64

Query: 315 RLMVAENLLRRW--PSSLFFLPALTVLALDENKKTTLPDELGLLVRLERFXXXXXXXXXX 488
RL ++ NLL P + L +L +L LD+N+ LP+++G L RLER
Sbjct: 65 RLTLSGNLLTVLLPPGACAGLTSLKLLVLDDNQLGDLPEDIGSLRRLERLSVSGNRLRTL 124

Query: 489 XXAIGSLRNLTLLNISHNRLKQLPESLGSCYSLEELLANDNLIEELP 629
+IG L L L +S N L+QLP+SL C LEEL A N + +P
Sbjct: 125 PDSIGQLEALQSLVVSRNCLEQLPDSLAGCGMLEELDAQSNDLAVVP 171