DK951023
Clone id TST38A01NGRL0010_E14
Library
Length 667
Definition Adiantum capillus-veneris mRNA. clone: TST38A01NGRL0010_E14. 5' end sequence.
Accession
Tissue type prothallia
Developmental stage gametophyte
Contig ID -
Sequence
CCAAAAGTTGGCAATGATACTGATGGCATCGTTGCTTCTCCTGATGATGTCGATGATGCT
TTTGTCCATTATGAGGCTGACAAAGATGACGATGAGAATGAATTCTTGGACAGTATCAAC
AACGATGGGCAACATGTCGAAGACGAGGTCAGTGTAAATGCTTATGCAGACAATAAGGTT
GATGAGTTTCCAGATAATGGAACCCATATTAGTAAGAAACTCGAAACAGAAAGTAATGAA
ATGGTGCATCTTATCACAGAGAACTTTGCTAATGAGAGGGTAGAAAGACCTATGCAGAGA
AGGAAATTAACATACTCCAAACGCTCATTCAAAGCAGGTTCTCGCAAATATACATTTTCG
AAAGGTATTTTGGGTTCTCATGATGTCATACAGCAGGACCTAATTAAGCATGATTCTGTA
CAGGAAAATGAAAAGGTGAAGTCTCTGGTTACGGCAAGTCAATTGCTCTCTATTCCATCC
ACTGGGAGACAAAAAACATCACCGTCTGAGACAAAGCAGATTTGGAGAAAGGGGGAAGGT
TTATCAGGGTATATACCTGGCCAGAATAAACAGCAAGCGACTGAAAATATAAGGTTGGTT
GAACAAATGGAGGGTTTTTATGGTGTTGTACCTAGCTATGGTAAGCAGCAACAAGCAGCT
GAAAAGA
■■Homology search results ■■ -
sp_hit_id P10923
Definition sp|P10923|OSTP_MOUSE Osteopontin OS=Mus musculus
Align length 147
Score (bit) 37.4
E-value 0.073
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= DK951023|Adiantum capillus-veneris mRNA, clone:
TST38A01NGRL0010_E14, 5'
(667 letters)

Database: uniprot_sprot.fasta
412,525 sequences; 148,809,765 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

sp|P10923|OSTP_MOUSE Osteopontin OS=Mus musculus GN=Spp1 PE=1 SV=1 37 0.073
sp|Q498F0|WDR44_XENLA WD repeat-containing protein 44 OS=Xenopus... 37 0.12
sp|Q12234|RUD3_YEAST GRIP domain-containing protein RUD3 OS=Sacc... 36 0.16
sp|Q6YRL3|DNAA_ONYPE Chromosomal replication initiator protein d... 36 0.21
sp|P10451|OSTP_HUMAN Osteopontin OS=Homo sapiens GN=SPP1 PE=1 SV=1 35 0.28
sp|Q54NP8|KIF4_DICDI Kinesin-related protein 4 OS=Dictyostelium ... 35 0.36
sp|Q6BQ20|ATG13_DEBHA Autophagy-related protein 13 OS=Debaryomyc... 35 0.36
sp|Q5BCN2|SPT5_EMENI Transcription elongation factor spt5 OS=Eme... 35 0.47
sp|P47245|NRDC_RAT Nardilysin OS=Rattus norvegicus GN=Nrd1 PE=2 ... 35 0.47
sp|Q8XLF7|KCY_CLOPE Cytidylate kinase OS=Clostridium perfringens... 35 0.47
sp|Q0TRF4|KCY_CLOP1 Cytidylate kinase OS=Clostridium perfringens... 35 0.47
sp|P08721|OSTP_RAT Osteopontin OS=Rattus norvegicus GN=Spp1 PE=1... 34 0.61
sp|Q6BWJ5|JIP5_DEBHA WD repeat-containing protein JIP5 OS=Debary... 34 0.61
sp|Q54GS1|CL16A_DICDI Protein CLEC16A homolog OS=Dictyostelium d... 34 0.61
sp|Q8ILR9|HLRR1_PLAF7 LRR domain-containing protein PF14_0175 OS... 34 0.80
sp|P54682|D7_DICDI cAMP-inducible prespore protein D7 OS=Dictyos... 34 0.80
sp|Q54G02|SPXS5_DICDI SPX and EXS domain-containing protein 5 OS... 33 1.0
sp|P23615|SPT6_YEAST Transcription elongation factor SPT6 OS=Sac... 33 1.4
sp|Q9UPQ7|PZRN3_HUMAN PDZ domain-containing RING finger protein ... 33 1.4
sp|Q0STT4|KCY_CLOPS Cytidylate kinase OS=Clostridium perfringens... 33 1.4
sp|Q2NKC5|DNAA_AYWBP Chromosomal replication initiator protein d... 33 1.4
sp|P32597|STH1_YEAST Nuclear protein STH1/NPS1 OS=Saccharomyces ... 33 1.8
sp|Q8BHG1|NRDC_MOUSE Nardilysin OS=Mus musculus GN=Nrd1 PE=2 SV=1 33 1.8
sp|Q9UIF8|BAZ2B_HUMAN Bromodomain adjacent to zinc finger domain... 33 1.8
sp|Q5UPA5|YL032_MIMIV Putative KilA-N domain-containing protein ... 32 2.3
sp|A2AIV2|VIR_MOUSE Protein virilizer homolog OS=Mus musculus GN... 32 2.3
sp|P27715|UNC13_CAEEL Phorbol ester/diacylglycerol-binding prote... 32 2.3
sp|Q8EM52|RPOE_OCEIH Probable DNA-directed RNA polymerase subuni... 32 2.3
sp|P68907|PZRN3_RAT PDZ domain-containing RING finger protein 3 ... 32 2.3
sp|Q69ZS0|PZRN3_MOUSE PDZ domain-containing RING finger protein ... 32 2.3

>sp|P10923|OSTP_MOUSE Osteopontin OS=Mus musculus GN=Spp1 PE=1 SV=1
Length = 294

Score = 37.4 bits (85), Expect = 0.073
Identities = 32/147 (21%), Positives = 64/147 (43%)
Frame = +1

Query: 40 PDDVDDAFVHYEADKDDDENEFLDSINNDGQHVEDEVSVNAYADNKVDEFPDNGTHISKK 219
P + +++ H + D DDD++ DG H E E SV++ ++ ++ ++
Sbjct: 74 PSNSNESHDHMDDDDDDDDD--------DGDHAESEDSVDSDESDESHHSDESDETVTAS 125

Query: 220 LETESNEMVHLITENFANERVERPMQRRKLTYSKRSFKAGSRKYTFSKGILGSHDVIQQD 399
+ ++ + + T + N R + L RSF+ +Y D +D
Sbjct: 126 TQADTFTPI-VPTVDVPNGRGDSLAYG--LRSKSRSFQVSDEQYP---------DATDED 173

Query: 400 LIKHDSVQENEKVKSLVTASQLLSIPS 480
L H E+++ ++ +QLLS+PS
Sbjct: 174 LTSHMKSGESKESLDVIPVAQLLSMPS 200


>sp|Q498F0|WDR44_XENLA WD repeat-containing protein 44 OS=Xenopus
laevis GN=wdr44 PE=2 SV=1
Length = 912

Score = 36.6 bits (83), Expect = 0.12
Identities = 22/80 (27%), Positives = 38/80 (47%), Gaps = 2/80 (2%)
Frame = +1

Query: 82 KDDDENEFLDSINNDGQHVEDEVSVNAYADNKVDEFPDN--GTHISKKLETESNEMVHLI 255
K DD E +DSI + Q D + N + K + + G + K + SN ++
Sbjct: 53 KQDDSKEIIDSIIEESQKCSDTENENPVVEEKTEVLHETLIGDSVKTKQDLLSNIPELVV 112

Query: 256 TENFANERVERPMQRRKLTY 315
TE+ ++ VE P+Q++ Y
Sbjct: 113 TESTFHDGVEDPLQQQISEY 132


>sp|Q12234|RUD3_YEAST GRIP domain-containing protein RUD3
OS=Saccharomyces cerevisiae GN=RUD3 PE=1 SV=1
Length = 484

Score = 36.2 bits (82), Expect = 0.16
Identities = 47/163 (28%), Positives = 71/163 (43%), Gaps = 9/163 (5%)
Frame = +1

Query: 1 PKVGND--TDGIVASPDDVDDAFVHYEADKDDDENEFLDSIN-NDGQHVEDEVSVNAYAD 171
PK+ D DGIVASPD D+ D +E +D NDG V+ ++N D
Sbjct: 41 PKMSTDPEADGIVASPD-----------DEGKDLSEGVDKQKVNDGLTVD---TINPLED 86

Query: 172 NKV-DEFPDNGTHISK-KLETESNEMVHLITENFANE--RVERPMQRRKLTYSKRSFKAG 339
K DE + I + KLE + E+F NE V + K Y K
Sbjct: 87 KKAGDEMKELREEIERLKLELSHKKDQETPNEDFKNELANVIKERDEFKTQYDTLLSKIS 146

Query: 340 SRKYTFSKGILGSHDV--IQQDLIKHDSVQENEKVKSLVTASQ 462
S K F+K + +Q+ L +++S +N K+K + A++
Sbjct: 147 SMKSIFNKMKEAQKQLEEVQEQLTEYES--QNLKLKKKLEATK 187


>sp|Q6YRL3|DNAA_ONYPE Chromosomal replication initiator protein dnaA
OS=Onion yellows phytoplasma GN=dnaA PE=3 SV=1
Length = 507

Score = 35.8 bits (81), Expect = 0.21
Identities = 42/191 (21%), Positives = 76/191 (39%), Gaps = 12/191 (6%)
Frame = +1

Query: 52 DDAFVHYEADKDDDENE---FLDSINNDGQHVEDEVSVNAYADNKVDEFPDNGTHISKKL 222
DD H+E K+ ENE + I N+ + DEF +N K
Sbjct: 90 DDEKKHFENLKEKLENENQTYFSKIENNENN---------------DEFQNN-----KYF 129

Query: 223 ETESNEMVHLITENFANERVERPMQRRKLTYSKRSFKAGSRKYTFSKGILGSHDVIQQDL 402
ET E + T+N N +E RK++++K ++ + KY+F ++G + +
Sbjct: 130 ETIEKEQIETKTDNDKNVEIEN----RKISFNKYNYGNTNPKYSFDNFVVGKSNNFAFKI 185

Query: 403 IKHDSVQENEKV---------KSLVTASQLLSIPSTGRQKTSPSETKQIWRKGEGLSGYI 555
K + E +KV K+ + + L+ K + S K ++ K +G
Sbjct: 186 AK--KIAEEKKVTTNPLYIFGKAGIGKTHLIQAIGNHILKKTHSSKKVLYVKADGFIEEF 243

Query: 556 PGQNKQQATEN 588
Q ++ E+
Sbjct: 244 TNQLRKAKMED 254


>sp|P10451|OSTP_HUMAN Osteopontin OS=Homo sapiens GN=SPP1 PE=1 SV=1
Length = 314

Score = 35.4 bits (80), Expect = 0.28
Identities = 34/169 (20%), Positives = 69/169 (40%), Gaps = 7/169 (4%)
Frame = +1

Query: 37 SPDDVDDAFVHYEADKDDDENEFLDSINN--DGQHVEDEVSVNAYADNKVDEFPDNGTHI 210
S ++ +D K ++ ++ +D +++ D HV+ + S+++ + VD+ D+
Sbjct: 62 SSEETNDFKQETLPSKSNESHDHMDDMDDEDDDDHVDSQDSIDSNDSDDVDDTDDSHQSD 121

Query: 211 SKKLETESNEMVHLITENFANERVERPMQRRKLTYSKRS----FKAGSRKYTFSKGILGS 378
ES+E+V + V P+ TY R + S+ F + +
Sbjct: 122 ESHHSDESDELVTDFPTDLPATEVFTPVVPTVDTYDGRGDSVVYGLRSKSKKFRRPDIQY 181

Query: 379 HDVIQQDLIKHDSVQENEKVKSLVTASQLLSIPSTGRQKTSPS-ETKQI 522
D +D+ H +E + +Q L+ PS + S ET Q+
Sbjct: 182 PDATDEDITSHMESEELNGAYKAIPVAQDLNAPSDWDSRGKDSYETSQL 230


>sp|Q54NP8|KIF4_DICDI Kinesin-related protein 4 OS=Dictyostelium
discoideum GN=kif4 PE=2 SV=1
Length = 1922

Score = 35.0 bits (79), Expect = 0.36
Identities = 21/62 (33%), Positives = 32/62 (51%)
Frame = +1

Query: 13 NDTDGIVASPDDVDDAFVHYEADKDDDENEFLDSINNDGQHVEDEVSVNAYADNKVDEFP 192
+D + + DD DD+ + D+D+D++E D+ N D ED N D+ DEF
Sbjct: 477 DDENNYSINQDDKDDSNYEDDDDEDEDDDEESDTDNEDD---EDNDEDNDDDDDDDDEFK 533

Query: 193 DN 198
DN
Sbjct: 534 DN 535


>sp|Q6BQ20|ATG13_DEBHA Autophagy-related protein 13 OS=Debaryomyces
hansenii GN=ATG13 PE=3 SV=2
Length = 837

Score = 35.0 bits (79), Expect = 0.36
Identities = 20/72 (27%), Positives = 40/72 (55%), Gaps = 1/72 (1%)
Frame = +1

Query: 25 GIVASPDDVDDAF-VHYEADKDDDENEFLDSINNDGQHVEDEVSVNAYADNKVDEFPDNG 201
G+ +P +D +HYE+ DDD++++ NN + + + S+ Y NK+ P +
Sbjct: 743 GLATTPSIYNDRRQIHYESVFDDDDDDY---ANNTADNRDQDDSLKLYLTNKLANAPKSN 799

Query: 202 THISKKLETESN 237
T+ S+ L++ +N
Sbjct: 800 TN-SRSLKSSTN 810


>sp|Q5BCN2|SPT5_EMENI Transcription elongation factor spt5
OS=Emericella nidulans GN=spt5 PE=3 SV=1
Length = 1016

Score = 34.7 bits (78), Expect = 0.47
Identities = 21/78 (26%), Positives = 36/78 (46%), Gaps = 4/78 (5%)
Frame = +1

Query: 58 AFVHYEADKDDDENEFLDSINNDG----QHVEDEVSVNAYADNKVDEFPDNGTHISKKLE 225
AF+ YEA D++E+E D +G QH +D + A D++ D ++ L+
Sbjct: 104 AFIDYEAGVDEEEDEVEDEEEEEGYGLEQHPDDVLPAGAETDDRQHRRLDRERELAATLD 163

Query: 226 TESNEMVHLITENFANER 279
E + L+ E + R
Sbjct: 164 AE--KQAQLLKERYGRNR 179


>sp|P47245|NRDC_RAT Nardilysin OS=Rattus norvegicus GN=Nrd1 PE=2
SV=1
Length = 1161

Score = 34.7 bits (78), Expect = 0.47
Identities = 30/111 (27%), Positives = 51/111 (45%)
Frame = +1

Query: 4 KVGNDTDGIVASPDDVDDAFVHYEADKDDDENEFLDSINNDGQHVEDEVSVNAYADNKVD 183
K GN TD ++ ++ E ++DDD+++ DS G ++D+ + D +
Sbjct: 133 KTGNATDEEEEEEEEEEEGEEEEEEEEDDDDDDDEDS----GAEIQDD-DEEGFDDE--E 185

Query: 184 EFPDNGTHISKKLETESNEMVHLITENFANERVERPMQRRKLTYSKRSFKA 336
EF D+ H L+ E NE+ E +E ++ RK T K+S A
Sbjct: 186 EF-DDDEHDDDDLDNEENEL----------EELEERVEARKKTTEKQSAAA 225


>sp|Q8XLF7|KCY_CLOPE Cytidylate kinase OS=Clostridium perfringens
GN=cmk PE=3 SV=1
Length = 217

Score = 34.7 bits (78), Expect = 0.47
Identities = 35/157 (22%), Positives = 60/157 (38%)
Frame = +1

Query: 16 DTDGIVASPDDVDDAFVHYEADKDDDENEFLDSINNDGQHVEDEVSVNAYADNKVDEFPD 195
+ D ++ D +D F + E + + L ++ N ++V S+ + V+
Sbjct: 55 EVDKLLVMIDGMDMHFENDELILNGENINSLITMPNISKNVSAYASIREVRERLVNLMRK 114

Query: 196 NGTHISKKLETESNEMVHLITENFANERVERPMQRRKLTYSKRSFKAGSRKYTFSKGILG 375
S ++ V L NF P +R Y K KG+
Sbjct: 115 MALKYSVIMDGRDIGTVVLKDANFKFFLTASPEERADRRY----------KELMGKGVEV 164

Query: 376 SHDVIQQDLIKHDSVQENEKVKSLVTASQLLSIPSTG 486
++D I QD+IK D + N +V L A + I +TG
Sbjct: 165 NYDEILQDIIKRDYLDSNREVDPLRKAEDAIEIDTTG 201


tr_hit_id Q6BYD8
Definition tr|Q6BYD8|Q6BYD8_DEBHA DEHA2A10340p OS=Debaryomyces hansenii
Align length 180
Score (bit) 43.1
E-value 0.016
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= DK951023|Adiantum capillus-veneris mRNA, clone:
TST38A01NGRL0010_E14, 5'
(667 letters)

Database: uniprot_trembl.fasta
7,341,751 sequences; 2,391,615,440 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

tr|Q6BYD8|Q6BYD8_DEBHA DEHA2A10340p OS=Debaryomyces hansenii GN=... 43 0.016
tr|Q54HZ8|Q54HZ8_DICDI Putative Ca2+ channel OS=Dictyostelium di... 42 0.035
tr|Q29DA4|Q29DA4_DROPS GA18070 OS=Drosophila pseudoobscura pseud... 42 0.035
tr|Q8I446|Q8I446_PLAF7 Putative uncharacterized protein PFE0275w... 40 0.10
tr|Q6CTJ1|Q6CTJ1_KLULA KLLA0C12331p OS=Kluyveromyces lactis GN=K... 40 0.10
tr|Q23RV6|Q23RV6_TETTH Pescadillo N-terminus family protein OS=T... 40 0.13
tr|A3LQY4|A3LQY4_PICST Predicted protein OS=Pichia stipitis GN=P... 40 0.13
tr|Q8IJQ2|Q8IJQ2_PLAF7 Putative uncharacterized protein OS=Plasm... 40 0.17
tr|Q54SX6|Q54SX6_DICDI Putative uncharacterized protein OS=Dicty... 40 0.17
tr|Q4N7P2|Q4N7P2_THEPA Putative uncharacterized protein OS=Theil... 39 0.22
tr|B4N1C6|B4N1C6_DROWI GK24821 OS=Drosophila willistoni GN=GK248... 39 0.22
tr|B3P9H8|B3P9H8_DROER Futsch OS=Drosophila erecta GN=futsch PE=... 39 0.22
tr|Q8IDI9|Q8IDI9_PLAF7 Phosphatidylinositol transfer protein, pu... 39 0.29
tr|Q8ID46|Q8ID46_PLAF7 Putative uncharacterized protein MAL13P1.... 39 0.29
tr|B6N1K1|B6N1K1_BRAFL Putative uncharacterized protein OS=Branc... 39 0.29
tr|A7TAW2|A7TAW2_NEMVE Predicted protein (Fragment) OS=Nematoste... 39 0.29
tr|Q4YF30|Q4YF30_PLABE Putative uncharacterized protein (Fragmen... 39 0.38
tr|Q9U0H2|Q9U0H2_PLAF7 Putative uncharacterized protein PFD0585c... 38 0.50
tr|A3R6S8|A3R6S8_PLAFA Erythrocyte membrane protein 1 (Fragment)... 38 0.50
tr|A2G605|A2G605_TRIVA Putative uncharacterized protein OS=Trich... 38 0.65
tr|A3KND4|A3KND4_XENLA C4SR protein OS=Xenopus laevis GN=C4SR PE... 37 0.85
tr|Q547B5|Q547B5_MOUSE Osteopontin OS=Mus musculus GN=Spp1 PE=2 ... 37 0.85
tr|Q3UZY3|Q3UZY3_MOUSE Putative uncharacterized protein OS=Mus m... 37 0.85
tr|Q3UBR1|Q3UBR1_MOUSE Putative uncharacterized protein OS=Mus m... 37 0.85
tr|Q8IIL1|Q8IIL1_PLAF7 Putative uncharacterized protein OS=Plasm... 37 0.85
tr|Q22A81|Q22A81_TETTH Putative uncharacterized protein OS=Tetra... 37 0.85
tr|B6LWX3|B6LWX3_BRAFL Putative uncharacterized protein OS=Branc... 37 0.85
tr|A2DX13|A2DX13_TRIVA PIKK family atypical protein kinase OS=Tr... 37 0.85
tr|A0DTB8|A0DTB8_PARTE Chromosome undetermined scaffold_62, whol... 37 0.85
tr|A0BCV8|A0BCV8_PARTE Chromosome undetermined scaffold_10, whol... 37 0.85

>tr|Q6BYD8|Q6BYD8_DEBHA DEHA2A10340p OS=Debaryomyces hansenii
GN=DEHA2A10340g PE=4 SV=2
Length = 1050

Score = 43.1 bits (100), Expect = 0.016
Identities = 45/180 (25%), Positives = 72/180 (40%), Gaps = 17/180 (9%)
Frame = +1

Query: 10 GNDTDGIVASPDDVDDAFVHYEADKDDDENEFLDSINNDGQHVEDEVSVNAYADNKVDEF 189
G+D D +D DD E D+DDD+++ D N +H ++ + N V
Sbjct: 415 GDDDDEDDGDDEDEDD---DDEDDEDDDQDDEEDEYNRQNRHDDNLDDIERAQSNLVIPS 471

Query: 190 PD--NGTHISKKLET------ESNEMVH------LITENFANERVERPMQRRKLTYSKRS 327
D G +K+ T E++E+ H +I ++ + +++KL Y K S
Sbjct: 472 SDATGGKKFTKRSNTLDVTPGENHELSHSPTFEKMIKSKMKKKKKPKQTKKQKLKYMK-S 530

Query: 328 FKAGSRKYTFSKGILGSHDVIQQDLIKHDSVQENEKVKSL---VTASQLLSIPSTGRQKT 498
G FS D D D E E KSL ++ + L +P+ GR T
Sbjct: 531 PTVGLNSSLFSPNYNNGSDYDDSDDSDEDDDDEEEDGKSLSKVMSTNYLSWVPTVGRNST 590


>tr|Q54HZ8|Q54HZ8_DICDI Putative Ca2+ channel OS=Dictyostelium
discoideum GN=DDB_0233089 PE=4 SV=1
Length = 2060

Score = 42.0 bits (97), Expect = 0.035
Identities = 21/94 (22%), Positives = 50/94 (53%)
Frame = +1

Query: 46 DVDDAFVHYEADKDDDENEFLDSINNDGQHVEDEVSVNAYADNKVDEFPDNGTHISKKLE 225
D +D ++ + ++E FL+ ++NDG +V +E++ + N +DE P + H K LE
Sbjct: 1032 DDNDNNINDNNNYKNEEKNFLEDVDNDGDNVSNEINQD---KNSIDELPQSQKHQDKSLE 1088

Query: 226 TESNEMVHLITENFANERVERPMQRRKLTYSKRS 327
+ + +H++ N ++ ++++ + + S
Sbjct: 1089 KKQH--IHILHHNHSHIHHHHHRHKKEIEFKEVS 1120


>tr|Q29DA4|Q29DA4_DROPS GA18070 OS=Drosophila pseudoobscura
pseudoobscura GN=GA18070 PE=4 SV=2
Length = 989

Score = 42.0 bits (97), Expect = 0.035
Identities = 47/215 (21%), Positives = 88/215 (40%), Gaps = 19/215 (8%)
Frame = +1

Query: 43 DDVDDAFVHYEA--DKDDDENEFLDSINNDGQHVEDEVSVNAYADNKVDEFPDNGTHISK 216
D+ +DA ++ ++DDDE+ D+ + G + DE +Y K + +G
Sbjct: 392 DEEEDASEESDSNEEEDDDEDSAEDTDTDSGSNESDE----SYETKKKSKRKSSGKPAED 447

Query: 217 KLETESNEMVHLITENFANERVERPMQRRKLTYSKRSFKAG-SRKYTFSKGILGSHDVIQ 393
+ E + + E + + + +R + R SK S + S + + S+ SHD
Sbjct: 448 EEEIPLPDSPLSVGELYKSPKGQRSSRSRSAASSKNSSDSSQSSRSSRSRSKTHSHDSSM 507

Query: 394 QDLIKHDSVQENEKVKSLVTASQLLSIPSTGRQKTSPSETKQIWR--------------- 528
+ + + ++++ S T S+ +P +K SE K
Sbjct: 508 DEDEEDGTHDKHQRSPSTSTRSEERGMPQAADEKPQTSEEKAATAKQPLRSLEEQTPCDD 567

Query: 529 KGEGLSGYIPGQNKQQATENIRLVEQM-EGFYGVV 630
KG L Y PG ++ E + + ++ EG YGVV
Sbjct: 568 KGIPLPNYYPGVQGCRSVEEFQCLNRIEEGTYGVV 602


>tr|Q8I446|Q8I446_PLAF7 Putative uncharacterized protein PFE0275w
OS=Plasmodium falciparum (isolate 3D7) GN=PFE0275w PE=4
SV=1
Length = 333

Score = 40.4 bits (93), Expect = 0.10
Identities = 23/99 (23%), Positives = 52/99 (52%), Gaps = 3/99 (3%)
Frame = +1

Query: 34 ASPDDVDDAFVHYEADKDDDENEFLDSINNDGQHVEDEVSVNAYADNKVDEFPDNGTH-- 207
+S ++ +D FV E D DD++++ ++ NN+ +H +E + + + +N + N H
Sbjct: 11 SSDEEDEDYFVDEENDNDDEDDDDNNNNNNNNEHNNNEHNNDQHNNNVHNNDQHNNNHMK 70

Query: 208 -ISKKLETESNEMVHLITENFANERVERPMQRRKLTYSK 321
I KK + ++ + I ++ E++E+ + L Y +
Sbjct: 71 TIRKKRKGRCKDIKNSIKKSIIKEKIEKTYKDINLEYKQ 109


>tr|Q6CTJ1|Q6CTJ1_KLULA KLLA0C12331p OS=Kluyveromyces lactis
GN=KLLA0C12331g PE=4 SV=1
Length = 662

Score = 40.4 bits (93), Expect = 0.10
Identities = 38/143 (26%), Positives = 65/143 (45%), Gaps = 11/143 (7%)
Frame = +1

Query: 43 DDVDDAFVHYEADKDDDENEFLDSINNDGQHVEDEVSVNAYADNKVDEFPDNG------- 201
D++DDA + ++D+ D+E++ LD + D + EDE +A N D+ NG
Sbjct: 55 DELDDASSNSDSDELDNESDQLDESDEDQEDAEDE--EDAGTGNDADKKESNGVSQHAEQ 112

Query: 202 --THISKKLETESNEMVHLITENFANERVERPMQRRKLTYSKRSFKAGSRKYTFSKGILG 375
T +KL+ +S E V I + RV+ P K K + + ++
Sbjct: 113 RKTLKERKLQRKSGETVQQIKSLWERLRVKNP-PIPKPVREKLCNEIWELSNDCIEDLVL 171

Query: 376 SHDV--IQQDLIKHDSVQENEKV 438
HD I Q L+K+ S + E++
Sbjct: 172 KHDASRIVQTLVKYSSKERREQI 194


>tr|Q23RV6|Q23RV6_TETTH Pescadillo N-terminus family protein
OS=Tetrahymena thermophila SB210 GN=TTHERM_00628420 PE=4
SV=1
Length = 601

Score = 40.0 bits (92), Expect = 0.13
Identities = 29/135 (21%), Positives = 57/135 (42%)
Frame = +1

Query: 43 DDVDDAFVHYEADKDDDENEFLDSINNDGQHVEDEVSVNAYADNKVDEFPDNGTHISKKL 222
+D D+ + E + ++DE E +D D E+EV + D+ D I+
Sbjct: 456 EDEDEEEIEAEENVEEDEEEDIDEEEEDDDEEEEEVDGEEELEEDDDDEEDEEEEINYDE 515

Query: 223 ETESNEMVHLITENFANERVERPMQRRKLTYSKRSFKAGSRKYTFSKGILGSHDVIQQDL 402
E++ ++ E NE Q++K +K+ K + +K ++ + +L
Sbjct: 516 ESDVEDIKKQDVEESENEYDHEKEQQKK---AKKQIKETKEQKELAKALMTRKNKKMYEL 572

Query: 403 IKHDSVQENEKVKSL 447
I+ + +KVK L
Sbjct: 573 IQKSKQDKLQKVKEL 587


>tr|A3LQY4|A3LQY4_PICST Predicted protein OS=Pichia stipitis
GN=PICST_67212 PE=4 SV=2
Length = 1931

Score = 40.0 bits (92), Expect = 0.13
Identities = 29/101 (28%), Positives = 44/101 (43%), Gaps = 9/101 (8%)
Frame = +1

Query: 43 DDVDDAFVHYEADKDDDENEFLDSINNDGQ-------HVEDEVSVNAYADNKVDEFPDNG 201
+D DD YE +DDDE E + DG+ E E V+ DE D
Sbjct: 148 EDYDD---QYEEAEDDDEEENEEDGVEDGEGDLIEILSSEQEEEVSEDESESEDEDEDEE 204

Query: 202 THISKKLETESNEMVHLITEN--FANERVERPMQRRKLTYS 318
H+ K+ E E+ ++L N + N ++ P Q+ + YS
Sbjct: 205 HHVEKEEEPEARPNINLTYPNTQYTNSGIQLPSQKTSIPYS 245


>tr|Q8IJQ2|Q8IJQ2_PLAF7 Putative uncharacterized protein OS=Plasmodium
falciparum (isolate 3D7) GN=PF10_0140 PE=4 SV=1
Length = 2379

Score = 39.7 bits (91), Expect = 0.17
Identities = 32/140 (22%), Positives = 57/140 (40%)
Frame = +1

Query: 16 DTDGIVASPDDVDDAFVHYEADKDDDENEFLDSINNDGQHVEDEVSVNAYADNKVDEFPD 195
D D DD DD + D DDDE++ D ++ D+ + D + D +
Sbjct: 999 DNDDDEDDEDDDDDDDDDDDDDNDDDEDDNDDEDEDEDDDENDDEEDDDDDDEEEDTREE 1058

Query: 196 NGTHISKKLETESNEMVHLITENFANERVERPMQRRKLTYSKRSFKAGSRKYTFSKGILG 375
+I +K + E ++ + ++ + + +RRK + +S + RK
Sbjct: 1059 TDDNICEKEDLEDDDDTYEYSDEDSTHKDRNKKRRRKKRNNNKSKRKRKRK--------S 1110

Query: 376 SHDVIQQDLIKHDSVQENEK 435
HD D DS +EN+K
Sbjct: 1111 KHDDYYDDNENEDSRKENDK 1130


>tr|Q54SX6|Q54SX6_DICDI Putative uncharacterized protein
OS=Dictyostelium discoideum GN=DDB_0205159 PE=4 SV=1
Length = 356

Score = 39.7 bits (91), Expect = 0.17
Identities = 32/126 (25%), Positives = 60/126 (47%), Gaps = 4/126 (3%)
Frame = +1

Query: 106 LDSINNDGQHVEDEVSVNAYADNKVDEFPDNGTHISKKLETESNEMVHLITENF--ANER 279
+ +N + D V N V + + +ISK + T SNE LI ++ E
Sbjct: 1 MSQVNTPNKPKVDSVIPNKKKKGIVFKDTVSSPYISKTINTISNEYSELILKSLKELTEN 60

Query: 280 VERPMQRRKLTYSKRSFKAGSRKYTFS--KGILGSHDVIQQDLIKHDSVQENEKVKSLVT 453
+ +Q +K+ ++ FK K + + K L S + +Q L+K +S+ + +K K ++
Sbjct: 61 EIKNIQNKKVIKKEQFFKVRKEKKSLNKLKNRLKSIEKKKQFLLKDESISKEDKDKEILR 120

Query: 454 ASQLLS 471
+QLL+
Sbjct: 121 QNQLLN 126


>tr|Q4N7P2|Q4N7P2_THEPA Putative uncharacterized protein
OS=Theileria parva GN=TP01_0778 PE=4 SV=1
Length = 635

Score = 39.3 bits (90), Expect = 0.22
Identities = 28/104 (26%), Positives = 52/104 (50%), Gaps = 6/104 (5%)
Frame = +1

Query: 43 DDVDDAFVHYEADKDDDENEFLDSINNDGQHVEDEVS-VNAYADNKVDEFPDNGTHISKK 219
D V DA + DK DDE ++ +NN+G V+++++ +N +K E + SK+
Sbjct: 458 DSVSDAEQEHPEDKSDDELDYNILVNNEGVEVDEQITKLNTLKKDKDQESTELDEMCSKE 517

Query: 220 LETE-----SNEMVHLITENFANERVERPMQRRKLTYSKRSFKA 336
+E E SN+ L+ NF ++ + R + Y++ F +
Sbjct: 518 MEEEVIGIHSNDQSELL--NFDQDKTSEMV--RSVGYTRGDFNS 557